SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20020
         (716 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY122128-1|AAM52640.1| 1188|Drosophila melanogaster GH22749p pro...    30   3.6  
AE014296-2482|AAN11790.1| 1188|Drosophila melanogaster CG12316-P...    30   3.6  
AE014296-2481|AAF49660.1| 1188|Drosophila melanogaster CG12316-P...    30   3.6  

>AY122128-1|AAM52640.1| 1188|Drosophila melanogaster GH22749p protein.
          Length = 1188

 Score = 29.9 bits (64), Expect = 3.6
 Identities = 21/84 (25%), Positives = 46/84 (54%), Gaps = 7/84 (8%)
 Frame = +3

Query: 297  QDVNVRR*NASERLQPIRSFTLKVKRSKRALTSLDSPS-----FANNAKKQLSAER--QR 455
            QD++  R +A  +L  IR     +K  KR+L + ++PS      + N+ ++L  ++  Q+
Sbjct: 771  QDLDTIRKSAPHKLPIIRLKRCNLKTQKRSLKAEEAPSVQEDILSMNSDRELQEQKKAQK 830

Query: 456  KNLKKILQLKKGRQSSLY*LQEEI 527
               K+  +++K +++  Y  ++EI
Sbjct: 831  PKRKRYKKVQKEQENEKYLREQEI 854


>AE014296-2482|AAN11790.1| 1188|Drosophila melanogaster CG12316-PB,
            isoform B protein.
          Length = 1188

 Score = 29.9 bits (64), Expect = 3.6
 Identities = 21/84 (25%), Positives = 46/84 (54%), Gaps = 7/84 (8%)
 Frame = +3

Query: 297  QDVNVRR*NASERLQPIRSFTLKVKRSKRALTSLDSPS-----FANNAKKQLSAER--QR 455
            QD++  R +A  +L  IR     +K  KR+L + ++PS      + N+ ++L  ++  Q+
Sbjct: 771  QDLDTIRKSAPHKLPIIRLKRCNLKTQKRSLKAEEAPSVQEDILSMNSDRELQEQKKAQK 830

Query: 456  KNLKKILQLKKGRQSSLY*LQEEI 527
               K+  +++K +++  Y  ++EI
Sbjct: 831  PKRKRYKKVQKEQENEKYLREQEI 854


>AE014296-2481|AAF49660.1| 1188|Drosophila melanogaster CG12316-PA,
            isoform A protein.
          Length = 1188

 Score = 29.9 bits (64), Expect = 3.6
 Identities = 21/84 (25%), Positives = 46/84 (54%), Gaps = 7/84 (8%)
 Frame = +3

Query: 297  QDVNVRR*NASERLQPIRSFTLKVKRSKRALTSLDSPS-----FANNAKKQLSAER--QR 455
            QD++  R +A  +L  IR     +K  KR+L + ++PS      + N+ ++L  ++  Q+
Sbjct: 771  QDLDTIRKSAPHKLPIIRLKRCNLKTQKRSLKAEEAPSVQEDILSMNSDRELQEQKKAQK 830

Query: 456  KNLKKILQLKKGRQSSLY*LQEEI 527
               K+  +++K +++  Y  ++EI
Sbjct: 831  PKRKRYKKVQKEQENEKYLREQEI 854


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,189,451
Number of Sequences: 53049
Number of extensions: 247353
Number of successful extensions: 803
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 764
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 803
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3190721655
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -