SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20015
         (627 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY061251-1|AAL28799.1|  211|Drosophila melanogaster LD18757p pro...    68   9e-12
AE014297-3387|AAF56185.1|  211|Drosophila melanogaster CG10214-P...    68   9e-12
AF351187-1|AAK37558.1| 1629|Drosophila melanogaster furry protei...    29   5.1  
AF310159-1|AAG41424.1| 3479|Drosophila melanogaster fry protein.       29   5.1  
AE014296-1705|ABI31247.1| 1629|Drosophila melanogaster CG32045-P...    29   5.1  
AE014296-1700|AAF50228.2| 3479|Drosophila melanogaster CG32045-P...    29   5.1  
AF326979-1|AAO13781.1|  557|Drosophila melanogaster N-acetylgala...    29   6.8  
AE014296-2566|AAF49588.1|  498|Drosophila melanogaster CG7579-PA...    29   6.8  
U04853-2|AAG33251.1|  267|Drosophila melanogaster trypsin-kappa ...    28   9.0  
BT024443-1|ABC86505.1|  272|Drosophila melanogaster IP01781p pro...    28   9.0  
AE013599-1273|AAF58664.3|  263|Drosophila melanogaster CG12388-P...    28   9.0  

>AY061251-1|AAL28799.1|  211|Drosophila melanogaster LD18757p
           protein.
          Length = 211

 Score = 68.1 bits (159), Expect = 9e-12
 Identities = 29/45 (64%), Positives = 35/45 (77%)
 Frame = +3

Query: 357 IVWMDLEMTGLDIENDHIMEIACLVTDAQLNVVATGPDIVINLPE 491
           IVWMDLEMTGLDIE D I+E+AC++TD  LNV + GP   IN P+
Sbjct: 38  IVWMDLEMTGLDIEKDKILEVACIITDQDLNVKSEGPCFAINHPQ 82


>AE014297-3387|AAF56185.1|  211|Drosophila melanogaster CG10214-PA
           protein.
          Length = 211

 Score = 68.1 bits (159), Expect = 9e-12
 Identities = 29/45 (64%), Positives = 35/45 (77%)
 Frame = +3

Query: 357 IVWMDLEMTGLDIENDHIMEIACLVTDAQLNVVATGPDIVINLPE 491
           IVWMDLEMTGLDIE D I+E+AC++TD  LNV + GP   IN P+
Sbjct: 38  IVWMDLEMTGLDIEKDKILEVACIITDQDLNVKSEGPCFAINHPQ 82


>AF351187-1|AAK37558.1| 1629|Drosophila melanogaster furry protein
            short isoform protein.
          Length = 1629

 Score = 29.1 bits (62), Expect = 5.1
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = -3

Query: 217  TLHVERNCMS-LHKKNEINSCTTLHYIHTISEIYLHQYYLY 98
            T H   N  S + KKNEI   TTLH++   + + L  Y  Y
Sbjct: 1007 TQHTVLNMASDVGKKNEIPLATTLHFVEGFALVLLCNYRTY 1047


>AF310159-1|AAG41424.1| 3479|Drosophila melanogaster fry protein.
          Length = 3479

 Score = 29.1 bits (62), Expect = 5.1
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = -3

Query: 217  TLHVERNCMS-LHKKNEINSCTTLHYIHTISEIYLHQYYLY 98
            T H   N  S + KKNEI   TTLH++   + + L  Y  Y
Sbjct: 1007 TQHTVLNMASDVGKKNEIPLATTLHFVEGFALVLLCNYRTY 1047


>AE014296-1705|ABI31247.1| 1629|Drosophila melanogaster CG32045-PD,
            isoform D protein.
          Length = 1629

 Score = 29.1 bits (62), Expect = 5.1
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = -3

Query: 217  TLHVERNCMS-LHKKNEINSCTTLHYIHTISEIYLHQYYLY 98
            T H   N  S + KKNEI   TTLH++   + + L  Y  Y
Sbjct: 1007 TQHTVLNMASDVGKKNEIPLATTLHFVEGFALVLLCNYRTY 1047


>AE014296-1700|AAF50228.2| 3479|Drosophila melanogaster CG32045-PB,
            isoform B protein.
          Length = 3479

 Score = 29.1 bits (62), Expect = 5.1
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = -3

Query: 217  TLHVERNCMS-LHKKNEINSCTTLHYIHTISEIYLHQYYLY 98
            T H   N  S + KKNEI   TTLH++   + + L  Y  Y
Sbjct: 1007 TQHTVLNMASDVGKKNEIPLATTLHFVEGFALVLLCNYRTY 1047


>AF326979-1|AAO13781.1|  557|Drosophila melanogaster
           N-acetylgalactosaminyltransferase protein.
          Length = 557

 Score = 28.7 bits (61), Expect = 6.8
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%)
 Frame = +2

Query: 416 NSVSCDRCTAKCSGDRSRYSYKST*SDFKQNNNWC-KVQHGETGLTEACLKSDTS 577
           N+V   +CT K S +   Y+Y+   S F  N N C ++   + GL  +   SD +
Sbjct: 479 NNVRATKCTKKLSKNPWHYNYQH--SSFVSNGNKCLQIDVNKVGLILSACDSDVT 531


>AE014296-2566|AAF49588.1|  498|Drosophila melanogaster CG7579-PA
           protein.
          Length = 498

 Score = 28.7 bits (61), Expect = 6.8
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%)
 Frame = +2

Query: 416 NSVSCDRCTAKCSGDRSRYSYKST*SDFKQNNNWC-KVQHGETGLTEACLKSDTS 577
           N+V   +CT K S +   Y+Y+   S F  N N C ++   + GL  +   SD +
Sbjct: 420 NNVRATKCTKKLSKNPWHYNYQH--SSFVSNGNKCLQIDVNKVGLILSACDSDVT 472


>U04853-2|AAG33251.1|  267|Drosophila melanogaster trypsin-kappa
           protein.
          Length = 267

 Score = 28.3 bits (60), Expect = 9.0
 Identities = 24/95 (25%), Positives = 38/95 (40%)
 Frame = +3

Query: 294 NLSMSPKIMTKKNTKVDIAQRIVWMDLEMTGLDIENDHIMEIACLVTDAQLNVVATGPDI 473
           ++S  P+      T VDIA+    + L     D E+ ++ E A ++   Q   + T    
Sbjct: 21  SISGQPEGRIINGTTVDIARHPYLISLRYRR-DNESSYMHECAGVIISEQ--ALITSAQC 77

Query: 474 VINLPEVTLNKIITGVRSNTARQG*QRLALNQTHH 578
           +  LPE T    + G  +     G      N THH
Sbjct: 78  LYGLPEETKLVAVAGANTRNGTDGFIYPVANWTHH 112


>BT024443-1|ABC86505.1|  272|Drosophila melanogaster IP01781p
           protein.
          Length = 272

 Score = 28.3 bits (60), Expect = 9.0
 Identities = 24/95 (25%), Positives = 38/95 (40%)
 Frame = +3

Query: 294 NLSMSPKIMTKKNTKVDIAQRIVWMDLEMTGLDIENDHIMEIACLVTDAQLNVVATGPDI 473
           ++S  P+      T VDIA+    + L     D E+ ++ E A ++   Q   + T    
Sbjct: 26  SISGQPEGRIINGTTVDIARHPYLVSLRYRR-DNESSYMHECAGVIISEQ--ALITSAQC 82

Query: 474 VINLPEVTLNKIITGVRSNTARQG*QRLALNQTHH 578
           +  LPE T    + G  +     G      N THH
Sbjct: 83  LYGLPEETKLVAVAGANTRNGTDGFIYPVANWTHH 117


>AE013599-1273|AAF58664.3|  263|Drosophila melanogaster CG12388-PA
           protein.
          Length = 263

 Score = 28.3 bits (60), Expect = 9.0
 Identities = 24/95 (25%), Positives = 38/95 (40%)
 Frame = +3

Query: 294 NLSMSPKIMTKKNTKVDIAQRIVWMDLEMTGLDIENDHIMEIACLVTDAQLNVVATGPDI 473
           ++S  P+      T VDIA+    + L     D E+ ++ E A ++   Q   + T    
Sbjct: 17  SISGQPEGRIINGTTVDIARHPYLVSLRYRR-DNESSYMHECAGVIISEQ--ALITSAQC 73

Query: 474 VINLPEVTLNKIITGVRSNTARQG*QRLALNQTHH 578
           +  LPE T    + G  +     G      N THH
Sbjct: 74  LYGLPEETKLVAVAGANTRNGTDGFIYPVANWTHH 108


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,367,114
Number of Sequences: 53049
Number of extensions: 497157
Number of successful extensions: 1189
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1147
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1189
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2600432100
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -