SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20021
         (476 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY094790-1|AAM11143.1|  184|Drosophila melanogaster LD17235p pro...   191   4e-49
AE013599-2887|AAF57560.1|  184|Drosophila melanogaster CG7726-PA...   191   4e-49
U15643-1|AAC46585.1|  184|Drosophila melanogaster ribosomal prot...   182   2e-46
BT022593-1|AAY55009.1|  163|Drosophila melanogaster IP06777p pro...   129   2e-30
AE014298-1457|AAN09261.3| 2309|Drosophila melanogaster CG17255-P...    29   2.5  
AE014298-1456|AAF46591.4| 2309|Drosophila melanogaster CG17255-P...    29   2.5  
AY069775-1|AAL39920.1| 2171|Drosophila melanogaster SD01562p pro...    29   4.3  
AE013599-2783|AAF57626.1| 2599|Drosophila melanogaster CG15099-P...    29   4.3  
AF132190-1|AAD34778.1| 1398|Drosophila melanogaster unknown prot...    28   5.7  
AE014297-3357|AAN13952.1| 1398|Drosophila melanogaster CG10254-P...    28   5.7  
AE014297-3356|AAF56162.1| 1398|Drosophila melanogaster CG10254-P...    28   5.7  
AE014134-1583|AAO41176.1|  618|Drosophila melanogaster CG32985-P...    28   7.5  

>AY094790-1|AAM11143.1|  184|Drosophila melanogaster LD17235p
           protein.
          Length = 184

 Score =  191 bits (466), Expect = 4e-49
 Identities = 99/141 (70%), Positives = 110/141 (78%), Gaps = 2/141 (1%)
 Frame = +1

Query: 58  DNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVVM 237
           D +KN MR+LHIRKLCLNICVGESGDRLTRAAKVLEQLTG    F +             
Sbjct: 11  DPAKNPMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN 70

Query: 238 KRLLSMYSPR-AKAEEIL-RXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGI 411
           +++    + R AKAEEIL R  KVREYELRR+NFS+TGNFGFGIQEHIDLGIKYDPSIGI
Sbjct: 71  EKIAVHCTVRGAKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGI 130

Query: 412 YGLDFYVVLCRPGFNVAHRRR 474
           YGLDFYVVL RPG+NV HR+R
Sbjct: 131 YGLDFYVVLGRPGYNVNHRKR 151


>AE013599-2887|AAF57560.1|  184|Drosophila melanogaster CG7726-PA
           protein.
          Length = 184

 Score =  191 bits (466), Expect = 4e-49
 Identities = 99/141 (70%), Positives = 110/141 (78%), Gaps = 2/141 (1%)
 Frame = +1

Query: 58  DNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVVM 237
           D +KN MR+LHIRKLCLNICVGESGDRLTRAAKVLEQLTG    F +             
Sbjct: 11  DPAKNPMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN 70

Query: 238 KRLLSMYSPR-AKAEEIL-RXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGI 411
           +++    + R AKAEEIL R  KVREYELRR+NFS+TGNFGFGIQEHIDLGIKYDPSIGI
Sbjct: 71  EKIAVHCTVRGAKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGI 130

Query: 412 YGLDFYVVLCRPGFNVAHRRR 474
           YGLDFYVVL RPG+NV HR+R
Sbjct: 131 YGLDFYVVLGRPGYNVNHRKR 151


>U15643-1|AAC46585.1|  184|Drosophila melanogaster ribosomal protein
           DL11 protein.
          Length = 184

 Score =  182 bits (443), Expect = 2e-46
 Identities = 95/141 (67%), Positives = 107/141 (75%), Gaps = 2/141 (1%)
 Frame = +1

Query: 58  DNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVVM 237
           D ++    +LHIRKLCLNICVGESGDRLTRAAKVLEQLTG    F +             
Sbjct: 11  DPAQEPDEDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN 70

Query: 238 KRLLSMYSPR-AKAEEIL-RXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGI 411
           +++    + R AKAEEIL R  KVREYELRR+NFS+TGNFGFGIQEHIDLGIKYDPSIGI
Sbjct: 71  EKIAVHCTVRGAKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGI 130

Query: 412 YGLDFYVVLCRPGFNVAHRRR 474
           YGLDFYVVL RPG+NV HR+R
Sbjct: 131 YGLDFYVVLGRPGYNVNHRKR 151


>BT022593-1|AAY55009.1|  163|Drosophila melanogaster IP06777p
           protein.
          Length = 163

 Score =  129 bits (312), Expect = 2e-30
 Identities = 61/70 (87%), Positives = 65/70 (92%), Gaps = 1/70 (1%)
 Frame = +1

Query: 268 AKAEEIL-RXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLCR 444
           AKAEEIL R  KVREYELRR+NFS+TGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVL R
Sbjct: 61  AKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 120

Query: 445 PGFNVAHRRR 474
           PG+NV HR+R
Sbjct: 121 PGYNVNHRKR 130



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 20/41 (48%), Positives = 23/41 (56%)
 Frame = +3

Query: 147 CRQGVGATHRKQPVFSKARYTVRSFGIRRNEKIAVHVQSEG 269
           C +  GA   +    +  R  VRSFGIRRNEKIAVH    G
Sbjct: 20  CTEDPGAQPNEPNERTHLRRCVRSFGIRRNEKIAVHCTVRG 60


>AE014298-1457|AAN09261.3| 2309|Drosophila melanogaster CG17255-PB,
            isoform B protein.
          Length = 2309

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 14/31 (45%), Positives = 16/31 (51%)
 Frame = +1

Query: 124  ESGDRLTRAAKVLEQLTGNSLYFPRLGIQCG 216
            ES D+   A KV E  +GN    PR G  CG
Sbjct: 1054 ESDDKAKSAGKVEEDKSGNKRVSPRSGAACG 1084


>AE014298-1456|AAF46591.4| 2309|Drosophila melanogaster CG17255-PA,
            isoform A protein.
          Length = 2309

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 14/31 (45%), Positives = 16/31 (51%)
 Frame = +1

Query: 124  ESGDRLTRAAKVLEQLTGNSLYFPRLGIQCG 216
            ES D+   A KV E  +GN    PR G  CG
Sbjct: 1054 ESDDKAKSAGKVEEDKSGNKRVSPRSGAACG 1084


>AY069775-1|AAL39920.1| 2171|Drosophila melanogaster SD01562p
           protein.
          Length = 2171

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = -3

Query: 171 ELLQHLGGTSQPVTGFTNTDVQAKLSDMKIPHYI 70
           ELL HLG   Q   GF  T ++  L  + +PHY+
Sbjct: 626 ELLWHLGRDKQTARGFEKTLLKV-LDTLALPHYM 658


>AE013599-2783|AAF57626.1| 2599|Drosophila melanogaster CG15099-PA
            protein.
          Length = 2599

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = -3

Query: 171  ELLQHLGGTSQPVTGFTNTDVQAKLSDMKIPHYI 70
            ELL HLG   Q   GF  T ++  L  + +PHY+
Sbjct: 1054 ELLWHLGRDKQTARGFEKTLLKV-LDTLALPHYM 1086


>AF132190-1|AAD34778.1| 1398|Drosophila melanogaster unknown
           protein.
          Length = 1398

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 16/44 (36%), Positives = 23/44 (52%)
 Frame = +1

Query: 40  GEEGSEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQL 171
           G +GSED+ +    N HI     +  +    DR T A KVLE++
Sbjct: 722 GSDGSEDSWETESENSHISSSDNDDDILTGIDRATEAMKVLEKM 765


>AE014297-3357|AAN13952.1| 1398|Drosophila melanogaster CG10254-PB,
           isoform B protein.
          Length = 1398

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 16/44 (36%), Positives = 23/44 (52%)
 Frame = +1

Query: 40  GEEGSEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQL 171
           G +GSED+ +    N HI     +  +    DR T A KVLE++
Sbjct: 722 GSDGSEDSWETESENSHISSSDNDDDILTGIDRATEAMKVLEKM 765


>AE014297-3356|AAF56162.1| 1398|Drosophila melanogaster CG10254-PA,
           isoform A protein.
          Length = 1398

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 16/44 (36%), Positives = 23/44 (52%)
 Frame = +1

Query: 40  GEEGSEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQL 171
           G +GSED+ +    N HI     +  +    DR T A KVLE++
Sbjct: 722 GSDGSEDSWETESENSHISSSDNDDDILTGIDRATEAMKVLEKM 765


>AE014134-1583|AAO41176.1|  618|Drosophila melanogaster CG32985-PA
           protein.
          Length = 618

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = -3

Query: 291 SKDLFCFSPRTVHGQQSFHYDG 226
           + D  CF  + ++GQ + HYDG
Sbjct: 88  TNDFACFYQKIIYGQSAEHYDG 109


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,737,183
Number of Sequences: 53049
Number of extensions: 426561
Number of successful extensions: 1130
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1108
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1124
length of database: 24,988,368
effective HSP length: 79
effective length of database: 20,797,497
effective search space used: 1643002263
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -