SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20019
         (587 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X51549-1|CAA35924.1| 1394|Drosophila melanogaster protein ( Dros...   199   2e-51
X51548-1|CAA35923.1| 1237|Drosophila melanogaster protein ( Dros...   199   2e-51
AE014296-2992|AAN11689.1|  906|Drosophila melanogaster CG8127-PD...   199   2e-51
AE014296-2991|AAN11688.1| 1355|Drosophila melanogaster CG8127-PA...   199   2e-51
AE014296-2990|AAN11687.1| 1199|Drosophila melanogaster CG8127-PC...   199   2e-51
AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB...   199   2e-51
X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein ( D.me...   153   2e-37
X98882-1|CAA67385.1|  391|Drosophila melanogaster nuclear hormon...    37   0.018
X98881-1|CAA67384.1|  865|Drosophila melanogaster nuclear hormon...    37   0.018
AF238309-1|AAF69495.1|  385|Drosophila melanogaster nuclear rece...    37   0.018
AF238308-1|AAF69494.1|  866|Drosophila melanogaster nuclear rece...    37   0.018
AE014296-3500|AAS65087.1|  338|Drosophila melanogaster CG18023-P...    37   0.018
AE014296-3499|AAN12161.3|  392|Drosophila melanogaster CG18023-P...    37   0.018
AE014296-3498|AAF51692.2|  862|Drosophila melanogaster CG18023-P...    37   0.018
U01088-1|AAA19976.2|  390|Drosophila melanogaster truncated nucl...    34   0.16 
U01087-1|AAA19975.1|  864|Drosophila melanogaster nuclear hormon...    34   0.16 
M90806-1|AAA28461.1|  487|Drosophila melanogaster DHR3 protein.        34   0.16 
AY094723-1|AAM11076.1|  444|Drosophila melanogaster GH21112p pro...    34   0.16 
AE013599-1047|AAF58826.1|  487|Drosophila melanogaster CG33183-P...    34   0.16 
AE013599-1046|AAO41454.1|  444|Drosophila melanogaster CG33183-P...    34   0.16 
AE013599-1045|AAO41453.1|  694|Drosophila melanogaster CG33183-P...    34   0.16 
X05939-1|CAA29373.1|  657|Drosophila melanogaster protein ( Dros...    29   4.7  
M11281-1|AAA70367.1|  441|Drosophila melanogaster Myb protein.         29   4.7  
BT003262-1|AAO25019.1|  657|Drosophila melanogaster LD22943p pro...    29   4.7  
AE014298-2256|AAS65358.1|  657|Drosophila melanogaster CG9045-PE...    29   4.7  
AE014298-2255|AAS65357.1|  657|Drosophila melanogaster CG9045-PD...    29   4.7  
AE014298-2254|AAS65356.1|  657|Drosophila melanogaster CG9045-PC...    29   4.7  
AE014298-2253|AAS65355.1|  657|Drosophila melanogaster CG9045-PB...    29   4.7  
AE014298-2252|AAF48529.1|  657|Drosophila melanogaster CG9045-PA...    29   4.7  
AY094778-1|AAM11131.1|  570|Drosophila melanogaster LD09231p pro...    28   8.2  
AE014297-2310|AAF55387.2|  570|Drosophila melanogaster CG5175-PB...    28   8.2  
AE014297-2309|AAN13733.1|  570|Drosophila melanogaster CG5175-PA...    28   8.2  

>X51549-1|CAA35924.1| 1394|Drosophila melanogaster protein (
            Drosophila mRNA forecdysone-inducible gene E75B. ).
          Length = 1394

 Score =  199 bits (486), Expect = 2e-51
 Identities = 110/187 (58%), Positives = 134/187 (71%), Gaps = 5/187 (2%)
 Frame = +2

Query: 8    RLLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTL-ACPLNPAPELQSEKEFSQRF 184
            RLLA V+RAHL+TCEFT+++V++MR RARDCP+YS PTL ACPLNPAPELQSE+EFSQRF
Sbjct: 512  RLLAAVLRAHLETCEFTKEKVSAMRQRARDCPSYSMPTLLACPLNPAPELQSEQEFSQRF 571

Query: 185  AHVIRGVIDFAGLIPGFQLLTQDEIHAAQKWSV--RCIVRATHLYV*RSS**YHLSQWAT 358
            AHVIRGVIDFAG+IPGFQLLTQD+     K  +     VR   ++    +    L+    
Sbjct: 572  AHVIRGVIDFAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVM 631

Query: 359  DEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLFW--XXXXXXRIGLLRNIELVE 532
              + +       +FLVDSTF FAERMNSMNLTDAEIGLF         R G LRN+EL+E
Sbjct: 632  RRDAIQ-NGANARFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITPDRPG-LRNLELIE 689

Query: 533  RMHSRLR 553
            +M+SRL+
Sbjct: 690  KMYSRLK 696



 Score = 90.2 bits (214), Expect = 2e-18
 Identities = 40/49 (81%), Positives = 47/49 (95%)
 Frame = +3

Query: 255 KFTLLKSGLFDALFVRLICMFDAPLNSIICLNGQLMKRDSIQSGANASF 401
           KFTLLK+GLFDALFVRLICMFD+ +NSIICLNGQ+M+RD+IQ+GANA F
Sbjct: 596 KFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVMRRDAIQNGANARF 644



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 1/39 (2%)
 Frame = +1

Query: 472 FLAIVLITPDRPAAKH-RASGKNALATKACLQTVIAQNR 585
           F AIVLITPDRP  ++     K     K CLQ ++AQNR
Sbjct: 669 FCAIVLITPDRPGLRNLELIEKMYSRLKGCLQYIVAQNR 707


>X51548-1|CAA35923.1| 1237|Drosophila melanogaster protein (
           Drosophila mRNA forecdysone-inducible gene E75A. ).
          Length = 1237

 Score =  199 bits (486), Expect = 2e-51
 Identities = 110/187 (58%), Positives = 134/187 (71%), Gaps = 5/187 (2%)
 Frame = +2

Query: 8   RLLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTL-ACPLNPAPELQSEKEFSQRF 184
           RLLA V+RAHL+TCEFT+++V++MR RARDCP+YS PTL ACPLNPAPELQSE+EFSQRF
Sbjct: 355 RLLAAVLRAHLETCEFTKEKVSAMRQRARDCPSYSMPTLLACPLNPAPELQSEQEFSQRF 414

Query: 185 AHVIRGVIDFAGLIPGFQLLTQDEIHAAQKWSV--RCIVRATHLYV*RSS**YHLSQWAT 358
           AHVIRGVIDFAG+IPGFQLLTQD+     K  +     VR   ++    +    L+    
Sbjct: 415 AHVIRGVIDFAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVM 474

Query: 359 DEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLFW--XXXXXXRIGLLRNIELVE 532
             + +       +FLVDSTF FAERMNSMNLTDAEIGLF         R G LRN+EL+E
Sbjct: 475 RRDAIQ-NGANARFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITPDRPG-LRNLELIE 532

Query: 533 RMHSRLR 553
           +M+SRL+
Sbjct: 533 KMYSRLK 539



 Score = 90.2 bits (214), Expect = 2e-18
 Identities = 40/49 (81%), Positives = 47/49 (95%)
 Frame = +3

Query: 255 KFTLLKSGLFDALFVRLICMFDAPLNSIICLNGQLMKRDSIQSGANASF 401
           KFTLLK+GLFDALFVRLICMFD+ +NSIICLNGQ+M+RD+IQ+GANA F
Sbjct: 439 KFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVMRRDAIQNGANARF 487



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 1/39 (2%)
 Frame = +1

Query: 472 FLAIVLITPDRPAAKH-RASGKNALATKACLQTVIAQNR 585
           F AIVLITPDRP  ++     K     K CLQ ++AQNR
Sbjct: 512 FCAIVLITPDRPGLRNLELIEKMYSRLKGCLQYIVAQNR 550


>AE014296-2992|AAN11689.1|  906|Drosophila melanogaster CG8127-PD,
           isoform D protein.
          Length = 906

 Score =  199 bits (486), Expect = 2e-51
 Identities = 110/187 (58%), Positives = 134/187 (71%), Gaps = 5/187 (2%)
 Frame = +2

Query: 8   RLLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTL-ACPLNPAPELQSEKEFSQRF 184
           RLLA V+RAHL+TCEFT+++V++MR RARDCP+YS PTL ACPLNPAPELQSE+EFSQRF
Sbjct: 62  RLLAAVLRAHLETCEFTKEKVSAMRQRARDCPSYSMPTLLACPLNPAPELQSEQEFSQRF 121

Query: 185 AHVIRGVIDFAGLIPGFQLLTQDEIHAAQKWSV--RCIVRATHLYV*RSS**YHLSQWAT 358
           AHVIRGVIDFAG+IPGFQLLTQD+     K  +     VR   ++    +    L+    
Sbjct: 122 AHVIRGVIDFAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVM 181

Query: 359 DEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLFW--XXXXXXRIGLLRNIELVE 532
             + +       +FLVDSTF FAERMNSMNLTDAEIGLF         R G LRN+EL+E
Sbjct: 182 RRDAIQ-NGANARFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITPDRPG-LRNLELIE 239

Query: 533 RMHSRLR 553
           +M+SRL+
Sbjct: 240 KMYSRLK 246



 Score = 90.2 bits (214), Expect = 2e-18
 Identities = 40/49 (81%), Positives = 47/49 (95%)
 Frame = +3

Query: 255 KFTLLKSGLFDALFVRLICMFDAPLNSIICLNGQLMKRDSIQSGANASF 401
           KFTLLK+GLFDALFVRLICMFD+ +NSIICLNGQ+M+RD+IQ+GANA F
Sbjct: 146 KFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVMRRDAIQNGANARF 194



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 1/39 (2%)
 Frame = +1

Query: 472 FLAIVLITPDRPAAKH-RASGKNALATKACLQTVIAQNR 585
           F AIVLITPDRP  ++     K     K CLQ ++AQNR
Sbjct: 219 FCAIVLITPDRPGLRNLELIEKMYSRLKGCLQYIVAQNR 257


>AE014296-2991|AAN11688.1| 1355|Drosophila melanogaster CG8127-PA,
            isoform A protein.
          Length = 1355

 Score =  199 bits (486), Expect = 2e-51
 Identities = 110/187 (58%), Positives = 134/187 (71%), Gaps = 5/187 (2%)
 Frame = +2

Query: 8    RLLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTL-ACPLNPAPELQSEKEFSQRF 184
            RLLA V+RAHL+TCEFT+++V++MR RARDCP+YS PTL ACPLNPAPELQSE+EFSQRF
Sbjct: 511  RLLAAVLRAHLETCEFTKEKVSAMRQRARDCPSYSMPTLLACPLNPAPELQSEQEFSQRF 570

Query: 185  AHVIRGVIDFAGLIPGFQLLTQDEIHAAQKWSV--RCIVRATHLYV*RSS**YHLSQWAT 358
            AHVIRGVIDFAG+IPGFQLLTQD+     K  +     VR   ++    +    L+    
Sbjct: 571  AHVIRGVIDFAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVM 630

Query: 359  DEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLFW--XXXXXXRIGLLRNIELVE 532
              + +       +FLVDSTF FAERMNSMNLTDAEIGLF         R G LRN+EL+E
Sbjct: 631  RRDAIQ-NGANARFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITPDRPG-LRNLELIE 688

Query: 533  RMHSRLR 553
            +M+SRL+
Sbjct: 689  KMYSRLK 695



 Score = 90.2 bits (214), Expect = 2e-18
 Identities = 40/49 (81%), Positives = 47/49 (95%)
 Frame = +3

Query: 255 KFTLLKSGLFDALFVRLICMFDAPLNSIICLNGQLMKRDSIQSGANASF 401
           KFTLLK+GLFDALFVRLICMFD+ +NSIICLNGQ+M+RD+IQ+GANA F
Sbjct: 595 KFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVMRRDAIQNGANARF 643



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 1/39 (2%)
 Frame = +1

Query: 472 FLAIVLITPDRPAAKH-RASGKNALATKACLQTVIAQNR 585
           F AIVLITPDRP  ++     K     K CLQ ++AQNR
Sbjct: 668 FCAIVLITPDRPGLRNLELIEKMYSRLKGCLQYIVAQNR 706


>AE014296-2990|AAN11687.1| 1199|Drosophila melanogaster CG8127-PC,
           isoform C protein.
          Length = 1199

 Score =  199 bits (486), Expect = 2e-51
 Identities = 110/187 (58%), Positives = 134/187 (71%), Gaps = 5/187 (2%)
 Frame = +2

Query: 8   RLLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTL-ACPLNPAPELQSEKEFSQRF 184
           RLLA V+RAHL+TCEFT+++V++MR RARDCP+YS PTL ACPLNPAPELQSE+EFSQRF
Sbjct: 355 RLLAAVLRAHLETCEFTKEKVSAMRQRARDCPSYSMPTLLACPLNPAPELQSEQEFSQRF 414

Query: 185 AHVIRGVIDFAGLIPGFQLLTQDEIHAAQKWSV--RCIVRATHLYV*RSS**YHLSQWAT 358
           AHVIRGVIDFAG+IPGFQLLTQD+     K  +     VR   ++    +    L+    
Sbjct: 415 AHVIRGVIDFAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVM 474

Query: 359 DEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLFW--XXXXXXRIGLLRNIELVE 532
             + +       +FLVDSTF FAERMNSMNLTDAEIGLF         R G LRN+EL+E
Sbjct: 475 RRDAIQ-NGANARFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITPDRPG-LRNLELIE 532

Query: 533 RMHSRLR 553
           +M+SRL+
Sbjct: 533 KMYSRLK 539



 Score = 90.2 bits (214), Expect = 2e-18
 Identities = 40/49 (81%), Positives = 47/49 (95%)
 Frame = +3

Query: 255 KFTLLKSGLFDALFVRLICMFDAPLNSIICLNGQLMKRDSIQSGANASF 401
           KFTLLK+GLFDALFVRLICMFD+ +NSIICLNGQ+M+RD+IQ+GANA F
Sbjct: 439 KFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVMRRDAIQNGANARF 487



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 1/39 (2%)
 Frame = +1

Query: 472 FLAIVLITPDRPAAKH-RASGKNALATKACLQTVIAQNR 585
           F AIVLITPDRP  ++     K     K CLQ ++AQNR
Sbjct: 512 FCAIVLITPDRPGLRNLELIEKMYSRLKGCLQYIVAQNR 550


>AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB,
            isoform B protein.
          Length = 1412

 Score =  199 bits (486), Expect = 2e-51
 Identities = 110/187 (58%), Positives = 134/187 (71%), Gaps = 5/187 (2%)
 Frame = +2

Query: 8    RLLARVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTL-ACPLNPAPELQSEKEFSQRF 184
            RLLA V+RAHL+TCEFT+++V++MR RARDCP+YS PTL ACPLNPAPELQSE+EFSQRF
Sbjct: 568  RLLAAVLRAHLETCEFTKEKVSAMRQRARDCPSYSMPTLLACPLNPAPELQSEQEFSQRF 627

Query: 185  AHVIRGVIDFAGLIPGFQLLTQDEIHAAQKWSV--RCIVRATHLYV*RSS**YHLSQWAT 358
            AHVIRGVIDFAG+IPGFQLLTQD+     K  +     VR   ++    +    L+    
Sbjct: 628  AHVIRGVIDFAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVM 687

Query: 359  DEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLFW--XXXXXXRIGLLRNIELVE 532
              + +       +FLVDSTF FAERMNSMNLTDAEIGLF         R G LRN+EL+E
Sbjct: 688  RRDAIQ-NGANARFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITPDRPG-LRNLELIE 745

Query: 533  RMHSRLR 553
            +M+SRL+
Sbjct: 746  KMYSRLK 752



 Score = 90.2 bits (214), Expect = 2e-18
 Identities = 40/49 (81%), Positives = 47/49 (95%)
 Frame = +3

Query: 255 KFTLLKSGLFDALFVRLICMFDAPLNSIICLNGQLMKRDSIQSGANASF 401
           KFTLLK+GLFDALFVRLICMFD+ +NSIICLNGQ+M+RD+IQ+GANA F
Sbjct: 652 KFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVMRRDAIQNGANARF 700



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 1/39 (2%)
 Frame = +1

Query: 472 FLAIVLITPDRPAAKH-RASGKNALATKACLQTVIAQNR 585
           F AIVLITPDRP  ++     K     K CLQ ++AQNR
Sbjct: 725 FCAIVLITPDRPGLRNLELIEKMYSRLKGCLQYIVAQNR 763


>X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein (
            D.melanogaster 75B mRNAencoding hypothetical 75B protein.
            ).
          Length = 1443

 Score =  153 bits (370), Expect = 2e-37
 Identities = 91/178 (51%), Positives = 114/178 (64%), Gaps = 4/178 (2%)
 Frame = +2

Query: 32   AHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAHVIRGVID 211
            AHL+TCEFT+++V++MR   R  P+    T      PAPELQSE+EFSQRFAHVIRGVID
Sbjct: 572  AHLETCEFTKEKVSAMR-HGRGLPSTPCHTSGLSAEPAPELQSEQEFSQRFAHVIRGVID 630

Query: 212  FAGLIPGFQLLTQDEIHAAQKWSV--RCIVRATHLYV*RSS**YHLSQWATDEERLHPER 385
            FAG+IPGFQLLTQD+     K  +     VR   ++    +    L+      + +    
Sbjct: 631  FAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVMRRDAIQ-NG 689

Query: 386  CQCKFLVDSTFKFAERMNSMNLTDAEIGLFW--XXXXXXRIGLLRNIELVERMHSRLR 553
               +FLVDSTF FAERMNSMNLTDAEIGLF         R G LRN+EL+E+M+SRL+
Sbjct: 690  ANARFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITPDRPG-LRNLELIEKMYSRLK 746



 Score = 90.2 bits (214), Expect = 2e-18
 Identities = 40/49 (81%), Positives = 47/49 (95%)
 Frame = +3

Query: 255 KFTLLKSGLFDALFVRLICMFDAPLNSIICLNGQLMKRDSIQSGANASF 401
           KFTLLK+GLFDALFVRLICMFD+ +NSIICLNGQ+M+RD+IQ+GANA F
Sbjct: 646 KFTLLKAGLFDALFVRLICMFDSSINSIICLNGQVMRRDAIQNGANARF 694



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 1/39 (2%)
 Frame = +1

Query: 472 FLAIVLITPDRPAAKH-RASGKNALATKACLQTVIAQNR 585
           F AIVLITPDRP  ++     K     K CLQ ++AQNR
Sbjct: 719 FCAIVLITPDRPGLRNLELIEKMYSRLKGCLQYIVAQNR 757


>X98882-1|CAA67385.1|  391|Drosophila melanogaster nuclear hormone
           receptor protein.
          Length = 391

 Score = 37.1 bits (82), Expect = 0.018
 Identities = 39/156 (25%), Positives = 64/156 (41%), Gaps = 5/156 (3%)
 Frame = +2

Query: 23  VVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAHVIRG 202
           V +AH   C +T +    +  R    P     +         ++   ++FS R    ++ 
Sbjct: 145 VSQAHRLNCSYTEELTRELMRRPVTVPQNGIASTVAESLEFQKIWLWQQFSARVTPGVQR 204

Query: 203 VIDFAGLIPGFQLLTQDEIHAAQKWSVRCIVRATHLYV*RSS**YHLSQWATDEERLHPE 382
           +++FA  +PGF   TQD+     K      V  TH+    +          T ++  +  
Sbjct: 205 IVEFAKRVPGFCDFTQDDQLILIKLGF-FEVWLTHVARLIN------EATLTLDDGAYLT 257

Query: 383 RCQCKFLVDSTF-----KFAERMNSMNLTDAEIGLF 475
           R Q + L DS F      FA  +N+  L+D EIGLF
Sbjct: 258 RQQLEILYDSDFVNALLNFANTLNAYGLSDTEIGLF 293


>X98881-1|CAA67384.1|  865|Drosophila melanogaster nuclear hormone
            receptor protein.
          Length = 865

 Score = 37.1 bits (82), Expect = 0.018
 Identities = 39/156 (25%), Positives = 64/156 (41%), Gaps = 5/156 (3%)
 Frame = +2

Query: 23   VVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAHVIRG 202
            V +AH   C +T +    +  R    P     +         ++   ++FS R    ++ 
Sbjct: 619  VSQAHRLNCSYTEELTRELMRRPVTVPQNGIASTVAESLEFQKIWLWQQFSARVTPGVQR 678

Query: 203  VIDFAGLIPGFQLLTQDEIHAAQKWSVRCIVRATHLYV*RSS**YHLSQWATDEERLHPE 382
            +++FA  +PGF   TQD+     K      V  TH+    +          T ++  +  
Sbjct: 679  IVEFAKRVPGFCDFTQDDQLILIKLGF-FEVWLTHVARLIN------EATLTLDDGAYLT 731

Query: 383  RCQCKFLVDSTF-----KFAERMNSMNLTDAEIGLF 475
            R Q + L DS F      FA  +N+  L+D EIGLF
Sbjct: 732  RQQLEILYDSDFVNALLNFANTLNAYGLSDTEIGLF 767


>AF238309-1|AAF69495.1|  385|Drosophila melanogaster nuclear
           receptor E78B protein.
          Length = 385

 Score = 37.1 bits (82), Expect = 0.018
 Identities = 39/156 (25%), Positives = 64/156 (41%), Gaps = 5/156 (3%)
 Frame = +2

Query: 23  VVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAHVIRG 202
           V +AH   C +T +    +  R    P     +         ++   ++FS R    ++ 
Sbjct: 139 VSQAHRLNCSYTEELTRELMRRPVTVPQNGIASTVAESLEFQKIWLWQQFSARVTPGVQR 198

Query: 203 VIDFAGLIPGFQLLTQDEIHAAQKWSVRCIVRATHLYV*RSS**YHLSQWATDEERLHPE 382
           +++FA  +PGF   TQD+     K      V  TH+    +          T ++  +  
Sbjct: 199 IVEFAKRVPGFCDFTQDDQLILIKLGF-FEVWLTHVARLIN------EATLTLDDGAYLT 251

Query: 383 RCQCKFLVDSTF-----KFAERMNSMNLTDAEIGLF 475
           R Q + L DS F      FA  +N+  L+D EIGLF
Sbjct: 252 RQQLEILYDSDFVNALLNFANTLNAYGLSDTEIGLF 287


>AF238308-1|AAF69494.1|  866|Drosophila melanogaster nuclear receptor
            E78A protein.
          Length = 866

 Score = 37.1 bits (82), Expect = 0.018
 Identities = 39/156 (25%), Positives = 64/156 (41%), Gaps = 5/156 (3%)
 Frame = +2

Query: 23   VVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAHVIRG 202
            V +AH   C +T +    +  R    P     +         ++   ++FS R    ++ 
Sbjct: 620  VSQAHRLNCSYTEELTRELMRRPVTVPQNGIASTVAESLEFQKIWLWQQFSARVTPGVQR 679

Query: 203  VIDFAGLIPGFQLLTQDEIHAAQKWSVRCIVRATHLYV*RSS**YHLSQWATDEERLHPE 382
            +++FA  +PGF   TQD+     K      V  TH+    +          T ++  +  
Sbjct: 680  IVEFAKRVPGFCDFTQDDQLILIKLGF-FEVWLTHVARLIN------EATLTLDDGAYLT 732

Query: 383  RCQCKFLVDSTF-----KFAERMNSMNLTDAEIGLF 475
            R Q + L DS F      FA  +N+  L+D EIGLF
Sbjct: 733  RQQLEILYDSDFVNALLNFANTLNAYGLSDTEIGLF 768


>AE014296-3500|AAS65087.1|  338|Drosophila melanogaster CG18023-PC,
           isoform C protein.
          Length = 338

 Score = 37.1 bits (82), Expect = 0.018
 Identities = 39/156 (25%), Positives = 64/156 (41%), Gaps = 5/156 (3%)
 Frame = +2

Query: 23  VVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAHVIRG 202
           V +AH   C +T +    +  R    P     +         ++   ++FS R    ++ 
Sbjct: 92  VSQAHRLNCSYTEELTRELMRRPVTVPQNGIASTVAESLEFQKIWLWQQFSARVTPGVQR 151

Query: 203 VIDFAGLIPGFQLLTQDEIHAAQKWSVRCIVRATHLYV*RSS**YHLSQWATDEERLHPE 382
           +++FA  +PGF   TQD+     K      V  TH+    +          T ++  +  
Sbjct: 152 IVEFAKRVPGFCDFTQDDQLILIKLGF-FEVWLTHVARLIN------EATLTLDDGAYLT 204

Query: 383 RCQCKFLVDSTF-----KFAERMNSMNLTDAEIGLF 475
           R Q + L DS F      FA  +N+  L+D EIGLF
Sbjct: 205 RQQLEILYDSDFVNALLNFANTLNAYGLSDTEIGLF 240


>AE014296-3499|AAN12161.3|  392|Drosophila melanogaster CG18023-PB,
           isoform B protein.
          Length = 392

 Score = 37.1 bits (82), Expect = 0.018
 Identities = 39/156 (25%), Positives = 64/156 (41%), Gaps = 5/156 (3%)
 Frame = +2

Query: 23  VVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAHVIRG 202
           V +AH   C +T +    +  R    P     +         ++   ++FS R    ++ 
Sbjct: 146 VSQAHRLNCSYTEELTRELMRRPVTVPQNGIASTVAESLEFQKIWLWQQFSARVTPGVQR 205

Query: 203 VIDFAGLIPGFQLLTQDEIHAAQKWSVRCIVRATHLYV*RSS**YHLSQWATDEERLHPE 382
           +++FA  +PGF   TQD+     K      V  TH+    +          T ++  +  
Sbjct: 206 IVEFAKRVPGFCDFTQDDQLILIKLGF-FEVWLTHVARLIN------EATLTLDDGAYLT 258

Query: 383 RCQCKFLVDSTF-----KFAERMNSMNLTDAEIGLF 475
           R Q + L DS F      FA  +N+  L+D EIGLF
Sbjct: 259 RQQLEILYDSDFVNALLNFANTLNAYGLSDTEIGLF 294


>AE014296-3498|AAF51692.2|  862|Drosophila melanogaster CG18023-PA,
            isoform A protein.
          Length = 862

 Score = 37.1 bits (82), Expect = 0.018
 Identities = 39/156 (25%), Positives = 64/156 (41%), Gaps = 5/156 (3%)
 Frame = +2

Query: 23   VVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAHVIRG 202
            V +AH   C +T +    +  R    P     +         ++   ++FS R    ++ 
Sbjct: 616  VSQAHRLNCSYTEELTRELMRRPVTVPQNGIASTVAESLEFQKIWLWQQFSARVTPGVQR 675

Query: 203  VIDFAGLIPGFQLLTQDEIHAAQKWSVRCIVRATHLYV*RSS**YHLSQWATDEERLHPE 382
            +++FA  +PGF   TQD+     K      V  TH+    +          T ++  +  
Sbjct: 676  IVEFAKRVPGFCDFTQDDQLILIKLGF-FEVWLTHVARLIN------EATLTLDDGAYLT 728

Query: 383  RCQCKFLVDSTF-----KFAERMNSMNLTDAEIGLF 475
            R Q + L DS F      FA  +N+  L+D EIGLF
Sbjct: 729  RQQLEILYDSDFVNALLNFANTLNAYGLSDTEIGLF 764


>U01088-1|AAA19976.2|  390|Drosophila melanogaster truncated nuclear
           hormone receptorsuperfamily protein protein.
          Length = 390

 Score = 33.9 bits (74), Expect = 0.16
 Identities = 38/152 (25%), Positives = 62/152 (40%)
 Frame = +2

Query: 20  RVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAHVIR 199
           RV  A L+ C +T +    +  R    P     +         ++   ++FS R    ++
Sbjct: 145 RVAGAPLN-CSYTEELTRELMRRPVTVPQNGIASTVAESLEFQKIWLWQQFSARVTPGVQ 203

Query: 200 GVIDFAGLIPGFQLLTQDEIHAAQKWSVRCIVRATHLYV*RSS**YHLSQWATDEERLHP 379
            +++FA  +PGF   TQD+     K      V  TH+    +     L   A    +L  
Sbjct: 204 RIVEFAKRVPGFCDFTQDDQLILIKLGF-FEVWLTHVARLINEATLTLDDGAYLTRQL-- 260

Query: 380 ERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
           E       V++   FA  +N+  L+D EIGLF
Sbjct: 261 EILYDSDFVNALLNFANTLNAYGLSDTEIGLF 292


>U01087-1|AAA19975.1|  864|Drosophila melanogaster nuclear hormone
            receptor superfamilyprotein protein.
          Length = 864

 Score = 33.9 bits (74), Expect = 0.16
 Identities = 38/152 (25%), Positives = 62/152 (40%)
 Frame = +2

Query: 20   RVVRAHLDTCEFTRDRVASMRARARDCPTYSQPTLACPLNPAPELQSEKEFSQRFAHVIR 199
            RV  A L+ C +T +    +  R    P     +         ++   ++FS R    ++
Sbjct: 619  RVAGAPLN-CSYTEELTRELMRRPVTVPQNGIASTVAESLEFQKIWLWQQFSARVTPGVQ 677

Query: 200  GVIDFAGLIPGFQLLTQDEIHAAQKWSVRCIVRATHLYV*RSS**YHLSQWATDEERLHP 379
             +++FA  +PGF   TQD+     K      V  TH+    +     L   A    +L  
Sbjct: 678  RIVEFAKRVPGFCDFTQDDQLILIKLGF-FEVWLTHVARLINEATLTLDDGAYLTRQL-- 734

Query: 380  ERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
            E       V++   FA  +N+  L+D EIGLF
Sbjct: 735  EILYDSDFVNALLNFANTLNAYGLSDTEIGLF 766


>M90806-1|AAA28461.1|  487|Drosophila melanogaster DHR3 protein.
          Length = 487

 Score = 33.9 bits (74), Expect = 0.16
 Identities = 28/103 (27%), Positives = 50/103 (48%), Gaps = 2/103 (1%)
 Frame = +2

Query: 173 SQRFAHVIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVR-CIVRATHLYV*RSS**YHLS 346
           +++   +I+ +I+FA LIPGF  L+Q D+I   +  S    IVR + L +  S       
Sbjct: 288 AEKLTQMIQNIIEFAKLIPGFMRLSQDDQILLLKTGSFELAIVRMSRL-LDLSQNAVLYG 346

Query: 347 QWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
                +E  +    +   LV   F+ A+ +  + LT+ E+ L+
Sbjct: 347 DVMLPQEAFYTSDSEEMRLVSRIFQTAKSIAELKLTETELALY 389


>AY094723-1|AAM11076.1|  444|Drosophila melanogaster GH21112p
           protein.
          Length = 444

 Score = 33.9 bits (74), Expect = 0.16
 Identities = 28/103 (27%), Positives = 50/103 (48%), Gaps = 2/103 (1%)
 Frame = +2

Query: 173 SQRFAHVIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVR-CIVRATHLYV*RSS**YHLS 346
           +++   +I+ +I+FA LIPGF  L+Q D+I   +  S    IVR + L +  S       
Sbjct: 245 AEKLTQMIQNIIEFAKLIPGFMRLSQDDQILLLKTGSFELAIVRMSRL-LDLSQNAVLYG 303

Query: 347 QWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
                +E  +    +   LV   F+ A+ +  + LT+ E+ L+
Sbjct: 304 DVMLPQEAFYTSDSEEMRLVSRIFQTAKSIAELKLTETELALY 346


>AE013599-1047|AAF58826.1|  487|Drosophila melanogaster CG33183-PA,
           isoform A protein.
          Length = 487

 Score = 33.9 bits (74), Expect = 0.16
 Identities = 28/103 (27%), Positives = 50/103 (48%), Gaps = 2/103 (1%)
 Frame = +2

Query: 173 SQRFAHVIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVR-CIVRATHLYV*RSS**YHLS 346
           +++   +I+ +I+FA LIPGF  L+Q D+I   +  S    IVR + L +  S       
Sbjct: 288 AEKLTQMIQNIIEFAKLIPGFMRLSQDDQILLLKTGSFELAIVRMSRL-LDLSQNAVLYG 346

Query: 347 QWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
                +E  +    +   LV   F+ A+ +  + LT+ E+ L+
Sbjct: 347 DVMLPQEAFYTSDSEEMRLVSRIFQTAKSIAELKLTETELALY 389


>AE013599-1046|AAO41454.1|  444|Drosophila melanogaster CG33183-PB,
           isoform B protein.
          Length = 444

 Score = 33.9 bits (74), Expect = 0.16
 Identities = 28/103 (27%), Positives = 50/103 (48%), Gaps = 2/103 (1%)
 Frame = +2

Query: 173 SQRFAHVIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVR-CIVRATHLYV*RSS**YHLS 346
           +++   +I+ +I+FA LIPGF  L+Q D+I   +  S    IVR + L +  S       
Sbjct: 245 AEKLTQMIQNIIEFAKLIPGFMRLSQDDQILLLKTGSFELAIVRMSRL-LDLSQNAVLYG 303

Query: 347 QWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
                +E  +    +   LV   F+ A+ +  + LT+ E+ L+
Sbjct: 304 DVMLPQEAFYTSDSEEMRLVSRIFQTAKSIAELKLTETELALY 346


>AE013599-1045|AAO41453.1|  694|Drosophila melanogaster CG33183-PC,
           isoform C protein.
          Length = 694

 Score = 33.9 bits (74), Expect = 0.16
 Identities = 28/103 (27%), Positives = 50/103 (48%), Gaps = 2/103 (1%)
 Frame = +2

Query: 173 SQRFAHVIRGVIDFAGLIPGFQLLTQ-DEIHAAQKWSVR-CIVRATHLYV*RSS**YHLS 346
           +++   +I+ +I+FA LIPGF  L+Q D+I   +  S    IVR + L +  S       
Sbjct: 495 AEKLTQMIQNIIEFAKLIPGFMRLSQDDQILLLKTGSFELAIVRMSRL-LDLSQNAVLYG 553

Query: 347 QWATDEERLHPERCQCKFLVDSTFKFAERMNSMNLTDAEIGLF 475
                +E  +    +   LV   F+ A+ +  + LT+ E+ L+
Sbjct: 554 DVMLPQEAFYTSDSEEMRLVSRIFQTAKSIAELKLTETELALY 596


>X05939-1|CAA29373.1|  657|Drosophila melanogaster protein (
           Drosophila melanogasterD-myb mRNA. ).
          Length = 657

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 2/35 (5%)
 Frame = -1

Query: 356 LPIETDDTIKRSVKHTDESHEQ--CIEQTTFEQRE 258
           +P +T   +KR+ KH  E+H Q  C    TF Q E
Sbjct: 331 MPRQTPIILKRTRKHIPETHHQAGCSSSETFNQEE 365


>M11281-1|AAA70367.1|  441|Drosophila melanogaster Myb protein.
          Length = 441

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 2/35 (5%)
 Frame = -1

Query: 356 LPIETDDTIKRSVKHTDESHEQ--CIEQTTFEQRE 258
           +P +T   +KR+ KH  E+H Q  C    TF Q E
Sbjct: 331 MPRQTPIILKRTRKHIPETHHQAGCSSSETFNQEE 365


>BT003262-1|AAO25019.1|  657|Drosophila melanogaster LD22943p
           protein.
          Length = 657

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 2/35 (5%)
 Frame = -1

Query: 356 LPIETDDTIKRSVKHTDESHEQ--CIEQTTFEQRE 258
           +P +T   +KR+ KH  E+H Q  C    TF Q E
Sbjct: 331 MPRQTPIILKRTRKHIPETHHQAGCSSSETFNQEE 365


>AE014298-2256|AAS65358.1|  657|Drosophila melanogaster CG9045-PE,
           isoform E protein.
          Length = 657

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 2/35 (5%)
 Frame = -1

Query: 356 LPIETDDTIKRSVKHTDESHEQ--CIEQTTFEQRE 258
           +P +T   +KR+ KH  E+H Q  C    TF Q E
Sbjct: 331 MPRQTPIILKRTRKHIPETHHQAGCSSSETFNQEE 365


>AE014298-2255|AAS65357.1|  657|Drosophila melanogaster CG9045-PD,
           isoform D protein.
          Length = 657

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 2/35 (5%)
 Frame = -1

Query: 356 LPIETDDTIKRSVKHTDESHEQ--CIEQTTFEQRE 258
           +P +T   +KR+ KH  E+H Q  C    TF Q E
Sbjct: 331 MPRQTPIILKRTRKHIPETHHQAGCSSSETFNQEE 365


>AE014298-2254|AAS65356.1|  657|Drosophila melanogaster CG9045-PC,
           isoform C protein.
          Length = 657

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 2/35 (5%)
 Frame = -1

Query: 356 LPIETDDTIKRSVKHTDESHEQ--CIEQTTFEQRE 258
           +P +T   +KR+ KH  E+H Q  C    TF Q E
Sbjct: 331 MPRQTPIILKRTRKHIPETHHQAGCSSSETFNQEE 365


>AE014298-2253|AAS65355.1|  657|Drosophila melanogaster CG9045-PB,
           isoform B protein.
          Length = 657

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 2/35 (5%)
 Frame = -1

Query: 356 LPIETDDTIKRSVKHTDESHEQ--CIEQTTFEQRE 258
           +P +T   +KR+ KH  E+H Q  C    TF Q E
Sbjct: 331 MPRQTPIILKRTRKHIPETHHQAGCSSSETFNQEE 365


>AE014298-2252|AAF48529.1|  657|Drosophila melanogaster CG9045-PA,
           isoform A protein.
          Length = 657

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 2/35 (5%)
 Frame = -1

Query: 356 LPIETDDTIKRSVKHTDESHEQ--CIEQTTFEQRE 258
           +P +T   +KR+ KH  E+H Q  C    TF Q E
Sbjct: 331 MPRQTPIILKRTRKHIPETHHQAGCSSSETFNQEE 365


>AY094778-1|AAM11131.1|  570|Drosophila melanogaster LD09231p
           protein.
          Length = 570

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 16/39 (41%), Positives = 19/39 (48%)
 Frame = -3

Query: 225 MRPAKSITPRITWAKRCENSFSDCSSGAGFSGQARVGCE 109
           +RP  S+TP      RC NS  D S+    S  A VG E
Sbjct: 359 IRPIDSLTPSKIGTYRCGNSDLDTSNCTNASMNATVGSE 397


>AE014297-2310|AAF55387.2|  570|Drosophila melanogaster CG5175-PB,
           isoform B protein.
          Length = 570

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 16/39 (41%), Positives = 19/39 (48%)
 Frame = -3

Query: 225 MRPAKSITPRITWAKRCENSFSDCSSGAGFSGQARVGCE 109
           +RP  S+TP      RC NS  D S+    S  A VG E
Sbjct: 359 IRPIDSLTPSKIGTYRCGNSDLDTSNCTNASMNATVGSE 397


>AE014297-2309|AAN13733.1|  570|Drosophila melanogaster CG5175-PA,
           isoform A protein.
          Length = 570

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 16/39 (41%), Positives = 19/39 (48%)
 Frame = -3

Query: 225 MRPAKSITPRITWAKRCENSFSDCSSGAGFSGQARVGCE 109
           +RP  S+TP      RC NS  D S+    S  A VG E
Sbjct: 359 IRPIDSLTPSKIGTYRCGNSDLDTSNCTNASMNATVGSE 397


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,769,582
Number of Sequences: 53049
Number of extensions: 512166
Number of successful extensions: 1693
Number of sequences better than 10.0: 32
Number of HSP's better than 10.0 without gapping: 1599
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1672
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2358819486
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -