SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20022
         (392 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY071732-1|AAL49354.1|  157|Drosophila melanogaster RH44960p pro...   127   5e-30
AY071136-1|AAL48758.1|  157|Drosophila melanogaster RE17737p pro...   127   5e-30
AE014297-251|AAF52027.1|  157|Drosophila melanogaster CG2099-PA ...   127   5e-30

>AY071732-1|AAL49354.1|  157|Drosophila melanogaster RH44960p
           protein.
          Length = 157

 Score =  127 bits (307), Expect = 5e-30
 Identities = 61/110 (55%), Positives = 75/110 (68%)
 Frame = +2

Query: 8   RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 187
           RL+AKAVFTGYKRGLRNQHEN A+LK+EGA+ +    FY GK CVYVY+A+ +  +P  P
Sbjct: 49  RLFAKAVFTGYKRGLRNQHENQAILKIEGARRKEHGSFYVGKRCVYVYKAETKKCVPQHP 108

Query: 188 RGKKNQAACYLGQGDPPTWQLWRVRAKFKSNLPAQAMGHRIRVMLYPSRI 337
             +K +     G+          VRA+F  NLP  AMGHRIR+MLYPSRI
Sbjct: 109 E-RKTRVRAVWGKVTRIHGNTGAVRARFNRNLPGHAMGHRIRIMLYPSRI 157


>AY071136-1|AAL48758.1|  157|Drosophila melanogaster RE17737p
           protein.
          Length = 157

 Score =  127 bits (307), Expect = 5e-30
 Identities = 61/110 (55%), Positives = 75/110 (68%)
 Frame = +2

Query: 8   RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 187
           RL+AKAVFTGYKRGLRNQHEN A+LK+EGA+ +    FY GK CVYVY+A+ +  +P  P
Sbjct: 49  RLFAKAVFTGYKRGLRNQHENQAILKIEGARRKEHGSFYVGKRCVYVYKAETKKCVPQHP 108

Query: 188 RGKKNQAACYLGQGDPPTWQLWRVRAKFKSNLPAQAMGHRIRVMLYPSRI 337
             +K +     G+          VRA+F  NLP  AMGHRIR+MLYPSRI
Sbjct: 109 E-RKTRVRAVWGKVTRIHGNTGAVRARFNRNLPGHAMGHRIRIMLYPSRI 157


>AE014297-251|AAF52027.1|  157|Drosophila melanogaster CG2099-PA
           protein.
          Length = 157

 Score =  127 bits (307), Expect = 5e-30
 Identities = 61/110 (55%), Positives = 75/110 (68%)
 Frame = +2

Query: 8   RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 187
           RL+AKAVFTGYKRGLRNQHEN A+LK+EGA+ +    FY GK CVYVY+A+ +  +P  P
Sbjct: 49  RLFAKAVFTGYKRGLRNQHENQAILKIEGARRKEHGSFYVGKRCVYVYKAETKKCVPQHP 108

Query: 188 RGKKNQAACYLGQGDPPTWQLWRVRAKFKSNLPAQAMGHRIRVMLYPSRI 337
             +K +     G+          VRA+F  NLP  AMGHRIR+MLYPSRI
Sbjct: 109 E-RKTRVRAVWGKVTRIHGNTGAVRARFNRNLPGHAMGHRIRIMLYPSRI 157


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,316,655
Number of Sequences: 53049
Number of extensions: 398938
Number of successful extensions: 1076
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 1046
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1070
length of database: 24,988,368
effective HSP length: 77
effective length of database: 20,903,595
effective search space used: 1107890535
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -