SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20018
         (688 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF037470-1|AAD02099.1|  625|Drosophila melanogaster Rlip protein.      73   5e-13
AE014297-2906|AAF55832.1|  625|Drosophila melanogaster CG11622-P...    73   5e-13
AY113338-1|AAM29343.1|  372|Drosophila melanogaster GH01995p pro...    64   1e-10
AE014135-52|AAF59356.2|  202|Drosophila melanogaster CG1748-PA p...    34   0.21 
AY075440-1|AAL68254.1| 1017|Drosophila melanogaster RE02250p pro...    33   0.28 
AE014297-1849|AAF55053.2| 1017|Drosophila melanogaster CG31319-P...    33   0.28 
AY061469-1|AAL29017.1|  462|Drosophila melanogaster LD43554p pro...    29   6.0  
AE014298-2103|AAF48423.1|  462|Drosophila melanogaster CG5599-PA...    29   6.0  
AY050239-1|AAK84938.1|  440|Drosophila melanogaster SD02309p pro...    29   7.9  
AE014298-757|AAN09145.1|  440|Drosophila melanogaster CG3208-PB,...    29   7.9  
AE014298-756|AAF46047.1|  494|Drosophila melanogaster CG3208-PA,...    29   7.9  

>AF037470-1|AAD02099.1|  625|Drosophila melanogaster Rlip protein.
          Length = 625

 Score = 72.5 bits (170), Expect = 5e-13
 Identities = 32/68 (47%), Positives = 45/68 (66%)
 Frame = +3

Query: 264 LGVALPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQ 443
           L +  P+FGV +  + ERSRCHD   +PLVVRD ID+LQ H LK + IY+ EP K +   
Sbjct: 180 LALGYPVFGVSVSLATERSRCHDGVDIPLVVRDCIDFLQDH-LKCEQIYKIEPIKTRLMH 238

Query: 444 LRKLFTDR 467
            ++L+ +R
Sbjct: 239 FKRLYNNR 246



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 12/28 (42%), Positives = 20/28 (71%)
 Frame = +2

Query: 509 AMLKAFISELPESILTQELHGQFEQATA 592
           ++LK F+ ELPE +LT +L  +FE+  +
Sbjct: 262 SLLKLFLRELPEPLLTTDLVARFEEVAS 289


>AE014297-2906|AAF55832.1|  625|Drosophila melanogaster CG11622-PA
           protein.
          Length = 625

 Score = 72.5 bits (170), Expect = 5e-13
 Identities = 32/68 (47%), Positives = 45/68 (66%)
 Frame = +3

Query: 264 LGVALPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQ 443
           L +  P+FGV +  + ERSRCHD   +PLVVRD ID+LQ H LK + IY+ EP K +   
Sbjct: 180 LALGYPVFGVSVSLATERSRCHDGVDIPLVVRDCIDFLQDH-LKCEQIYKIEPIKTRLMH 238

Query: 444 LRKLFTDR 467
            ++L+ +R
Sbjct: 239 FKRLYNNR 246



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 12/28 (42%), Positives = 20/28 (71%)
 Frame = +2

Query: 509 AMLKAFISELPESILTQELHGQFEQATA 592
           ++LK F+ ELPE +LT +L  +FE+  +
Sbjct: 262 SLLKLFLRELPEPLLTTDLVARFEEVAS 289


>AY113338-1|AAM29343.1|  372|Drosophila melanogaster GH01995p
           protein.
          Length = 372

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 29/68 (42%), Positives = 43/68 (63%)
 Frame = +3

Query: 264 LGVALPIFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQ 443
           L +  P+FGV +  + ERSRCHD   +PLVVRD ID+LQ   LK + IY+  P + +   
Sbjct: 180 LALGYPVFGVSVSLATERSRCHDGVDIPLVVRDCIDFLQDR-LKCERIYKVGPIETRLMH 238

Query: 444 LRKLFTDR 467
            ++L+ +R
Sbjct: 239 FKRLYNNR 246



 Score = 29.5 bits (63), Expect = 4.5
 Identities = 11/28 (39%), Positives = 20/28 (71%)
 Frame = +2

Query: 509 AMLKAFISELPESILTQELHGQFEQATA 592
           ++L+ F+ ELPE +LT +L  +FE+  +
Sbjct: 262 SLLRLFLRELPEPLLTTDLVARFEEVAS 289


>AE014135-52|AAF59356.2|  202|Drosophila melanogaster CG1748-PA
           protein.
          Length = 202

 Score = 33.9 bits (74), Expect = 0.21
 Identities = 14/39 (35%), Positives = 25/39 (64%)
 Frame = +3

Query: 342 LPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLF 458
           +P+ V + IDYL+ +GL+   ++R    K + +QLR+ F
Sbjct: 2   VPIFVNNCIDYLEDNGLQQVGLFRVSTSKKRVKQLREEF 40


>AY075440-1|AAL68254.1| 1017|Drosophila melanogaster RE02250p
           protein.
          Length = 1017

 Score = 33.5 bits (73), Expect = 0.28
 Identities = 20/57 (35%), Positives = 30/57 (52%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRK 452
           +FGVPL   ++RS       LPL VR +  +LQ + L    I+R    K +  +LR+
Sbjct: 562 VFGVPLLMILQRS----GQTLPLAVRAAFRWLQLNALDQVGIFRKSGGKSRIMKLRE 614


>AE014297-1849|AAF55053.2| 1017|Drosophila melanogaster CG31319-PA
           protein.
          Length = 1017

 Score = 33.5 bits (73), Expect = 0.28
 Identities = 20/57 (35%), Positives = 30/57 (52%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRK 452
           +FGVPL   ++RS       LPL VR +  +LQ + L    I+R    K +  +LR+
Sbjct: 562 VFGVPLLMILQRS----GQTLPLAVRAAFRWLQLNALDQVGIFRKSGGKSRIMKLRE 614


>AY061469-1|AAL29017.1|  462|Drosophila melanogaster LD43554p
           protein.
          Length = 462

 Score = 29.1 bits (62), Expect = 6.0
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 4/50 (8%)
 Frame = -1

Query: 370 SMLSRTTSGRPVSSWQRERSTDCCSGTPNIGS----ATPNVKILQKEHQM 233
           S  S +TS    +S   E+ +   S TP  G     ATP+V+ L KEHQ+
Sbjct: 126 SSSSSSTSSDSSASENEEKQSAEASATPTEGRVIIPATPSVRRLAKEHQL 175


>AE014298-2103|AAF48423.1|  462|Drosophila melanogaster CG5599-PA
           protein.
          Length = 462

 Score = 29.1 bits (62), Expect = 6.0
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 4/50 (8%)
 Frame = -1

Query: 370 SMLSRTTSGRPVSSWQRERSTDCCSGTPNIGS----ATPNVKILQKEHQM 233
           S  S +TS    +S   E+ +   S TP  G     ATP+V+ L KEHQ+
Sbjct: 126 SSSSSSTSSDSSASENEEKQSAEASATPTEGRVIIPATPSVRRLAKEHQL 175


>AY050239-1|AAK84938.1|  440|Drosophila melanogaster SD02309p
           protein.
          Length = 440

 Score = 28.7 bits (61), Expect = 7.9
 Identities = 19/62 (30%), Positives = 30/62 (48%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFT 461
           +FG  L   V+    H    +P VVR  ++ ++A G+  + IYR      + + L KL  
Sbjct: 301 VFGTDLTTMVQLEPHHQ---IPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEAL-KLAL 356

Query: 462 DR 467
           DR
Sbjct: 357 DR 358


>AE014298-757|AAN09145.1|  440|Drosophila melanogaster CG3208-PB,
           isoform B protein.
          Length = 440

 Score = 28.7 bits (61), Expect = 7.9
 Identities = 19/62 (30%), Positives = 30/62 (48%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFT 461
           +FG  L   V+    H    +P VVR  ++ ++A G+  + IYR      + + L KL  
Sbjct: 301 VFGTDLTTMVQLEPHHQ---IPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEAL-KLAL 356

Query: 462 DR 467
           DR
Sbjct: 357 DR 358


>AE014298-756|AAF46047.1|  494|Drosophila melanogaster CG3208-PA,
           isoform A protein.
          Length = 494

 Score = 28.7 bits (61), Expect = 7.9
 Identities = 19/62 (30%), Positives = 30/62 (48%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQLRKLFT 461
           +FG  L   V+    H    +P VVR  ++ ++A G+  + IYR      + + L KL  
Sbjct: 301 VFGTDLTTMVQLEPHHQ---IPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEAL-KLAL 356

Query: 462 DR 467
           DR
Sbjct: 357 DR 358


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,708,327
Number of Sequences: 53049
Number of extensions: 481741
Number of successful extensions: 1590
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1538
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1590
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 3013199100
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -