SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20014
         (597 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT022718-1|AAY55134.1|  190|Drosophila melanogaster RE74350p pro...   133   2e-31
AE014134-2010|AAF53049.1|  190|Drosophila melanogaster CG6141-PB...   133   2e-31
AE014134-2009|AAF53048.2|  190|Drosophila melanogaster CG6141-PA...   133   2e-31
X94613-1|CAA64319.1|  190|Drosophila melanogaster ribosomal prot...   133   2e-31
AY060984-1|AAL28532.1|  730|Drosophila melanogaster GM14169p pro...    33   0.22 
AF123262-1|AAD22056.1|  730|Drosophila melanogaster TXBP181-like...    33   0.22 
AE013599-845|AAF58955.1|  730|Drosophila melanogaster CG2072-PA ...    33   0.22 
AY069587-1|AAL39732.2|  639|Drosophila melanogaster LD33388p pro...    32   0.68 
AY058785-1|AAL14014.1| 1068|Drosophila melanogaster SD08329p pro...    32   0.68 
AE014296-109|AAN11444.1| 1340|Drosophila melanogaster CG17090-PB...    32   0.68 
AE014296-108|AAF47392.2| 1340|Drosophila melanogaster CG17090-PA...    32   0.68 
AY147240-1|AAN63094.1|  251|Drosophila melanogaster testis-speci...    30   2.1  
AE014297-4706|AAF57116.1|  251|Drosophila melanogaster CG1736-PA...    30   2.1  
BT010048-1|AAQ22517.1| 1654|Drosophila melanogaster LD26355p pro...    29   3.6  
AE014297-3630|AAF56339.1| 1654|Drosophila melanogaster CG11375-P...    29   3.6  
BT023113-1|AAY55529.1|  423|Drosophila melanogaster IP03677p pro...    28   8.4  

>BT022718-1|AAY55134.1|  190|Drosophila melanogaster RE74350p
           protein.
          Length = 190

 Score =  133 bits (322), Expect = 2e-31
 Identities = 85/189 (44%), Positives = 110/189 (58%), Gaps = 4/189 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNPRLLKVEKWFG 207
           M+ I +NQ VKIP  +   VK+R+VT+ G RG LKR+FKHLA+D+ M + R LKVEKWFG
Sbjct: 1   MRTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYMPDKRTLKVEKWFG 60

Query: 208 SKKELAAVRTVCSHVET*LKE*LKASNTRCVLCMLTSPL---TVSPLRVIQLLRYV-TSW 375
           +KKELAAVRTVCSH+E  +K        +        P+   T     VI++  ++   +
Sbjct: 61  TKKELAAVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKY 120

Query: 376 VRNTSEG*RWHLV*LSLTLQNKRMN*SLGNSFERCL*LWCSHPATTTVKNKDIRKFLDGL 555
           +R         +V  + T Q   +    GN  E           +TTVKNKDIRKFLDGL
Sbjct: 121 IRRVEMAPGVTVV--NSTAQKDELIVE-GNDIESVSGSAALIQQSTTVKNKDIRKFLDGL 177

Query: 556 YVSEKTTVV 582
           YVSEKTTVV
Sbjct: 178 YVSEKTTVV 186



 Score =  128 bits (310), Expect = 4e-30
 Identities = 59/68 (86%), Positives = 64/68 (94%)
 Frame = +3

Query: 255 NMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNSP 434
           NMIKGVT GFQYKMRAVYAHFPINCVT+E N++IEIRNFLGEKYIRRV+MAPGVTVVNS 
Sbjct: 77  NMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKYIRRVEMAPGVTVVNST 136

Query: 435 KQKDELII 458
            QKDELI+
Sbjct: 137 AQKDELIV 144


>AE014134-2010|AAF53049.1|  190|Drosophila melanogaster CG6141-PB,
           isoform B protein.
          Length = 190

 Score =  133 bits (322), Expect = 2e-31
 Identities = 85/189 (44%), Positives = 110/189 (58%), Gaps = 4/189 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNPRLLKVEKWFG 207
           M+ I +NQ VKIP  +   VK+R+VT+ G RG LKR+FKHLA+D+ M + R LKVEKWFG
Sbjct: 1   MRTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYMPDKRTLKVEKWFG 60

Query: 208 SKKELAAVRTVCSHVET*LKE*LKASNTRCVLCMLTSPL---TVSPLRVIQLLRYV-TSW 375
           +KKELAAVRTVCSH+E  +K        +        P+   T     VI++  ++   +
Sbjct: 61  TKKELAAVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKY 120

Query: 376 VRNTSEG*RWHLV*LSLTLQNKRMN*SLGNSFERCL*LWCSHPATTTVKNKDIRKFLDGL 555
           +R         +V  + T Q   +    GN  E           +TTVKNKDIRKFLDGL
Sbjct: 121 IRRVEMAPGVTVV--NSTAQKDELIVE-GNDIESVSGSAALIQQSTTVKNKDIRKFLDGL 177

Query: 556 YVSEKTTVV 582
           YVSEKTTVV
Sbjct: 178 YVSEKTTVV 186



 Score =  128 bits (310), Expect = 4e-30
 Identities = 59/68 (86%), Positives = 64/68 (94%)
 Frame = +3

Query: 255 NMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNSP 434
           NMIKGVT GFQYKMRAVYAHFPINCVT+E N++IEIRNFLGEKYIRRV+MAPGVTVVNS 
Sbjct: 77  NMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKYIRRVEMAPGVTVVNST 136

Query: 435 KQKDELII 458
            QKDELI+
Sbjct: 137 AQKDELIV 144


>AE014134-2009|AAF53048.2|  190|Drosophila melanogaster CG6141-PA,
           isoform A protein.
          Length = 190

 Score =  133 bits (322), Expect = 2e-31
 Identities = 85/189 (44%), Positives = 110/189 (58%), Gaps = 4/189 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNPRLLKVEKWFG 207
           M+ I +NQ VKIP  +   VK+R+VT+ G RG LKR+FKHLA+D+ M + R LKVEKWFG
Sbjct: 1   MRTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYMPDKRTLKVEKWFG 60

Query: 208 SKKELAAVRTVCSHVET*LKE*LKASNTRCVLCMLTSPL---TVSPLRVIQLLRYV-TSW 375
           +KKELAAVRTVCSH+E  +K        +        P+   T     VI++  ++   +
Sbjct: 61  TKKELAAVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKY 120

Query: 376 VRNTSEG*RWHLV*LSLTLQNKRMN*SLGNSFERCL*LWCSHPATTTVKNKDIRKFLDGL 555
           +R         +V  + T Q   +    GN  E           +TTVKNKDIRKFLDGL
Sbjct: 121 IRRVEMAPGVTVV--NSTAQKDELIVE-GNDIESVSGSAALIQQSTTVKNKDIRKFLDGL 177

Query: 556 YVSEKTTVV 582
           YVSEKTTVV
Sbjct: 178 YVSEKTTVV 186



 Score =  128 bits (310), Expect = 4e-30
 Identities = 59/68 (86%), Positives = 64/68 (94%)
 Frame = +3

Query: 255 NMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNSP 434
           NMIKGVT GFQYKMRAVYAHFPINCVT+E N++IEIRNFLGEKYIRRV+MAPGVTVVNS 
Sbjct: 77  NMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKYIRRVEMAPGVTVVNST 136

Query: 435 KQKDELII 458
            QKDELI+
Sbjct: 137 AQKDELIV 144


>X94613-1|CAA64319.1|  190|Drosophila melanogaster ribosomal protein
           L9 protein.
          Length = 190

 Score =  133 bits (321), Expect = 2e-31
 Identities = 85/189 (44%), Positives = 109/189 (57%), Gaps = 4/189 (2%)
 Frame = +1

Query: 28  MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNPRLLKVEKWFG 207
           M+ I +NQ VKIP  +   VK+R+VT+ G RG LKR FKHLA+D+ M + R LKVEKWFG
Sbjct: 1   MRTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRTFKHLALDMYMPDKRTLKVEKWFG 60

Query: 208 SKKELAAVRTVCSHVET*LKE*LKASNTRCVLCMLTSPL---TVSPLRVIQLLRYV-TSW 375
           +KKELAAVRTVCSH+E  +K        +        P+   T     VI++  ++   +
Sbjct: 61  TKKELAAVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKY 120

Query: 376 VRNTSEG*RWHLV*LSLTLQNKRMN*SLGNSFERCL*LWCSHPATTTVKNKDIRKFLDGL 555
           +R         +V  + T Q   +    GN  E           +TTVKNKDIRKFLDGL
Sbjct: 121 IRRVEMAPGVTVV--NSTAQKDELIVE-GNDIESVSGSAALIQQSTTVKNKDIRKFLDGL 177

Query: 556 YVSEKTTVV 582
           YVSEKTTVV
Sbjct: 178 YVSEKTTVV 186



 Score =  128 bits (310), Expect = 4e-30
 Identities = 59/68 (86%), Positives = 64/68 (94%)
 Frame = +3

Query: 255 NMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNSP 434
           NMIKGVT GFQYKMRAVYAHFPINCVT+E N++IEIRNFLGEKYIRRV+MAPGVTVVNS 
Sbjct: 77  NMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKYIRRVEMAPGVTVVNST 136

Query: 435 KQKDELII 458
            QKDELI+
Sbjct: 137 AQKDELIV 144


>AY060984-1|AAL28532.1|  730|Drosophila melanogaster GM14169p
           protein.
          Length = 730

 Score = 33.5 bits (73), Expect = 0.22
 Identities = 18/58 (31%), Positives = 34/58 (58%)
 Frame = +1

Query: 187 KVEKWFGSKKELAAVRTVCSHVET*LKE*LKASNTRCVLCMLTSPLTVSPLRVIQLLR 360
           ++E+  G++ E A+++    H+E  LKE +K +   C+   L SP+ +   R+ QLL+
Sbjct: 316 RLEREEGARAEAASLQVKLLHMEQELKEWVKVAQDHCLANTLVSPMALRS-RIEQLLK 372


>AF123262-1|AAD22056.1|  730|Drosophila melanogaster TXBP181-like
           protein protein.
          Length = 730

 Score = 33.5 bits (73), Expect = 0.22
 Identities = 18/58 (31%), Positives = 34/58 (58%)
 Frame = +1

Query: 187 KVEKWFGSKKELAAVRTVCSHVET*LKE*LKASNTRCVLCMLTSPLTVSPLRVIQLLR 360
           ++E+  G++ E A+++    H+E  LKE +K +   C+   L SP+ +   R+ QLL+
Sbjct: 316 RLEREEGARAEAASLQVKLLHMEQELKEWVKVAQDHCLANTLVSPMALRS-RIEQLLK 372


>AE013599-845|AAF58955.1|  730|Drosophila melanogaster CG2072-PA
           protein.
          Length = 730

 Score = 33.5 bits (73), Expect = 0.22
 Identities = 18/58 (31%), Positives = 34/58 (58%)
 Frame = +1

Query: 187 KVEKWFGSKKELAAVRTVCSHVET*LKE*LKASNTRCVLCMLTSPLTVSPLRVIQLLR 360
           ++E+  G++ E A+++    H+E  LKE +K +   C+   L SP+ +   R+ QLL+
Sbjct: 316 RLEREEGARAEAASLQVKLLHMEQELKEWVKVAQDHCLANTLVSPMALRS-RIEQLLK 372


>AY069587-1|AAL39732.2|  639|Drosophila melanogaster LD33388p
           protein.
          Length = 639

 Score = 31.9 bits (69), Expect = 0.68
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +3

Query: 21  PKHEANCSKSESQNPRRAYGPCEIASGDS*RAPRSSQKELQTLGC*HSHGKPSSP 185
           PKH  N  +++ +    A+    IA G+S R PR  +KE Q L       K SSP
Sbjct: 27  PKHHLNLPRNDLKKESPAH---HIAKGNSYRVPRHEKKEHQQLSPVKKRVKESSP 78


>AY058785-1|AAL14014.1| 1068|Drosophila melanogaster SD08329p
           protein.
          Length = 1068

 Score = 31.9 bits (69), Expect = 0.68
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +3

Query: 21  PKHEANCSKSESQNPRRAYGPCEIASGDS*RAPRSSQKELQTLGC*HSHGKPSSP 185
           PKH  N  +++ +    A+    IA G+S R PR  +KE Q L       K SSP
Sbjct: 457 PKHHLNLPRNDLKKESPAH---HIAKGNSYRVPRHEKKEHQQLSPVKKRVKESSP 508


>AE014296-109|AAN11444.1| 1340|Drosophila melanogaster CG17090-PB,
           isoform B protein.
          Length = 1340

 Score = 31.9 bits (69), Expect = 0.68
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +3

Query: 21  PKHEANCSKSESQNPRRAYGPCEIASGDS*RAPRSSQKELQTLGC*HSHGKPSSP 185
           PKH  N  +++ +    A+    IA G+S R PR  +KE Q L       K SSP
Sbjct: 728 PKHHLNLPRNDLKKESPAH---HIAKGNSYRVPRHEKKEHQQLSPVKKRVKESSP 779


>AE014296-108|AAF47392.2| 1340|Drosophila melanogaster CG17090-PA,
           isoform A protein.
          Length = 1340

 Score = 31.9 bits (69), Expect = 0.68
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +3

Query: 21  PKHEANCSKSESQNPRRAYGPCEIASGDS*RAPRSSQKELQTLGC*HSHGKPSSP 185
           PKH  N  +++ +    A+    IA G+S R PR  +KE Q L       K SSP
Sbjct: 728 PKHHLNLPRNDLKKESPAH---HIAKGNSYRVPRHEKKEHQQLSPVKKRVKESSP 779


>AY147240-1|AAN63094.1|  251|Drosophila melanogaster testis-specific
           20S proteasomesubunit alpha 3T protein.
          Length = 251

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 12/47 (25%), Positives = 27/47 (57%), Gaps = 2/47 (4%)
 Frame = -2

Query: 368 VTYLNN*ITL--SGDTVNGEVSIHSTHLVLEAFSYSFNHVSTCEQTV 234
           +++LN  I    +G+T +G V ++   ++ + + ++F  +  CEQ V
Sbjct: 64  ISWLNENIACWPTGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLV 110


>AE014297-4706|AAF57116.1|  251|Drosophila melanogaster CG1736-PA
           protein.
          Length = 251

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 12/47 (25%), Positives = 27/47 (57%), Gaps = 2/47 (4%)
 Frame = -2

Query: 368 VTYLNN*ITL--SGDTVNGEVSIHSTHLVLEAFSYSFNHVSTCEQTV 234
           +++LN  I    +G+T +G V ++   ++ + + ++F  +  CEQ V
Sbjct: 64  ISWLNENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCEQLV 110


>BT010048-1|AAQ22517.1| 1654|Drosophila melanogaster LD26355p protein.
          Length = 1654

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 9/30 (30%), Positives = 21/30 (70%)
 Frame = -1

Query: 582  HNSCFLRYIKTIQELSDILILDCSSCWMRA 493
            H+  +++YI+++Q  S + ++ C++ W RA
Sbjct: 1572 HSEAYIKYIESLQTGSHLNVVTCNNNWRRA 1601


>AE014297-3630|AAF56339.1| 1654|Drosophila melanogaster CG11375-PA
            protein.
          Length = 1654

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 9/30 (30%), Positives = 21/30 (70%)
 Frame = -1

Query: 582  HNSCFLRYIKTIQELSDILILDCSSCWMRA 493
            H+  +++YI+++Q  S + ++ C++ W RA
Sbjct: 1572 HSEAYIKYIESLQTGSHLNVVTCNNNWRRA 1601


>BT023113-1|AAY55529.1|  423|Drosophila melanogaster IP03677p
           protein.
          Length = 423

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%)
 Frame = -3

Query: 244 NRLSSRRQAPFWIRTISQPSGDE-GLPCECQ 155
           +R   RR+   W RT+ QP G   G  CECQ
Sbjct: 390 SRCQRRRRWCCWWRTLRQPGGRRPGRLCECQ 420


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,642,669
Number of Sequences: 53049
Number of extensions: 581033
Number of successful extensions: 1200
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 1162
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1200
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2420893683
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -