SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20013
         (724 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY070979-1|AAL48601.1|  619|Drosophila melanogaster RE07731p pro...   173   3e-43
AE014134-2205|AAF53194.1|  619|Drosophila melanogaster CG6382-PA...   173   3e-43
U88868-1|AAC24943.1|  619|Drosophila melanogaster elongation fac...   168   6e-42
BT003766-1|AAO41445.1|  670|Drosophila melanogaster RE29053p pro...   106   3e-23
AE014296-376|AAF47584.2|  670|Drosophila melanogaster CG1898-PA ...   106   3e-23
BT015202-1|AAT94431.1|  462|Drosophila melanogaster RE68984p pro...    93   5e-19
AE014297-4793|AAS65236.1|  462|Drosophila melanogaster CG1873-PD...    93   5e-19
AE014297-4792|AAS65235.1|  462|Drosophila melanogaster CG1873-PC...    93   5e-19
AE014297-4791|AAN14285.1|  462|Drosophila melanogaster CG1873-PB...    93   5e-19
AE014297-4790|AAF57185.1|  462|Drosophila melanogaster CG1873-PA...    93   5e-19
BT011039-1|AAR30199.1|  463|Drosophila melanogaster LP10071p pro...    92   6e-19
AE013599-1358|AAM68698.1|  463|Drosophila melanogaster CG8280-PB...    92   6e-19
AE013599-1357|AAF58608.1|  463|Drosophila melanogaster CG8280-PA...    92   6e-19
X06870-1|CAA29994.1|  462|Drosophila melanogaster EF-1-alpha pro...    90   2e-18
X06869-1|CAA29993.1|  463|Drosophila melanogaster EF-1-alpha pro...    85   1e-16
M11744-1|AAA28526.1|  463|Drosophila melanogaster protein ( D.me...    85   1e-16
BT003749-1|AAO41413.1|  489|Drosophila melanogaster RH68252p pro...    60   4e-09
AY058493-1|AAL13722.1|  300|Drosophila melanogaster GM14682p pro...    60   4e-09
AE013599-1732|AAF58366.1|  489|Drosophila melanogaster CG6050-PA...    60   4e-09
BT010319-1|AAQ23637.1|  456|Drosophila melanogaster AT01345p pro...    54   2e-07
AY058330-1|AAL13559.1|  456|Drosophila melanogaster GH10272p pro...    54   2e-07
AE013599-436|AAF59240.1|  456|Drosophila melanogaster CG12736-PA...    54   2e-07
AY071627-1|AAL49249.1|  511|Drosophila melanogaster RE67487p pro...    46   5e-05
AE013599-3196|AAF46721.1|  511|Drosophila melanogaster CG9841-PA...    46   5e-05
BT001873-1|AAN71645.1|  362|Drosophila melanogaster SD08285p pro...    45   1e-04
AY089522-1|AAL90260.1|  362|Drosophila melanogaster GM14559p pro...    45   1e-04
BT023763-1|AAZ41771.1|  639|Drosophila melanogaster RE37786p pro...    36   0.074
AE014134-1251|AAF52495.2|  745|Drosophila melanogaster CG4567-PA...    36   0.074
AY119138-1|AAM50998.1|  696|Drosophila melanogaster RE37995p pro...    34   0.17 
AE014297-4239|AAF56796.2|  696|Drosophila melanogaster CG12413-P...    34   0.17 
X80069-1|CAA56375.1|  475|Drosophila melanogaster 51KDa protein ...    34   0.23 
BT012446-1|AAS93717.1|  467|Drosophila melanogaster RE71279p pro...    34   0.23 
AY061102-1|AAL28650.1|  475|Drosophila melanogaster LD09025p pro...    34   0.23 
AJ290956-1|CAB93767.1|  475|Drosophila melanogaster eukaryotic t...    34   0.23 
AE014297-1977|AAN13641.1|  467|Drosophila melanogaster CG6476-PC...    34   0.23 
AE014297-1976|AAF55153.1|  475|Drosophila melanogaster CG6476-PB...    34   0.23 
X80070-1|CAA56376.1|  635|Drosophila melanogaster Su(var)3-9 pro...    32   0.69 
BT023767-1|AAZ41775.1| 1144|Drosophila melanogaster RE11051p pro...    32   0.69 
AJ290956-2|CAB93768.2|  635|Drosophila melanogaster histone-lysi...    32   0.69 
AF143207-1|AAF36532.1| 1144|Drosophila melanogaster IF2 protein ...    32   0.69 
AE014297-1978|AAF55154.1|  635|Drosophila melanogaster CG6476-PA...    32   0.69 
AE014296-661|AAF47774.2| 1144|Drosophila melanogaster CG10840-PB...    32   0.69 
BT003552-1|AAO39556.1|  676|Drosophila melanogaster LP12382p pro...    32   0.91 
AF017777-7|AAC28402.1|  679|Drosophila melanogaster waclaw protein.    32   0.91 
AE014298-3127|AAF50824.2|  696|Drosophila melanogaster CG1410-PA...    32   0.91 
AE014298-1971|AAF48328.2|  342|Drosophila melanogaster CG11063-P...    31   1.6  
AE014296-2740|AAF49461.3| 1033|Drosophila melanogaster CG33158-P...    31   2.1  
AY119468-1|AAM50122.1|  667|Drosophila melanogaster GH04243p pro...    30   2.8  
AE014134-709|AAN11172.1|  667|Drosophila melanogaster CG3714-PE,...    30   2.8  
AE014134-708|AAN11171.1|  667|Drosophila melanogaster CG3714-PD,...    30   2.8  
AE014134-707|AAN11170.1|  667|Drosophila melanogaster CG3714-PC,...    30   2.8  
AE014134-706|AAN11169.1|  667|Drosophila melanogaster CG3714-PB,...    30   2.8  
AY061131-1|AAL28679.1|  358|Drosophila melanogaster LD11455p pro...    30   3.7  
AE013599-2837|AAF57594.1|  358|Drosophila melanogaster CG7137-PA...    30   3.7  
AE014297-3196|AAF56031.2|  692|Drosophila melanogaster CG31159-P...    29   4.8  
AY060791-1|AAL28339.1|  507|Drosophila melanogaster GH26014p pro...    29   6.4  
AE014134-3017|AAF53741.1|  507|Drosophila melanogaster CG10446-P...    29   6.4  
X15805-1|CAA33804.1|  844|Drosophila melanogaster protein ( Dros...    29   8.5  
BT001894-1|AAN71683.1| 1047|Drosophila melanogaster SD17880p pro...    29   8.5  
AY084119-1|AAL89857.1|  658|Drosophila melanogaster LD19039p pro...    29   8.5  
AY075481-1|AAL68292.1|  844|Drosophila melanogaster RE38659p pro...    29   8.5  
AY069338-1|AAL39483.1|  239|Drosophila melanogaster LD05303p pro...    29   8.5  
AE014297-309|AAN13252.1| 1393|Drosophila melanogaster CG31551-PA...    29   8.5  
AE014135-27|AAN06557.1|  497|Drosophila melanogaster CG32000-PC,...    29   8.5  
AE014135-26|AAN06555.1|  521|Drosophila melanogaster CG32000-PF,...    29   8.5  
AE014135-25|AAN06556.2| 1314|Drosophila melanogaster CG32000-PB,...    29   8.5  
AE014135-24|AAN06554.2| 1314|Drosophila melanogaster CG32000-PA,...    29   8.5  
AE014135-23|AAN06553.1|  595|Drosophila melanogaster CG32000-PE,...    29   8.5  
AE014135-22|AAS64610.1| 1388|Drosophila melanogaster CG32000-PG,...    29   8.5  
AE014135-21|AAN06552.1|  658|Drosophila melanogaster CG32000-PD,...    29   8.5  
AE014134-3534|AAN11135.1|  832|Drosophila melanogaster CG2238-PC...    29   8.5  
AE014134-3533|AAG22125.2|  832|Drosophila melanogaster CG2238-PB...    29   8.5  
AE014134-3532|AAF57226.2|  844|Drosophila melanogaster CG2238-PA...    29   8.5  

>AY070979-1|AAL48601.1|  619|Drosophila melanogaster RE07731p
           protein.
          Length = 619

 Score =  173 bits (420), Expect = 3e-43
 Identities = 78/82 (95%), Positives = 82/82 (100%)
 Frame = +3

Query: 264 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAV 443
           WYLSWALDTNQEERDKGKTVEVGRA+FET++KHFTILDAPGHKSFVPNMIGGAAQADLAV
Sbjct: 242 WYLSWALDTNQEERDKGKTVEVGRAFFETDRKHFTILDAPGHKSFVPNMIGGAAQADLAV 301

Query: 444 LVISARKGEFETGFDRGGQTRD 509
           LVISARKGEFETGFDRGGQTR+
Sbjct: 302 LVISARKGEFETGFDRGGQTRE 323



 Score =  121 bits (291), Expect = 1e-27
 Identities = 60/89 (67%), Positives = 69/89 (77%)
 Frame = +1

Query: 52  DGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKY 231
           +GE T K+ KKK  +VE+ RSK+EHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKY
Sbjct: 171 EGEATPKVSKKKVVKVEENRSKREHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKY 230

Query: 232 EREAREKSENHGTYHGHWTQIKKNETKAK 318
           EREAREKS    +++  W      E + K
Sbjct: 231 EREAREKSRE--SWYLSWALDTNQEERDK 257



 Score = 91.9 bits (218), Expect = 8e-19
 Identities = 39/44 (88%), Positives = 42/44 (95%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HAMLAKTAGVKHLV LVNKMDDPTVNWD+ RYNEC++KILPYLK
Sbjct: 324 HAMLAKTAGVKHLVVLVNKMDDPTVNWDQTRYNECKDKILPYLK 367



 Score = 32.7 bits (71), Expect = 0.52
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = +1

Query: 640 ELGFNTAKDLSFLPVSGQTG 699
           +LGFN AKDL+F+P SG +G
Sbjct: 368 KLGFNPAKDLTFMPCSGLSG 387


>AE014134-2205|AAF53194.1|  619|Drosophila melanogaster CG6382-PA
           protein.
          Length = 619

 Score =  173 bits (420), Expect = 3e-43
 Identities = 78/82 (95%), Positives = 82/82 (100%)
 Frame = +3

Query: 264 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAV 443
           WYLSWALDTNQEERDKGKTVEVGRA+FET++KHFTILDAPGHKSFVPNMIGGAAQADLAV
Sbjct: 242 WYLSWALDTNQEERDKGKTVEVGRAFFETDRKHFTILDAPGHKSFVPNMIGGAAQADLAV 301

Query: 444 LVISARKGEFETGFDRGGQTRD 509
           LVISARKGEFETGFDRGGQTR+
Sbjct: 302 LVISARKGEFETGFDRGGQTRE 323



 Score =  121 bits (291), Expect = 1e-27
 Identities = 60/89 (67%), Positives = 69/89 (77%)
 Frame = +1

Query: 52  DGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKY 231
           +GE T K+ KKK  +VE+ RSK+EHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKY
Sbjct: 171 EGEATPKVSKKKVVKVEENRSKREHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKY 230

Query: 232 EREAREKSENHGTYHGHWTQIKKNETKAK 318
           EREAREKS    +++  W      E + K
Sbjct: 231 EREAREKSRE--SWYLSWALDTNQEERDK 257



 Score = 91.9 bits (218), Expect = 8e-19
 Identities = 39/44 (88%), Positives = 42/44 (95%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HAMLAKTAGVKHLV LVNKMDDPTVNWD+ RYNEC++KILPYLK
Sbjct: 324 HAMLAKTAGVKHLVVLVNKMDDPTVNWDQTRYNECKDKILPYLK 367



 Score = 32.7 bits (71), Expect = 0.52
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = +1

Query: 640 ELGFNTAKDLSFLPVSGQTG 699
           +LGFN AKDL+F+P SG +G
Sbjct: 368 KLGFNPAKDLTFMPCSGLSG 387


>U88868-1|AAC24943.1|  619|Drosophila melanogaster elongation factor
           1 alpha-likefactor protein.
          Length = 619

 Score =  168 bits (409), Expect = 6e-42
 Identities = 76/82 (92%), Positives = 80/82 (97%)
 Frame = +3

Query: 264 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAV 443
           WYLSW LDTNQEERDKGKTV VGRA+FET++KHFTILDAPGHKSFVPNMIGGAAQADLAV
Sbjct: 242 WYLSWGLDTNQEERDKGKTVGVGRAFFETDRKHFTILDAPGHKSFVPNMIGGAAQADLAV 301

Query: 444 LVISARKGEFETGFDRGGQTRD 509
           LVISARKGEFETGFDRGGQTR+
Sbjct: 302 LVISARKGEFETGFDRGGQTRE 323



 Score =  118 bits (283), Expect = 1e-26
 Identities = 56/68 (82%), Positives = 61/68 (89%)
 Frame = +1

Query: 52  DGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKY 231
           +GE T K+ KKK  +VE+ RSK+EHVNVVFIGHVDAGKSTIGGQIMSLTGMV KRTLEKY
Sbjct: 171 EGEATPKVSKKKVVKVEENRSKREHVNVVFIGHVDAGKSTIGGQIMSLTGMVHKRTLEKY 230

Query: 232 EREAREKS 255
           EREAREKS
Sbjct: 231 EREAREKS 238



 Score = 91.9 bits (218), Expect = 8e-19
 Identities = 39/44 (88%), Positives = 42/44 (95%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HAMLAKTAGVKHLV LVNKMDDPTVNWD+ RYNEC++KILPYLK
Sbjct: 324 HAMLAKTAGVKHLVVLVNKMDDPTVNWDQTRYNECKDKILPYLK 367



 Score = 32.7 bits (71), Expect = 0.52
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = +1

Query: 640 ELGFNTAKDLSFLPVSGQTG 699
           +LGFN AKDL+F+P SG +G
Sbjct: 368 KLGFNPAKDLTFMPCSGLSG 387


>BT003766-1|AAO41445.1|  670|Drosophila melanogaster RE29053p
           protein.
          Length = 670

 Score =  106 bits (255), Expect = 3e-23
 Identities = 46/79 (58%), Positives = 62/79 (78%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD   EER +G T++VG++  ET+ K  T+LDAPGHK F+PNMI GA QAD+A+LV+
Sbjct: 297 AWVLDETGEERARGITMDVGQSRIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVV 356

Query: 453 SARKGEFETGFDRGGQTRD 509
            A +GEFE+GF+ GGQTR+
Sbjct: 357 DATRGEFESGFELGGQTRE 375



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 24/73 (32%), Positives = 45/73 (61%)
 Frame = +1

Query: 100 EDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTYHG 279
           ++   +K H++++ IGHVDAGKST+ G ++  TG V +R + K+E+E+++  +    Y  
Sbjct: 239 KERADQKSHIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMY-- 296

Query: 280 HWTQIKKNETKAK 318
            W   +  E +A+
Sbjct: 297 AWVLDETGEERAR 309



 Score = 38.3 bits (85), Expect = 0.010
 Identities = 17/44 (38%), Positives = 27/44 (61%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+L ++ GV  L  ++NK+D  TV W + R+ E   K+  +LK
Sbjct: 376 HAILVRSLGVNQLGVVINKLD--TVGWSQDRFTEIVTKLKSFLK 417


>AE014296-376|AAF47584.2|  670|Drosophila melanogaster CG1898-PA
           protein.
          Length = 670

 Score =  106 bits (255), Expect = 3e-23
 Identities = 46/79 (58%), Positives = 62/79 (78%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD   EER +G T++VG++  ET+ K  T+LDAPGHK F+PNMI GA QAD+A+LV+
Sbjct: 297 AWVLDETGEERARGITMDVGQSRIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVV 356

Query: 453 SARKGEFETGFDRGGQTRD 509
            A +GEFE+GF+ GGQTR+
Sbjct: 357 DATRGEFESGFELGGQTRE 375



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 24/73 (32%), Positives = 45/73 (61%)
 Frame = +1

Query: 100 EDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTYHG 279
           ++   +K H++++ IGHVDAGKST+ G ++  TG V +R + K+E+E+++  +    Y  
Sbjct: 239 KERADQKSHIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMY-- 296

Query: 280 HWTQIKKNETKAK 318
            W   +  E +A+
Sbjct: 297 AWVLDETGEERAR 309



 Score = 38.3 bits (85), Expect = 0.010
 Identities = 17/44 (38%), Positives = 27/44 (61%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+L ++ GV  L  ++NK+D  TV W + R+ E   K+  +LK
Sbjct: 376 HAILVRSLGVNQLGVVINKLD--TVGWSQDRFTEIVTKLKSFLK 417


>BT015202-1|AAT94431.1|  462|Drosophila melanogaster RE68984p
           protein.
          Length = 462

 Score = 92.7 bits (220), Expect = 5e-19
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGTGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  +    Y
Sbjct: 4   EKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY 56



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + E RY E ++++  Y+K
Sbjct: 136 HALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIK 179


>AE014297-4793|AAS65236.1|  462|Drosophila melanogaster CG1873-PD,
           isoform D protein.
          Length = 462

 Score = 92.7 bits (220), Expect = 5e-19
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGTGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  +    Y
Sbjct: 4   EKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY 56



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + E RY E ++++  Y+K
Sbjct: 136 HALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIK 179


>AE014297-4792|AAS65235.1|  462|Drosophila melanogaster CG1873-PC,
           isoform C protein.
          Length = 462

 Score = 92.7 bits (220), Expect = 5e-19
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGTGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  +    Y
Sbjct: 4   EKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY 56



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + E RY E ++++  Y+K
Sbjct: 136 HALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIK 179


>AE014297-4791|AAN14285.1|  462|Drosophila melanogaster CG1873-PB,
           isoform B protein.
          Length = 462

 Score = 92.7 bits (220), Expect = 5e-19
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGTGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  +    Y
Sbjct: 4   EKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY 56



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + E RY E ++++  Y+K
Sbjct: 136 HALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIK 179


>AE014297-4790|AAF57185.1|  462|Drosophila melanogaster CG1873-PA,
           isoform A protein.
          Length = 462

 Score = 92.7 bits (220), Expect = 5e-19
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGTGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  +    Y
Sbjct: 4   EKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY 56



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + E RY E ++++  Y+K
Sbjct: 136 HALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIK 179


>BT011039-1|AAR30199.1|  463|Drosophila melanogaster LP10071p
           protein.
          Length = 463

 Score = 92.3 bits (219), Expect = 6e-19
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGTGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  +    Y
Sbjct: 4   EKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY 56



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + E RY E ++++  Y+K
Sbjct: 136 HALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIK 179


>AE013599-1358|AAM68698.1|  463|Drosophila melanogaster CG8280-PB,
           isoform B protein.
          Length = 463

 Score = 92.3 bits (219), Expect = 6e-19
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGTGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  +    Y
Sbjct: 4   EKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY 56



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + E RY E ++++  Y+K
Sbjct: 136 HALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIK 179


>AE013599-1357|AAF58608.1|  463|Drosophila melanogaster CG8280-PA,
           isoform A protein.
          Length = 463

 Score = 92.3 bits (219), Expect = 6e-19
 Identities = 39/79 (49%), Positives = 56/79 (70%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL++
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGTGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  +    Y
Sbjct: 4   EKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY 56



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + E RY E ++++  Y+K
Sbjct: 136 HALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIK 179


>X06870-1|CAA29994.1|  462|Drosophila melanogaster EF-1-alpha
           protein.
          Length = 462

 Score = 90.2 bits (214), Expect = 2e-18
 Identities = 39/79 (49%), Positives = 55/79 (69%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL+ 
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLID 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  + GQTR+
Sbjct: 117 AAGTGEFEAGISKNGQTRE 135



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  +    Y
Sbjct: 4   EKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY 56



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + E RY E ++++  Y+K
Sbjct: 136 HALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIK 179


>X06869-1|CAA29993.1|  463|Drosophila melanogaster EF-1-alpha
           protein.
          Length = 463

 Score = 84.6 bits (200), Expect = 1e-16
 Identities = 37/79 (46%), Positives = 53/79 (67%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AV + 
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVQID 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  +  QTR+
Sbjct: 117 AAGTGEFEAGISKNDQTRE 135



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  +    Y
Sbjct: 4   EKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY 56



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + E RY E ++++  Y+K
Sbjct: 136 HALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIK 179


>M11744-1|AAA28526.1|  463|Drosophila melanogaster protein (
           D.melanogaster 50 kDaprotein F1 gene, complete cds. ).
          Length = 463

 Score = 84.6 bits (200), Expect = 1e-16
 Identities = 37/79 (46%), Positives = 53/79 (67%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AV + 
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVQID 116

Query: 453 SARKGEFETGFDRGGQTRD 509
           +A  GEFE G  +  QTR+
Sbjct: 117 AAGTGEFEAGISKNDQTRE 135



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 26/53 (49%), Positives = 38/53 (71%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  +    Y
Sbjct: 4   EKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKY 56



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + E RY E ++++  Y+K
Sbjct: 136 HALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIK 179


>BT003749-1|AAO41413.1|  489|Drosophila melanogaster RH68252p
           protein.
          Length = 489

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 25/62 (40%), Positives = 38/62 (61%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D   EE+ +G T+ V    ++TE +H+   D PGH  ++ NMI G AQ D A+LV++A 
Sbjct: 120 IDNAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAAT 179

Query: 462 KG 467
            G
Sbjct: 180 DG 181



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +1

Query: 118 KEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLE 225
           K H NV  IGHVD GK+T+   I  +  + DK+  E
Sbjct: 80  KPHCNVGTIGHVDHGKTTLTAAITKV--LADKQLAE 113



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 10/21 (47%), Positives = 15/21 (71%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMD 571
           H +LAK  G+ H+V  +NK+D
Sbjct: 189 HMLLAKQIGIDHIVVFINKVD 209


>AY058493-1|AAL13722.1|  300|Drosophila melanogaster GM14682p
           protein.
          Length = 300

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 25/62 (40%), Positives = 38/62 (61%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D   EE+ +G T+ V    ++TE +H+   D PGH  ++ NMI G AQ D A+LV++A 
Sbjct: 120 IDNAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAAT 179

Query: 462 KG 467
            G
Sbjct: 180 DG 181



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +1

Query: 118 KEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLE 225
           K H NV  IGHVD GK+T+   I  +  + DK+  E
Sbjct: 80  KPHCNVGTIGHVDHGKTTLTAAITKV--LADKQLAE 113



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 10/21 (47%), Positives = 15/21 (71%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMD 571
           H +LAK  G+ H+V  +NK+D
Sbjct: 189 HMLLAKQIGIDHIVVFINKVD 209


>AE013599-1732|AAF58366.1|  489|Drosophila melanogaster CG6050-PA
           protein.
          Length = 489

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 25/62 (40%), Positives = 38/62 (61%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D   EE+ +G T+ V    ++TE +H+   D PGH  ++ NMI G AQ D A+LV++A 
Sbjct: 120 IDNAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAAT 179

Query: 462 KG 467
            G
Sbjct: 180 DG 181



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +1

Query: 118 KEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLE 225
           K H NV  IGHVD GK+T+   I  +  + DK+  E
Sbjct: 80  KPHCNVGTIGHVDHGKTTLTAAITKV--LADKQLAE 113



 Score = 29.5 bits (63), Expect = 4.8
 Identities = 10/21 (47%), Positives = 15/21 (71%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMD 571
           H +LAK  G+ H+V  +NK+D
Sbjct: 189 HMLLAKQIGIDHIVVFINKVD 209


>BT010319-1|AAQ23637.1|  456|Drosophila melanogaster AT01345p
           protein.
          Length = 456

 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 25/69 (36%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +3

Query: 267 YLSW-ALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAV 443
           YLS+  +D   EE+ +G T+      + T ++ +   D PGH  ++ NMI GA+Q D A+
Sbjct: 89  YLSYDQIDRAPEEKARGITINACHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAI 148

Query: 444 LVISARKGE 470
           LV++A  G+
Sbjct: 149 LVVAATDGQ 157



 Score = 32.3 bits (70), Expect = 0.69
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 3/47 (6%)
 Frame = +1

Query: 124 HVNVVFIGHVDAGKSTIGG---QIMSLTGMVDKRTLEKYEREAREKS 255
           H NV  IGHVD GK+T+     +I S  G+ +  + ++ +R   EK+
Sbjct: 57  HCNVGTIGHVDHGKTTLTAAITRIQSQKGLAEYLSYDQIDRAPEEKA 103


>AY058330-1|AAL13559.1|  456|Drosophila melanogaster GH10272p
           protein.
          Length = 456

 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 25/69 (36%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +3

Query: 267 YLSW-ALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAV 443
           YLS+  +D   EE+ +G T+      + T ++ +   D PGH  ++ NMI GA+Q D A+
Sbjct: 89  YLSYDQIDRAPEEKARGITINACHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAI 148

Query: 444 LVISARKGE 470
           LV++A  G+
Sbjct: 149 LVVAATDGQ 157



 Score = 32.3 bits (70), Expect = 0.69
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 3/47 (6%)
 Frame = +1

Query: 124 HVNVVFIGHVDAGKSTIGG---QIMSLTGMVDKRTLEKYEREAREKS 255
           H NV  IGHVD GK+T+     +I S  G+ +  + ++ +R   EK+
Sbjct: 57  HCNVGTIGHVDHGKTTLTAAITRIQSQKGLAEYLSYDQIDRAPEEKA 103


>AE013599-436|AAF59240.1|  456|Drosophila melanogaster CG12736-PA
           protein.
          Length = 456

 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 25/69 (36%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +3

Query: 267 YLSW-ALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAV 443
           YLS+  +D   EE+ +G T+      + T ++ +   D PGH  ++ NMI GA+Q D A+
Sbjct: 89  YLSYDQIDRAPEEKARGITINACHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAI 148

Query: 444 LVISARKGE 470
           LV++A  G+
Sbjct: 149 LVVAATDGQ 157



 Score = 32.3 bits (70), Expect = 0.69
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 3/47 (6%)
 Frame = +1

Query: 124 HVNVVFIGHVDAGKSTIGG---QIMSLTGMVDKRTLEKYEREAREKS 255
           H NV  IGHVD GK+T+     +I S  G+ +  + ++ +R   EK+
Sbjct: 57  HCNVGTIGHVDHGKTTLTAAITRIQSQKGLAEYLSYDQIDRAPEEKA 103


>AY071627-1|AAL49249.1|  511|Drosophila melanogaster RE67487p
           protein.
          Length = 511

 Score = 46.0 bits (104), Expect = 5e-05
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 9/73 (12%)
 Frame = +3

Query: 279 ALDTNQEERDKGKTVEVGRAYF---------ETEKKHFTILDAPGHKSFVPNMIGGAAQA 431
           A D N +  ++G T+++G +           + E+  FT +D PGH S +  +IGGA   
Sbjct: 32  AFDKNPQSVERGITLDLGFSGLLVDAPAHLPQGEQLQFTFVDCPGHASLIRTIIGGAQII 91

Query: 432 DLAVLVISARKGE 470
           DL +LV+ A+KG+
Sbjct: 92  DLMLLVVDAQKGK 104


>AE013599-3196|AAF46721.1|  511|Drosophila melanogaster CG9841-PA
           protein.
          Length = 511

 Score = 46.0 bits (104), Expect = 5e-05
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 9/73 (12%)
 Frame = +3

Query: 279 ALDTNQEERDKGKTVEVGRAYF---------ETEKKHFTILDAPGHKSFVPNMIGGAAQA 431
           A D N +  ++G T+++G +           + E+  FT +D PGH S +  +IGGA   
Sbjct: 32  AFDKNPQSVERGITLDLGFSGLLVDAPAHLPQGEQLQFTFVDCPGHASLIRTIIGGAQII 91

Query: 432 DLAVLVISARKGE 470
           DL +LV+ A+KG+
Sbjct: 92  DLMLLVVDAQKGK 104


>BT001873-1|AAN71645.1|  362|Drosophila melanogaster SD08285p
           protein.
          Length = 362

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +3

Query: 408 MIGGAAQADLAVLVISARKGEFETGFDRGGQTRD 509
           MI G +QAD AVL+++A  GEFE G  + GQTR+
Sbjct: 1   MITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 34



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + E RY E ++++  Y+K
Sbjct: 35  HALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIK 78


>AY089522-1|AAL90260.1|  362|Drosophila melanogaster GM14559p
           protein.
          Length = 362

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +3

Query: 408 MIGGAAQADLAVLVISARKGEFETGFDRGGQTRD 509
           MI G +QAD AVL+++A  GEFE G  + GQTR+
Sbjct: 1   MITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 34



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK L+  VNKMD     + E RY E ++++  Y+K
Sbjct: 35  HALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIK 78


>BT023763-1|AAZ41771.1|  639|Drosophila melanogaster RE37786p
           protein.
          Length = 639

 Score = 35.5 bits (78), Expect = 0.074
 Identities = 19/62 (30%), Positives = 30/62 (48%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D+ + ER +G T++    Y   +  +  I+D PGH  F   +       D AVLV+ A 
Sbjct: 85  MDSMELERQRGITIQSAATYTLWKDTNINIIDTPGHVDFTVEVERALRVLDGAVLVLCAV 144

Query: 462 KG 467
            G
Sbjct: 145 GG 146


>AE014134-1251|AAF52495.2|  745|Drosophila melanogaster CG4567-PA
           protein.
          Length = 745

 Score = 35.5 bits (78), Expect = 0.074
 Identities = 19/62 (30%), Positives = 30/62 (48%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D+ + ER +G T++    Y   +  +  I+D PGH  F   +       D AVLV+ A 
Sbjct: 85  MDSMELERQRGITIQSAATYTLWKDTNINIIDTPGHVDFTVEVERALRVLDGAVLVLCAV 144

Query: 462 KG 467
            G
Sbjct: 145 GG 146


>AY119138-1|AAM50998.1|  696|Drosophila melanogaster RE37995p
           protein.
          Length = 696

 Score = 34.3 bits (75), Expect = 0.17
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
 Frame = +3

Query: 312 GKTVEVGRAYFETEK-KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           G T  +G      E  +  T LD PGH +F      GA   D+ VLV++A  G
Sbjct: 194 GITQHIGAFTVTLENGERVTFLDTPGHAAFSAMRARGAVATDIIVLVVAAEDG 246


>AE014297-4239|AAF56796.2|  696|Drosophila melanogaster CG12413-PA
           protein.
          Length = 696

 Score = 34.3 bits (75), Expect = 0.17
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
 Frame = +3

Query: 312 GKTVEVGRAYFETEK-KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           G T  +G      E  +  T LD PGH +F      GA   D+ VLV++A  G
Sbjct: 194 GITQHIGAFTVTLENGERVTFLDTPGHAAFSAMRARGAVATDIIVLVVAAEDG 246


>X80069-1|CAA56375.1|  475|Drosophila melanogaster 51KDa protein
           protein.
          Length = 475

 Score = 33.9 bits (74), Expect = 0.23
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +3

Query: 357 KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           +H + +D PGH   +  M+ GAA  D A+L+I+  +
Sbjct: 127 RHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNE 162



 Score = 31.1 bits (67), Expect = 1.6
 Identities = 19/70 (27%), Positives = 33/70 (47%)
 Frame = +1

Query: 19  DTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLT 198
           + Q+G     +  +L+     K  P   +  S++  +N+  IGHV  GKST+   I  + 
Sbjct: 5   EAQIGVNRNLQKQDLSNLDVSKLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQ 64

Query: 199 GMVDKRTLEK 228
            +  K  LE+
Sbjct: 65  TVRFKNELER 74


>BT012446-1|AAS93717.1|  467|Drosophila melanogaster RE71279p
           protein.
          Length = 467

 Score = 33.9 bits (74), Expect = 0.23
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +3

Query: 357 KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           +H + +D PGH   +  M+ GAA  D A+L+I+  +
Sbjct: 119 RHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNE 154


>AY061102-1|AAL28650.1|  475|Drosophila melanogaster LD09025p
           protein.
          Length = 475

 Score = 33.9 bits (74), Expect = 0.23
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +3

Query: 357 KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           +H + +D PGH   +  M+ GAA  D A+L+I+  +
Sbjct: 127 RHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNE 162



 Score = 31.1 bits (67), Expect = 1.6
 Identities = 19/70 (27%), Positives = 33/70 (47%)
 Frame = +1

Query: 19  DTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLT 198
           + Q+G     +  +L+     K  P   +  S++  +N+  IGHV  GKST+   I  + 
Sbjct: 5   EAQIGVNRNLQKQDLSNLDVSKLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQ 64

Query: 199 GMVDKRTLEK 228
            +  K  LE+
Sbjct: 65  TVRFKNELER 74


>AJ290956-1|CAB93767.1|  475|Drosophila melanogaster eukaryotic
           translation initiationfactor 2 gamma subunit protein.
          Length = 475

 Score = 33.9 bits (74), Expect = 0.23
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +3

Query: 357 KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           +H + +D PGH   +  M+ GAA  D A+L+I+  +
Sbjct: 127 RHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNE 162



 Score = 31.1 bits (67), Expect = 1.6
 Identities = 19/70 (27%), Positives = 33/70 (47%)
 Frame = +1

Query: 19  DTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLT 198
           + Q+G     +  +L+     K  P   +  S++  +N+  IGHV  GKST+   I  + 
Sbjct: 5   EAQIGVNRNLQKQDLSNLDVSKLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQ 64

Query: 199 GMVDKRTLEK 228
            +  K  LE+
Sbjct: 65  TVRFKNELER 74


>AE014297-1977|AAN13641.1|  467|Drosophila melanogaster CG6476-PC,
           isoform C protein.
          Length = 467

 Score = 33.9 bits (74), Expect = 0.23
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +3

Query: 357 KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           +H + +D PGH   +  M+ GAA  D A+L+I+  +
Sbjct: 119 RHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNE 154


>AE014297-1976|AAF55153.1|  475|Drosophila melanogaster CG6476-PB,
           isoform B protein.
          Length = 475

 Score = 33.9 bits (74), Expect = 0.23
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +3

Query: 357 KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           +H + +D PGH   +  M+ GAA  D A+L+I+  +
Sbjct: 127 RHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNE 162



 Score = 31.1 bits (67), Expect = 1.6
 Identities = 19/70 (27%), Positives = 33/70 (47%)
 Frame = +1

Query: 19  DTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLT 198
           + Q+G     +  +L+     K  P   +  S++  +N+  IGHV  GKST+   I  + 
Sbjct: 5   EAQIGVNRNLQKQDLSNLDVSKLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQ 64

Query: 199 GMVDKRTLEK 228
            +  K  LE+
Sbjct: 65  TVRFKNELER 74


>X80070-1|CAA56376.1|  635|Drosophila melanogaster Su(var)3-9
           protein.
          Length = 635

 Score = 32.3 bits (70), Expect = 0.69
 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 5/86 (5%)
 Frame = +1

Query: 19  DTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTI-----GGQ 183
           + Q+G     +  +L+     K  P   +  S++  +N+  IGHV  GKST+     G Q
Sbjct: 5   EAQIGVNRNLQKQDLSNLDVSKLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQ 64

Query: 184 IMSLTGMVDKRTLEKYEREAREKSEN 261
            +     +++    K ER + +K +N
Sbjct: 65  TVRFKNELERNITIKLERLSEKKIKN 90


>BT023767-1|AAZ41775.1| 1144|Drosophila melanogaster RE11051p
           protein.
          Length = 1144

 Score = 32.3 bits (70), Expect = 0.69
 Identities = 16/44 (36%), Positives = 23/44 (52%)
 Frame = +3

Query: 336 AYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           A FE       I+D PGH+SF      G++  D+A+LV+    G
Sbjct: 613 AGFEHRLPGLLIIDTPGHESFSNLRNRGSSLCDIAILVVDIMHG 656


>AJ290956-2|CAB93768.2|  635|Drosophila melanogaster histone-lysine
           N-methyltransferase,H3 lysine-9 specific protein.
          Length = 635

 Score = 32.3 bits (70), Expect = 0.69
 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 5/86 (5%)
 Frame = +1

Query: 19  DTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTI-----GGQ 183
           + Q+G     +  +L+     K  P   +  S++  +N+  IGHV  GKST+     G Q
Sbjct: 5   EAQIGVNRNLQKQDLSNLDVSKLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQ 64

Query: 184 IMSLTGMVDKRTLEKYEREAREKSEN 261
            +     +++    K ER + +K +N
Sbjct: 65  TVRFKNELERNITIKLERLSEKKIKN 90


>AF143207-1|AAF36532.1| 1144|Drosophila melanogaster IF2 protein
           protein.
          Length = 1144

 Score = 32.3 bits (70), Expect = 0.69
 Identities = 16/44 (36%), Positives = 23/44 (52%)
 Frame = +3

Query: 336 AYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           A FE       I+D PGH+SF      G++  D+A+LV+    G
Sbjct: 613 AGFEHRLPGLLIIDTPGHESFSNLRNRGSSLCDIAILVVDIMHG 656


>AE014297-1978|AAF55154.1|  635|Drosophila melanogaster CG6476-PA,
           isoform A protein.
          Length = 635

 Score = 32.3 bits (70), Expect = 0.69
 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 5/86 (5%)
 Frame = +1

Query: 19  DTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTI-----GGQ 183
           + Q+G     +  +L+     K  P   +  S++  +N+  IGHV  GKST+     G Q
Sbjct: 5   EAQIGVNRNLQKQDLSNLDVSKLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQ 64

Query: 184 IMSLTGMVDKRTLEKYEREAREKSEN 261
            +     +++    K ER + +K +N
Sbjct: 65  TVRFKNELERNITIKLERLSEKKIKN 90


>AE014296-661|AAF47774.2| 1144|Drosophila melanogaster CG10840-PB
           protein.
          Length = 1144

 Score = 32.3 bits (70), Expect = 0.69
 Identities = 16/44 (36%), Positives = 23/44 (52%)
 Frame = +3

Query: 336 AYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           A FE       I+D PGH+SF      G++  D+A+LV+    G
Sbjct: 613 AGFEHRLPGLLIIDTPGHESFSNLRNRGSSLCDIAILVVDIMHG 656


>BT003552-1|AAO39556.1|  676|Drosophila melanogaster LP12382p
           protein.
          Length = 676

 Score = 31.9 bits (69), Expect = 0.91
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 4/66 (6%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRA-YFETEKKHFTIL---DAPGHKSFVPNMIGGAAQADLAVLV 449
           LD  Q ER++G TV+   A  F   K    +L   D PGH  F   +    A  D  VL+
Sbjct: 116 LDNLQVERERGITVKAQTASIFHRHKGQLYLLNLIDTPGHVDFSNEVSRSLAACDGVVLL 175

Query: 450 ISARKG 467
           + A  G
Sbjct: 176 VDACHG 181



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +1

Query: 130 NVVFIGHVDAGKSTIGGQIMSLTGMV 207
           N   I HVD GKST+  +++ LTG +
Sbjct: 81  NFSIIAHVDHGKSTLADRLLELTGAI 106


>AF017777-7|AAC28402.1|  679|Drosophila melanogaster waclaw protein.
          Length = 679

 Score = 31.9 bits (69), Expect = 0.91
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 4/66 (6%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRA-YFETEKKHFTIL---DAPGHKSFVPNMIGGAAQADLAVLV 449
           LD  Q ER++G TV+   A  F   K    +L   D PGH  F   +    A  D  VL+
Sbjct: 136 LDNLQVERERGITVKAQTASIFHRHKGQLYLLNLIDTPGHVDFSNEVSRSLAACDGVVLL 195

Query: 450 ISARKG 467
           + A  G
Sbjct: 196 VDACHG 201



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +1

Query: 130 NVVFIGHVDAGKSTIGGQIMSLTGMV 207
           N   I HVD GKST+  +++ LTG +
Sbjct: 101 NFSIIAHVDHGKSTLADRLLELTGAI 126


>AE014298-3127|AAF50824.2|  696|Drosophila melanogaster CG1410-PA,
           isoform A protein.
          Length = 696

 Score = 31.9 bits (69), Expect = 0.91
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 4/66 (6%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRA-YFETEKKHFTIL---DAPGHKSFVPNMIGGAAQADLAVLV 449
           LD  Q ER++G TV+   A  F   K    +L   D PGH  F   +    A  D  VL+
Sbjct: 136 LDNLQVERERGITVKAQTASIFHRHKGQLYLLNLIDTPGHVDFSNEVSRSLAACDGVVLL 195

Query: 450 ISARKG 467
           + A  G
Sbjct: 196 VDACHG 201



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +1

Query: 130 NVVFIGHVDAGKSTIGGQIMSLTGMV 207
           N   I HVD GKST+  +++ LTG +
Sbjct: 101 NFSIIAHVDHGKSTLADRLLELTGAI 126


>AE014298-1971|AAF48328.2|  342|Drosophila melanogaster CG11063-PB
           protein.
          Length = 342

 Score = 31.1 bits (67), Expect = 1.6
 Identities = 26/89 (29%), Positives = 40/89 (44%), Gaps = 6/89 (6%)
 Frame = +1

Query: 31  GNTNPNEDGELTKKIPKKKPPRVED--TRSKKEHVNVV-FIG---HVDAGKSTIGGQIMS 192
           G+  P  DG +  +  ++ P  +E+    S+++H N+  F+    H D G S  GG I  
Sbjct: 42  GSGGPG-DGGVAMRSYQRSPGAIENYLQESQQQHTNIHRFLAGDAHCDDGSSG-GGHITH 99

Query: 193 LTGMVDKRTLEKYEREAREKSENHGTYHG 279
                    L +   E  E+SE HG Y G
Sbjct: 100 SLAQRKIEELTRQLEEEIEQSEEHGEYFG 128


>AE014296-2740|AAF49461.3| 1033|Drosophila melanogaster CG33158-PB
           protein.
          Length = 1033

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 11/40 (27%), Positives = 24/40 (60%)
 Frame = +1

Query: 109 RSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           R +++  N+  + HVD GK+T+   +++  G++ +R   K
Sbjct: 14  RRRQQVRNICILAHVDHGKTTLADSLVASNGIISQRMAGK 53


>AY119468-1|AAM50122.1|  667|Drosophila melanogaster GH04243p
           protein.
          Length = 667

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +1

Query: 19  DTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQ 183
           +T+  NT P    ++  +     PP+ + + S   H N   +GHV+  K+T G Q
Sbjct: 307 ETEQANTEPKHINDIKSE---NSPPKPKASPSTNGHQNGQGVGHVNGHKTTNGHQ 358


>AE014134-709|AAN11172.1|  667|Drosophila melanogaster CG3714-PE,
           isoform E protein.
          Length = 667

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +1

Query: 19  DTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQ 183
           +T+  NT P    ++  +     PP+ + + S   H N   +GHV+  K+T G Q
Sbjct: 307 ETEQANTEPKHINDIKSE---NSPPKPKASPSTNGHQNGQGVGHVNGHKTTNGHQ 358


>AE014134-708|AAN11171.1|  667|Drosophila melanogaster CG3714-PD,
           isoform D protein.
          Length = 667

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +1

Query: 19  DTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQ 183
           +T+  NT P    ++  +     PP+ + + S   H N   +GHV+  K+T G Q
Sbjct: 307 ETEQANTEPKHINDIKSE---NSPPKPKASPSTNGHQNGQGVGHVNGHKTTNGHQ 358


>AE014134-707|AAN11170.1|  667|Drosophila melanogaster CG3714-PC,
           isoform C protein.
          Length = 667

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +1

Query: 19  DTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQ 183
           +T+  NT P    ++  +     PP+ + + S   H N   +GHV+  K+T G Q
Sbjct: 307 ETEQANTEPKHINDIKSE---NSPPKPKASPSTNGHQNGQGVGHVNGHKTTNGHQ 358


>AE014134-706|AAN11169.1|  667|Drosophila melanogaster CG3714-PB,
           isoform B protein.
          Length = 667

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +1

Query: 19  DTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQ 183
           +T+  NT P    ++  +     PP+ + + S   H N   +GHV+  K+T G Q
Sbjct: 307 ETEQANTEPKHINDIKSE---NSPPKPKASPSTNGHQNGQGVGHVNGHKTTNGHQ 358


>AY061131-1|AAL28679.1|  358|Drosophila melanogaster LD11455p
           protein.
          Length = 358

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = +1

Query: 40  NPNEDGELTKKIPKKKPPRVEDTRSKKEHVNV 135
           NP+ +G   KK PKKK P+ +      E++NV
Sbjct: 22  NPSGNGVAAKKKPKKKKPKKKKAAVPNENLNV 53


>AE013599-2837|AAF57594.1|  358|Drosophila melanogaster CG7137-PA
           protein.
          Length = 358

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = +1

Query: 40  NPNEDGELTKKIPKKKPPRVEDTRSKKEHVNV 135
           NP+ +G   KK PKKK P+ +      E++NV
Sbjct: 22  NPSGNGVAAKKKPKKKKPKKKKAAVPNENLNV 53


>AE014297-3196|AAF56031.2|  692|Drosophila melanogaster CG31159-PA
           protein.
          Length = 692

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 15/57 (26%), Positives = 23/57 (40%)
 Frame = +3

Query: 297 EERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           +ER++G T+      F        +LD PGH  F   +       D  V+V+    G
Sbjct: 78  QERERGITICSSAVTFSWNDHRINLLDTPGHIDFTMEVEQSLYAVDGVVVVLDGTAG 134


>AY060791-1|AAL28339.1|  507|Drosophila melanogaster GH26014p
           protein.
          Length = 507

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 14/42 (33%), Positives = 19/42 (45%)
 Frame = +2

Query: 566 MDDPTVNWDEKRYNECREKILPYLKNWVSIQRKTYPSFLFPG 691
           +DDPTVN     Y +C  ++  YL         T P+   PG
Sbjct: 117 LDDPTVNKYRAGYTDCAREVARYLATPEPPPMGTMPTLAEPG 158


>AE014134-3017|AAF53741.1|  507|Drosophila melanogaster CG10446-PA
           protein.
          Length = 507

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 14/42 (33%), Positives = 19/42 (45%)
 Frame = +2

Query: 566 MDDPTVNWDEKRYNECREKILPYLKNWVSIQRKTYPSFLFPG 691
           +DDPTVN     Y +C  ++  YL         T P+   PG
Sbjct: 117 LDDPTVNKYRAGYTDCAREVARYLATPEPPPMGTMPTLAEPG 158


>X15805-1|CAA33804.1|  844|Drosophila melanogaster protein (
           Drosophila DMEF2 genefor the translation elongation
           factor 2. ).
          Length = 844

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 1/32 (3%)
 Frame = +1

Query: 115 KKEHV-NVVFIGHVDAGKSTIGGQIMSLTGMV 207
           KK ++ N+  I HVD GKST+   ++S  G++
Sbjct: 15  KKRNIRNMSVIAHVDHGKSTLTDSLVSKAGII 46


>BT001894-1|AAN71683.1| 1047|Drosophila melanogaster SD17880p
           protein.
          Length = 1047

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +3

Query: 129 KCSIYRTCRCRKVDYWWSNNVTHW 200
           KCS  R  RC+++ Y W+NN   +
Sbjct: 216 KCSSIRIFRCKQLVYAWNNNTNRF 239


>AY084119-1|AAL89857.1|  658|Drosophila melanogaster LD19039p
           protein.
          Length = 658

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +3

Query: 129 KCSIYRTCRCRKVDYWWSNNVTHW 200
           KCS  R  RC+++ Y W+NN   +
Sbjct: 279 KCSSIRIFRCKQLVYAWNNNTNRF 302


>AY075481-1|AAL68292.1|  844|Drosophila melanogaster RE38659p
           protein.
          Length = 844

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 1/32 (3%)
 Frame = +1

Query: 115 KKEHV-NVVFIGHVDAGKSTIGGQIMSLTGMV 207
           KK ++ N+  I HVD GKST+   ++S  G++
Sbjct: 15  KKRNIRNMSVIAHVDHGKSTLTDSLVSKAGII 46


>AY069338-1|AAL39483.1|  239|Drosophila melanogaster LD05303p
           protein.
          Length = 239

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +3

Query: 129 KCSIYRTCRCRKVDYWWSNNVTHW 200
           KCS  R  RC+++ Y W+NN   +
Sbjct: 142 KCSSIRIFRCKQLVYAWNNNTNRF 165


>AE014297-309|AAN13252.1| 1393|Drosophila melanogaster CG31551-PA
           protein.
          Length = 1393

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 12/23 (52%), Positives = 17/23 (73%)
 Frame = +1

Query: 193 LTGMVDKRTLEKYEREAREKSEN 261
           ++G +DKR  E+YER ARE+  N
Sbjct: 684 VSGELDKRDQEEYERFAREEESN 706


>AE014135-27|AAN06557.1|  497|Drosophila melanogaster CG32000-PC,
           isoform C protein.
          Length = 497

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +3

Query: 129 KCSIYRTCRCRKVDYWWSNNVTHW 200
           KCS  R  RC+++ Y W+NN   +
Sbjct: 118 KCSSIRIFRCKQLVYAWNNNTNRF 141


>AE014135-26|AAN06555.1|  521|Drosophila melanogaster CG32000-PF,
           isoform F protein.
          Length = 521

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +3

Query: 129 KCSIYRTCRCRKVDYWWSNNVTHW 200
           KCS  R  RC+++ Y W+NN   +
Sbjct: 142 KCSSIRIFRCKQLVYAWNNNTNRF 165


>AE014135-25|AAN06556.2| 1314|Drosophila melanogaster CG32000-PB,
           isoform B protein.
          Length = 1314

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +3

Query: 129 KCSIYRTCRCRKVDYWWSNNVTHW 200
           KCS  R  RC+++ Y W+NN   +
Sbjct: 142 KCSSIRIFRCKQLVYAWNNNTNRF 165


>AE014135-24|AAN06554.2| 1314|Drosophila melanogaster CG32000-PA,
           isoform A protein.
          Length = 1314

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +3

Query: 129 KCSIYRTCRCRKVDYWWSNNVTHW 200
           KCS  R  RC+++ Y W+NN   +
Sbjct: 142 KCSSIRIFRCKQLVYAWNNNTNRF 165


>AE014135-23|AAN06553.1|  595|Drosophila melanogaster CG32000-PE,
           isoform E protein.
          Length = 595

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +3

Query: 129 KCSIYRTCRCRKVDYWWSNNVTHW 200
           KCS  R  RC+++ Y W+NN   +
Sbjct: 216 KCSSIRIFRCKQLVYAWNNNTNRF 239


>AE014135-22|AAS64610.1| 1388|Drosophila melanogaster CG32000-PG,
           isoform G protein.
          Length = 1388

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +3

Query: 129 KCSIYRTCRCRKVDYWWSNNVTHW 200
           KCS  R  RC+++ Y W+NN   +
Sbjct: 216 KCSSIRIFRCKQLVYAWNNNTNRF 239


>AE014135-21|AAN06552.1|  658|Drosophila melanogaster CG32000-PD,
           isoform D protein.
          Length = 658

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +3

Query: 129 KCSIYRTCRCRKVDYWWSNNVTHW 200
           KCS  R  RC+++ Y W+NN   +
Sbjct: 279 KCSSIRIFRCKQLVYAWNNNTNRF 302


>AE014134-3534|AAN11135.1|  832|Drosophila melanogaster CG2238-PC,
           isoform C protein.
          Length = 832

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 1/32 (3%)
 Frame = +1

Query: 115 KKEHV-NVVFIGHVDAGKSTIGGQIMSLTGMV 207
           KK ++ N+  I HVD GKST+   ++S  G++
Sbjct: 3   KKRNIRNMSVIAHVDHGKSTLTDSLVSKAGII 34


>AE014134-3533|AAG22125.2|  832|Drosophila melanogaster CG2238-PB,
           isoform B protein.
          Length = 832

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 1/32 (3%)
 Frame = +1

Query: 115 KKEHV-NVVFIGHVDAGKSTIGGQIMSLTGMV 207
           KK ++ N+  I HVD GKST+   ++S  G++
Sbjct: 3   KKRNIRNMSVIAHVDHGKSTLTDSLVSKAGII 34


>AE014134-3532|AAF57226.2|  844|Drosophila melanogaster CG2238-PA,
           isoform A protein.
          Length = 844

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 1/32 (3%)
 Frame = +1

Query: 115 KKEHV-NVVFIGHVDAGKSTIGGQIMSLTGMV 207
           KK ++ N+  I HVD GKST+   ++S  G++
Sbjct: 15  KKRNIRNMSVIAHVDHGKSTLTDSLVSKAGII 46


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,399,982
Number of Sequences: 53049
Number of extensions: 588825
Number of successful extensions: 2066
Number of sequences better than 10.0: 73
Number of HSP's better than 10.0 without gapping: 1893
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2064
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3231892257
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -