SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20009
         (710 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M62398-1|AAB03701.1|  165|Drosophila melanogaster CYP-1 protein.      164   1e-40
BT009946-1|AAQ22415.1|  165|Drosophila melanogaster SD01793p pro...   164   1e-40
AE014298-2364|AAF48589.2|  227|Drosophila melanogaster CG9916-PA...   164   1e-40
BT016150-1|AAV37035.1|  194|Drosophila melanogaster AT16671p pro...   155   4e-38
AY060923-1|AAL28471.1|  164|Drosophila melanogaster GM06533p pro...   155   4e-38
AE014296-2371|AAF49750.1|  164|Drosophila melanogaster CG7768-PB...   155   4e-38
AE014296-2370|AAF49751.1|  164|Drosophila melanogaster CG7768-PA...   155   4e-38
AY061421-1|AAL28969.1|  300|Drosophila melanogaster LD35248p pro...   146   2e-35
AF182826-1|AAF01031.1|  300|Drosophila melanogaster cyclophilin-...   146   2e-35
AE013599-2502|AAF57839.1|  300|Drosophila melanogaster CG4886-PA...   146   2e-35
BT021266-1|AAX33414.1|  205|Drosophila melanogaster RE50843p pro...   146   3e-35
AE013599-3426|AAF46873.1|  205|Drosophila melanogaster CG2852-PA...   146   3e-35
AE013599-3427|AAG22196.1|  120|Drosophila melanogaster CG2852-PB...   143   2e-34
BT022685-1|AAY55101.1|  183|Drosophila melanogaster IP07164p pro...   123   2e-28
AE013599-201|AAM70809.1|  183|Drosophila melanogaster CG17266-PA...   123   2e-28
BT001578-1|AAN71333.1| 1002|Drosophila melanogaster RE23622p pro...   118   6e-27
AY134669-1|AAN39118.1|  968|Drosophila melanogaster peptidylprol...   118   6e-27
AE014297-4230|AAF56786.1|  970|Drosophila melanogaster CG1866-PA...   118   6e-27
AY070975-1|AAL48597.1|  176|Drosophila melanogaster RE07451p pro...   113   2e-25
AE014296-107|AAF47391.1|  176|Drosophila melanogaster CG13892-PA...   113   2e-25
X14769-1|CAA32877.1|  237|Drosophila melanogaster ninaA protein.      107   2e-23
M22851-1|AAA28717.1|  237|Drosophila melanogaster cyclosporine A...   107   2e-23
AY119494-1|AAM50148.1|  237|Drosophila melanogaster GH08867p pro...   107   2e-23
AE014134-179|AAF51437.1|  237|Drosophila melanogaster CG3966-PA ...   107   2e-23
AY051909-1|AAK93333.1|  637|Drosophila melanogaster LD39850p pro...   100   2e-21
AE013599-3904|AAF47231.2|  637|Drosophila melanogaster CG3511-PA...   100   2e-21
AY061295-1|AAL28843.1|  517|Drosophila melanogaster LD20635p pro...    99   5e-21
AE013599-2245|AAF58019.1|  517|Drosophila melanogaster CG7747-PA...    99   5e-21
AY058303-1|AAL13532.1|  383|Drosophila melanogaster GH06403p pro...    85   7e-17
AE014296-1699|AAF50235.1|  383|Drosophila melanogaster CG8336-PC...    85   7e-17
AE014296-1698|AAN11948.1|  383|Drosophila melanogaster CG8336-PB...    85   7e-17
AE014296-1697|AAN11947.1|  383|Drosophila melanogaster CG8336-PA...    85   7e-17
AY113541-1|AAM29546.1|  161|Drosophila melanogaster RE61564p pro...    80   3e-15
AE013599-1109|AAM68761.1|  161|Drosophila melanogaster CG11777-P...    80   3e-15
BT011449-1|AAR99107.1|  161|Drosophila melanogaster RE40650p pro...    80   3e-15
AY070988-1|AAL48610.1|  502|Drosophila melanogaster RE08109p pro...    75   1e-13
AE014296-2031|AAF50009.1|  502|Drosophila melanogaster CG10907-P...    75   1e-13
AF132148-1|AAD34736.1|  653|Drosophila melanogaster unknown prot...    59   7e-09
AE014297-3634|AAF56342.1|  653|Drosophila melanogaster CG5808-PA...    59   7e-09
AE014297-3820|AAN14059.1|  680|Drosophila melanogaster CG5071-PB...    48   2e-05
BT001373-1|AAN71128.1|  139|Drosophila melanogaster AT31683p pro...    41   0.002
AL031028-1|CAA19845.2| 1795|Drosophila melanogaster EG:56G7.1 pr...    32   0.67 
AE014298-231|AAF45644.1| 1795|Drosophila melanogaster CG14796-PA...    32   0.67 
AY119632-1|AAM50286.1|  796|Drosophila melanogaster RE37895p pro...    29   8.2  
AY061361-1|AAL28909.1|  940|Drosophila melanogaster LD28662p pro...    29   8.2  
AY051526-1|AAK92950.1|  404|Drosophila melanogaster GH18016p pro...    29   8.2  
AF324425-1|AAG48327.1| 2618|Drosophila melanogaster transcriptio...    29   8.2  
AF227215-1|AAF43172.1| 2618|Drosophila melanogaster jlkjlkj prot...    29   8.2  
AF227214-1|AAF43021.1| 2618|Drosophila melanogaster Pap/DTRAP240...    29   8.2  
AF226855-1|AAF36691.1| 2618|Drosophila melanogaster TRAP240 prot...    29   8.2  
AE014296-3458|AAN12149.1| 2618|Drosophila melanogaster CG9936-PD...    29   8.2  
AE014296-3457|AAN12148.1| 2618|Drosophila melanogaster CG9936-PC...    29   8.2  
AE014296-2066|AAF49982.1|  796|Drosophila melanogaster CG7248-PA...    29   8.2  
AE014134-11|AAF51568.2| 2833|Drosophila melanogaster CG31973-PB,...    29   8.2  
AE013599-3874|AAF47207.1|  404|Drosophila melanogaster CG3492-PA...    29   8.2  

>M62398-1|AAB03701.1|  165|Drosophila melanogaster CYP-1 protein.
          Length = 165

 Score =  164 bits (398), Expect = 1e-40
 Identities = 74/103 (71%), Positives = 86/103 (83%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P+FM QGGDFTNHNGTGGKSIYGNKF DENF LKHTG G+LSMANAGA+TN
Sbjct: 50  KGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTN 109

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGR 531
           GSQFFI TVKT+WLD +HVVFG VVEG++VVK+IE+  +  G+
Sbjct: 110 GSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGK 152



 Score =  112 bits (270), Expect = 4e-25
 Identities = 50/64 (78%), Positives = 56/64 (87%)
 Frame = +2

Query: 83  SLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISC 262
           +LPRVFFD+T D+ PLG+IV+ELRSDV PKT ENFRALCTGEKGFGYKGSIFHRVIP   
Sbjct: 3   TLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFM 62

Query: 263 CKEG 274
           C+ G
Sbjct: 63  CQGG 66



 Score = 28.7 bits (61), Expect = 8.2
 Identities = 10/20 (50%), Positives = 16/20 (80%)
 Frame = +3

Query: 510 FGSHSGKTSKRIVIKDCGQI 569
           +GS SGKTSK+I++ + G +
Sbjct: 146 YGSQSGKTSKKIIVANSGSL 165


>BT009946-1|AAQ22415.1|  165|Drosophila melanogaster SD01793p
           protein.
          Length = 165

 Score =  164 bits (398), Expect = 1e-40
 Identities = 74/103 (71%), Positives = 86/103 (83%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P+FM QGGDFTNHNGTGGKSIYGNKF DENF LKHTG G+LSMANAGA+TN
Sbjct: 50  KGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTN 109

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGR 531
           GSQFFI TVKT+WLD +HVVFG VVEG++VVK+IE+  +  G+
Sbjct: 110 GSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGK 152



 Score =  112 bits (270), Expect = 4e-25
 Identities = 50/64 (78%), Positives = 56/64 (87%)
 Frame = +2

Query: 83  SLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISC 262
           +LPRVFFD+T D+ PLG+IV+ELRSDV PKT ENFRALCTGEKGFGYKGSIFHRVIP   
Sbjct: 3   TLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFM 62

Query: 263 CKEG 274
           C+ G
Sbjct: 63  CQGG 66



 Score = 28.7 bits (61), Expect = 8.2
 Identities = 10/20 (50%), Positives = 16/20 (80%)
 Frame = +3

Query: 510 FGSHSGKTSKRIVIKDCGQI 569
           +GS SGKTSK+I++ + G +
Sbjct: 146 YGSQSGKTSKKIIVANSGSL 165


>AE014298-2364|AAF48589.2|  227|Drosophila melanogaster CG9916-PA
           protein.
          Length = 227

 Score =  164 bits (398), Expect = 1e-40
 Identities = 74/103 (71%), Positives = 86/103 (83%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P+FM QGGDFTNHNGTGGKSIYGNKF DENF LKHTG G+LSMANAGA+TN
Sbjct: 112 KGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTN 171

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGR 531
           GSQFFI TVKT+WLD +HVVFG VVEG++VVK+IE+  +  G+
Sbjct: 172 GSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGK 214



 Score =  113 bits (272), Expect = 2e-25
 Identities = 53/67 (79%), Positives = 58/67 (86%), Gaps = 1/67 (1%)
 Frame = +2

Query: 77  KMS-LPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIP 253
           KMS LPRVFFD+T D+ PLG+IV+ELRSDV PKT ENFRALCTGEKGFGYKGSIFHRVIP
Sbjct: 62  KMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIP 121

Query: 254 ISCCKEG 274
              C+ G
Sbjct: 122 NFMCQGG 128



 Score = 28.7 bits (61), Expect = 8.2
 Identities = 10/20 (50%), Positives = 16/20 (80%)
 Frame = +3

Query: 510 FGSHSGKTSKRIVIKDCGQI 569
           +GS SGKTSK+I++ + G +
Sbjct: 208 YGSQSGKTSKKIIVANSGSL 227


>BT016150-1|AAV37035.1|  194|Drosophila melanogaster AT16671p
           protein.
          Length = 194

 Score =  155 bits (377), Expect = 4e-38
 Identities = 70/103 (67%), Positives = 84/103 (81%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P+FM QGGDFTN NGTGG+SIYGNKF DENF LKHTG GVLSMANAGA+TN
Sbjct: 79  KGSPFHRVIPNFMCQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTN 138

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGR 531
           GSQFFI T KT+WLD +HVVFG VVEGM++V+++E+  +  G+
Sbjct: 139 GSQFFICTGKTTWLDNKHVVFGKVVEGMDIVQKVESYGSQDGK 181



 Score =  105 bits (251), Expect = 8e-23
 Identities = 47/68 (69%), Positives = 54/68 (79%)
 Frame = +2

Query: 71  TGKMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           + KMSLPRV+FD+      LG+IV+ELRSDV PKT ENFRALCTGEKG+GYKGS FHRVI
Sbjct: 28  SAKMSLPRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVI 87

Query: 251 PISCCKEG 274
           P   C+ G
Sbjct: 88  PNFMCQGG 95



 Score = 33.5 bits (73), Expect = 0.29
 Identities = 11/20 (55%), Positives = 17/20 (85%)
 Frame = +3

Query: 510 FGSHSGKTSKRIVIKDCGQI 569
           +GS  GKTSK+++I+DCG +
Sbjct: 175 YGSQDGKTSKKVIIEDCGAL 194


>AY060923-1|AAL28471.1|  164|Drosophila melanogaster GM06533p
           protein.
          Length = 164

 Score =  155 bits (377), Expect = 4e-38
 Identities = 70/103 (67%), Positives = 84/103 (81%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P+FM QGGDFTN NGTGG+SIYGNKF DENF LKHTG GVLSMANAGA+TN
Sbjct: 49  KGSPFHRVIPNFMCQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTN 108

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGR 531
           GSQFFI T KT+WLD +HVVFG VVEGM++V+++E+  +  G+
Sbjct: 109 GSQFFICTGKTTWLDNKHVVFGKVVEGMDIVQKVESYGSQDGK 151



 Score =  102 bits (245), Expect = 4e-22
 Identities = 46/65 (70%), Positives = 52/65 (80%)
 Frame = +2

Query: 80  MSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPIS 259
           MSLPRV+FD+      LG+IV+ELRSDV PKT ENFRALCTGEKG+GYKGS FHRVIP  
Sbjct: 1   MSLPRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNF 60

Query: 260 CCKEG 274
            C+ G
Sbjct: 61  MCQGG 65



 Score = 33.5 bits (73), Expect = 0.29
 Identities = 11/20 (55%), Positives = 17/20 (85%)
 Frame = +3

Query: 510 FGSHSGKTSKRIVIKDCGQI 569
           +GS  GKTSK+++I+DCG +
Sbjct: 145 YGSQDGKTSKKVIIEDCGAL 164


>AE014296-2371|AAF49750.1|  164|Drosophila melanogaster CG7768-PB,
           isoform B protein.
          Length = 164

 Score =  155 bits (377), Expect = 4e-38
 Identities = 70/103 (67%), Positives = 84/103 (81%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P+FM QGGDFTN NGTGG+SIYGNKF DENF LKHTG GVLSMANAGA+TN
Sbjct: 49  KGSPFHRVIPNFMCQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTN 108

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGR 531
           GSQFFI T KT+WLD +HVVFG VVEGM++V+++E+  +  G+
Sbjct: 109 GSQFFICTGKTTWLDNKHVVFGKVVEGMDIVQKVESYGSQDGK 151



 Score =  102 bits (245), Expect = 4e-22
 Identities = 46/65 (70%), Positives = 52/65 (80%)
 Frame = +2

Query: 80  MSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPIS 259
           MSLPRV+FD+      LG+IV+ELRSDV PKT ENFRALCTGEKG+GYKGS FHRVIP  
Sbjct: 1   MSLPRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNF 60

Query: 260 CCKEG 274
            C+ G
Sbjct: 61  MCQGG 65



 Score = 33.5 bits (73), Expect = 0.29
 Identities = 11/20 (55%), Positives = 17/20 (85%)
 Frame = +3

Query: 510 FGSHSGKTSKRIVIKDCGQI 569
           +GS  GKTSK+++I+DCG +
Sbjct: 145 YGSQDGKTSKKVIIEDCGAL 164


>AE014296-2370|AAF49751.1|  164|Drosophila melanogaster CG7768-PA,
           isoform A protein.
          Length = 164

 Score =  155 bits (377), Expect = 4e-38
 Identities = 70/103 (67%), Positives = 84/103 (81%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P+FM QGGDFTN NGTGG+SIYGNKF DENF LKHTG GVLSMANAGA+TN
Sbjct: 49  KGSPFHRVIPNFMCQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTN 108

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGR 531
           GSQFFI T KT+WLD +HVVFG VVEGM++V+++E+  +  G+
Sbjct: 109 GSQFFICTGKTTWLDNKHVVFGKVVEGMDIVQKVESYGSQDGK 151



 Score =  102 bits (245), Expect = 4e-22
 Identities = 46/65 (70%), Positives = 52/65 (80%)
 Frame = +2

Query: 80  MSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPIS 259
           MSLPRV+FD+      LG+IV+ELRSDV PKT ENFRALCTGEKG+GYKGS FHRVIP  
Sbjct: 1   MSLPRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNF 60

Query: 260 CCKEG 274
            C+ G
Sbjct: 61  MCQGG 65



 Score = 33.5 bits (73), Expect = 0.29
 Identities = 11/20 (55%), Positives = 17/20 (85%)
 Frame = +3

Query: 510 FGSHSGKTSKRIVIKDCGQI 569
           +GS  GKTSK+++I+DCG +
Sbjct: 145 YGSQDGKTSKKVIIEDCGAL 164


>AY061421-1|AAL28969.1|  300|Drosophila melanogaster LD35248p
           protein.
          Length = 300

 Score =  146 bits (355), Expect = 2e-35
 Identities = 66/104 (63%), Positives = 77/104 (74%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P FM QGGDFTN+NGTGGKSIYG KF DENF LKH   G LSMAN+GA+TN
Sbjct: 184 KGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTN 243

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
           GSQFFI T KT WLD +HVVFG+V+ G EVV+++E   +  G P
Sbjct: 244 GSQFFICTTKTDWLDNKHVVFGHVISGAEVVRKMERCGSKSGTP 287



 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 36/62 (58%), Positives = 45/62 (72%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCK 268
           P+VFFD+ +     G+IV+ LR+DV PKT ENFR LCT E+G+GYKG  FHRVIP   C+
Sbjct: 139 PQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQ 198

Query: 269 EG 274
            G
Sbjct: 199 GG 200


>AF182826-1|AAF01031.1|  300|Drosophila melanogaster cyclophilin-33
           protein.
          Length = 300

 Score =  146 bits (355), Expect = 2e-35
 Identities = 66/104 (63%), Positives = 77/104 (74%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P FM QGGDFTN+NGTGGKSIYG KF DENF LKH   G LSMAN+GA+TN
Sbjct: 184 KGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTN 243

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
           GSQFFI T KT WLD +HVVFG+V+ G EVV+++E   +  G P
Sbjct: 244 GSQFFICTTKTDWLDNKHVVFGHVISGAEVVRKMERCGSKSGTP 287



 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 36/62 (58%), Positives = 45/62 (72%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCK 268
           P+VFFD+ +     G+IV+ LR+DV PKT ENFR LCT E+G+GYKG  FHRVIP   C+
Sbjct: 139 PQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQ 198

Query: 269 EG 274
            G
Sbjct: 199 GG 200


>AE013599-2502|AAF57839.1|  300|Drosophila melanogaster CG4886-PA
           protein.
          Length = 300

 Score =  146 bits (355), Expect = 2e-35
 Identities = 66/104 (63%), Positives = 77/104 (74%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F    P FM QGGDFTN+NGTGGKSIYG KF DENF LKH   G LSMAN+GA+TN
Sbjct: 184 KGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTN 243

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
           GSQFFI T KT WLD +HVVFG+V+ G EVV+++E   +  G P
Sbjct: 244 GSQFFICTTKTDWLDNKHVVFGHVISGAEVVRKMERCGSKSGTP 287



 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 36/62 (58%), Positives = 45/62 (72%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCK 268
           P+VFFD+ +     G+IV+ LR+DV PKT ENFR LCT E+G+GYKG  FHRVIP   C+
Sbjct: 139 PQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQ 198

Query: 269 EG 274
            G
Sbjct: 199 GG 200


>BT021266-1|AAX33414.1|  205|Drosophila melanogaster RE50843p
           protein.
          Length = 205

 Score =  146 bits (353), Expect = 3e-35
 Identities = 69/108 (63%), Positives = 81/108 (75%), Gaps = 1/108 (0%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F      FM+QGGDFT  +GTGG+SIYG +FEDENF LKH G G LSMANAG DTN
Sbjct: 74  KGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTN 133

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAA-TLGRPLRE 543
           GSQFFITT +TSWLDGRHVVFG ++ GM VV+QIE  A     RP+++
Sbjct: 134 GSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKD 181



 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 27/53 (50%), Positives = 34/53 (64%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +VFFD+T+   P G+I I L     PKT ENF+ L    +G GYKGS FHR+I
Sbjct: 30  KVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRII 82


>AE013599-3426|AAF46873.1|  205|Drosophila melanogaster CG2852-PA,
           isoform A protein.
          Length = 205

 Score =  146 bits (353), Expect = 3e-35
 Identities = 69/108 (63%), Positives = 81/108 (75%), Gaps = 1/108 (0%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F      FM+QGGDFT  +GTGG+SIYG +FEDENF LKH G G LSMANAG DTN
Sbjct: 74  KGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTN 133

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAA-TLGRPLRE 543
           GSQFFITT +TSWLDGRHVVFG ++ GM VV+QIE  A     RP+++
Sbjct: 134 GSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKD 181



 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 27/53 (50%), Positives = 34/53 (64%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +VFFD+T+   P G+I I L     PKT ENF+ L    +G GYKGS FHR+I
Sbjct: 30  KVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRII 82


>AE013599-3427|AAG22196.1|  120|Drosophila melanogaster CG2852-PB,
           isoform B protein.
          Length = 120

 Score =  143 bits (346), Expect = 2e-34
 Identities = 66/96 (68%), Positives = 77/96 (80%), Gaps = 1/96 (1%)
 Frame = +1

Query: 259 MLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTS 438
           M+QGGDFT  +GTGG+SIYG +FEDENF LKH G G LSMANAG DTNGSQFFITT +TS
Sbjct: 1   MIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTS 60

Query: 439 WLDGRHVVFGNVVEGMEVVKQIETLAA-TLGRPLRE 543
           WLDGRHVVFG ++ GM VV+QIE  A     RP+++
Sbjct: 61  WLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKD 96


>BT022685-1|AAY55101.1|  183|Drosophila melanogaster IP07164p
           protein.
          Length = 183

 Score =  123 bits (297), Expect = 2e-28
 Identities = 55/97 (56%), Positives = 72/97 (74%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F      FM+QGGDF   +GTG  SIYGN F DENFTLKH  PG+LSMAN+G +TN
Sbjct: 67  KGASFHRVIKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETN 126

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETL 513
           G QFFIT  K ++LDG+HVVFG V++G+ ++++IE +
Sbjct: 127 GCQFFITCAKCNFLDGKHVVFGRVLDGLLIMRKIENV 163



 Score = 62.1 bits (144), Expect = 7e-10
 Identities = 29/59 (49%), Positives = 37/59 (62%), Gaps = 5/59 (8%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGE-----KGFGYKGSIFHRVI 250
           P VFFD+ V    +G+++ EL +D  P+T ENFR  CTGE        GYKG+ FHRVI
Sbjct: 17  PVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVI 75


>AE013599-201|AAM70809.1|  183|Drosophila melanogaster CG17266-PA
           protein.
          Length = 183

 Score =  123 bits (297), Expect = 2e-28
 Identities = 55/97 (56%), Positives = 72/97 (74%)
 Frame = +1

Query: 223 QGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 402
           +G  F      FM+QGGDF   +GTG  SIYGN F DENFTLKH  PG+LSMAN+G +TN
Sbjct: 67  KGASFHRVIKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETN 126

Query: 403 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETL 513
           G QFFIT  K ++LDG+HVVFG V++G+ ++++IE +
Sbjct: 127 GCQFFITCAKCNFLDGKHVVFGRVLDGLLIMRKIENV 163



 Score = 62.1 bits (144), Expect = 7e-10
 Identities = 29/59 (49%), Positives = 37/59 (62%), Gaps = 5/59 (8%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGE-----KGFGYKGSIFHRVI 250
           P VFFD+ V    +G+++ EL +D  P+T ENFR  CTGE        GYKG+ FHRVI
Sbjct: 17  PVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVI 75


>BT001578-1|AAN71333.1| 1002|Drosophila melanogaster RE23622p
           protein.
          Length = 1002

 Score =  118 bits (285), Expect = 6e-27
 Identities = 59/114 (51%), Positives = 77/114 (67%), Gaps = 1/114 (0%)
 Frame = +1

Query: 208 ERLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANA 387
           ++L+ +G+ F      FM+Q GDF+  NGTGG+SIYG  FEDE+F  KH  P +LSMAN 
Sbjct: 93  KKLQYKGVIFHRVVKDFMVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANR 152

Query: 388 GADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATL-GRPLRES 546
           G +TNGSQFFITT     LD  HVVFG V+ G E+V+Q+E L      RPL+++
Sbjct: 153 GKNTNGSQFFITTQPAPHLDNIHVVFGQVISGQELVRQLEGLPVDRNSRPLQDA 206



 Score = 76.6 bits (180), Expect = 3e-14
 Identities = 37/62 (59%), Positives = 44/62 (70%), Gaps = 8/62 (12%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGSIFHR 244
           PR FFD+++    +G+IV EL +DV PKT ENFRALCTGEKGFG        YKG IFHR
Sbjct: 45  PRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHR 104

Query: 245 VI 250
           V+
Sbjct: 105 VV 106


>AY134669-1|AAN39118.1|  968|Drosophila melanogaster peptidylprolyl
           cis-trans isomerase protein.
          Length = 968

 Score =  118 bits (285), Expect = 6e-27
 Identities = 59/114 (51%), Positives = 77/114 (67%), Gaps = 1/114 (0%)
 Frame = +1

Query: 208 ERLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANA 387
           ++L+ +G+ F      FM+Q GDF+  NGTGG+SIYG  FEDE+F  KH  P +LSMAN 
Sbjct: 61  KKLQYKGVIFHRVVKDFMVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANR 120

Query: 388 GADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATL-GRPLRES 546
           G +TNGSQFFITT     LD  HVVFG V+ G E+V+Q+E L      RPL+++
Sbjct: 121 GKNTNGSQFFITTQPAPHLDNIHVVFGQVISGQELVRQLEGLPVDRNSRPLQDA 174



 Score = 76.6 bits (180), Expect = 3e-14
 Identities = 37/62 (59%), Positives = 44/62 (70%), Gaps = 8/62 (12%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGSIFHR 244
           PR FFD+++    +G+IV EL +DV PKT ENFRALCTGEKGFG        YKG IFHR
Sbjct: 13  PRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHR 72

Query: 245 VI 250
           V+
Sbjct: 73  VV 74


>AE014297-4230|AAF56786.1|  970|Drosophila melanogaster CG1866-PA,
           isoform A protein.
          Length = 970

 Score =  118 bits (285), Expect = 6e-27
 Identities = 59/114 (51%), Positives = 77/114 (67%), Gaps = 1/114 (0%)
 Frame = +1

Query: 208 ERLRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANA 387
           ++L+ +G+ F      FM+Q GDF+  NGTGG+SIYG  FEDE+F  KH  P +LSMAN 
Sbjct: 61  KKLQYKGVIFHRVVKDFMVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANR 120

Query: 388 GADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATL-GRPLRES 546
           G +TNGSQFFITT     LD  HVVFG V+ G E+V+Q+E L      RPL+++
Sbjct: 121 GKNTNGSQFFITTQPAPHLDNIHVVFGQVISGQELVRQLEGLPVDRNSRPLQDA 174



 Score = 76.6 bits (180), Expect = 3e-14
 Identities = 37/62 (59%), Positives = 44/62 (70%), Gaps = 8/62 (12%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGSIFHR 244
           PR FFD+++    +G+IV EL +DV PKT ENFRALCTGEKGFG        YKG IFHR
Sbjct: 13  PRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHR 72

Query: 245 VI 250
           V+
Sbjct: 73  VV 74


>AY070975-1|AAL48597.1|  176|Drosophila melanogaster RE07451p
           protein.
          Length = 176

 Score =  113 bits (273), Expect = 2e-25
 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+QGGD T   G GG SIYG++F DE +  L+HTG G+LSMAN+G DTNGSQFFIT   
Sbjct: 69  FMIQGGDPTG-TGRGGASIYGSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAP 127

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQI 504
           T WLDG+H +FG V  GMEVVK+I
Sbjct: 128 TQWLDGKHTIFGRVYTGMEVVKRI 151



 Score = 35.1 bits (77), Expect = 0.095
 Identities = 21/61 (34%), Positives = 30/61 (49%)
 Frame = +2

Query: 119 DAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITAL 298
           +  +G+I +EL     P TC NF  L    +G+ Y   +FHR+I      +G  PT T  
Sbjct: 26  ETSMGEITVELYWKHAPNTCRNFAEL--SRRGY-YNNVVFHRIIR-DFMIQGGDPTGTGR 81

Query: 299 G 301
           G
Sbjct: 82  G 82


>AE014296-107|AAF47391.1|  176|Drosophila melanogaster CG13892-PA
           protein.
          Length = 176

 Score =  113 bits (273), Expect = 2e-25
 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+QGGD T   G GG SIYG++F DE +  L+HTG G+LSMAN+G DTNGSQFFIT   
Sbjct: 69  FMIQGGDPTG-TGRGGASIYGSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAP 127

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQI 504
           T WLDG+H +FG V  GMEVVK+I
Sbjct: 128 TQWLDGKHTIFGRVYTGMEVVKRI 151



 Score = 35.1 bits (77), Expect = 0.095
 Identities = 21/61 (34%), Positives = 30/61 (49%)
 Frame = +2

Query: 119 DAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITAL 298
           +  +G+I +EL     P TC NF  L    +G+ Y   +FHR+I      +G  PT T  
Sbjct: 26  ETSMGEITVELYWKHAPNTCRNFAEL--SRRGY-YNNVVFHRIIR-DFMIQGGDPTGTGR 81

Query: 299 G 301
           G
Sbjct: 82  G 82


>X14769-1|CAA32877.1|  237|Drosophila melanogaster ninaA protein.
          Length = 237

 Score =  107 bits (256), Expect = 2e-23
 Identities = 50/96 (52%), Positives = 62/96 (64%), Gaps = 2/96 (2%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTL--KHTGPGVLSMANAGADT 399
           G  F      F++QGGD  N +GTG  SIYG+ F DE+  L  +H  PG L MAN G DT
Sbjct: 74  GSRFHRVVDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDT 133

Query: 400 NGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           NG QF++TTV   WLDG+H VFG V+EGM+ +  IE
Sbjct: 134 NGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIE 169



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALC-TGEKGFGYKGSIFHRVI 250
           R++ DV  +  P+G+I   L   + PKT  NFR +C  G  G  Y GS FHRV+
Sbjct: 28  RIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVV 81


>M22851-1|AAA28717.1|  237|Drosophila melanogaster cyclosporine A
           binding protein protein.
          Length = 237

 Score =  107 bits (256), Expect = 2e-23
 Identities = 50/96 (52%), Positives = 62/96 (64%), Gaps = 2/96 (2%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTL--KHTGPGVLSMANAGADT 399
           G  F      F++QGGD  N +GTG  SIYG+ F DE+  L  +H  PG L MAN G DT
Sbjct: 74  GSRFHRVVDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDT 133

Query: 400 NGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           NG QF++TTV   WLDG+H VFG V+EGM+ +  IE
Sbjct: 134 NGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIE 169



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALC-TGEKGFGYKGSIFHRVI 250
           R++ DV  +  P+G+I   L   + PKT  NFR +C  G  G  Y GS FHRV+
Sbjct: 28  RIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVV 81


>AY119494-1|AAM50148.1|  237|Drosophila melanogaster GH08867p
           protein.
          Length = 237

 Score =  107 bits (256), Expect = 2e-23
 Identities = 50/96 (52%), Positives = 62/96 (64%), Gaps = 2/96 (2%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTL--KHTGPGVLSMANAGADT 399
           G  F      F++QGGD  N +GTG  SIYG+ F DE+  L  +H  PG L MAN G DT
Sbjct: 74  GSRFHRVVDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDT 133

Query: 400 NGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           NG QF++TTV   WLDG+H VFG V+EGM+ +  IE
Sbjct: 134 NGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIE 169



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALC-TGEKGFGYKGSIFHRVI 250
           R++ DV  +  P+G+I   L   + PKT  NFR +C  G  G  Y GS FHRV+
Sbjct: 28  RIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVV 81


>AE014134-179|AAF51437.1|  237|Drosophila melanogaster CG3966-PA
           protein.
          Length = 237

 Score =  107 bits (256), Expect = 2e-23
 Identities = 50/96 (52%), Positives = 62/96 (64%), Gaps = 2/96 (2%)
 Frame = +1

Query: 226 GLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTL--KHTGPGVLSMANAGADT 399
           G  F      F++QGGD  N +GTG  SIYG+ F DE+  L  +H  PG L MAN G DT
Sbjct: 74  GSRFHRVVDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDT 133

Query: 400 NGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 507
           NG QF++TTV   WLDG+H VFG V+EGM+ +  IE
Sbjct: 134 NGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIE 169



 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
 Frame = +2

Query: 92  RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALC-TGEKGFGYKGSIFHRVI 250
           R++ DV  +  P+G+I   L   + PKT  NFR +C  G  G  Y GS FHRV+
Sbjct: 28  RIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVV 81


>AY051909-1|AAK93333.1|  637|Drosophila melanogaster LD39850p
           protein.
          Length = 637

 Score =  100 bits (240), Expect = 2e-21
 Identities = 51/84 (60%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENF-TLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+Q GD T   GTGGKSI+G+ F+DE   +LKH  P  +SMANAG +TNGSQFFIT + 
Sbjct: 530 FMVQTGDPTG-TGTGGKSIWGSDFKDEFVPSLKHDRPYTVSMANAGPNTNGSQFFITVLP 588

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQI 504
           T WLD +H VFG V  GMEVV  I
Sbjct: 589 TPWLDNKHTVFGRVYRGMEVVLNI 612



 Score = 33.5 bits (73), Expect = 0.29
 Identities = 24/57 (42%), Positives = 26/57 (45%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G I + L     PKT ENF   C   K   Y G IFHRVI     + G  PT T  G
Sbjct: 491 GDIHMRLFFKEVPKTVENF---CVHAKNGYYNGHIFHRVIKGFMVQTG-DPTGTGTG 543


>AE013599-3904|AAF47231.2|  637|Drosophila melanogaster CG3511-PA
           protein.
          Length = 637

 Score =  100 bits (240), Expect = 2e-21
 Identities = 51/84 (60%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDENF-TLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           FM+Q GD T   GTGGKSI+G+ F+DE   +LKH  P  +SMANAG +TNGSQFFIT + 
Sbjct: 530 FMVQTGDPTG-TGTGGKSIWGSDFKDEFVPSLKHDRPYTVSMANAGPNTNGSQFFITVLP 588

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQI 504
           T WLD +H VFG V  GMEVV  I
Sbjct: 589 TPWLDNKHTVFGRVYRGMEVVLNI 612



 Score = 33.5 bits (73), Expect = 0.29
 Identities = 24/57 (42%), Positives = 26/57 (45%)
 Frame = +2

Query: 131 GKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           G I + L     PKT ENF   C   K   Y G IFHRVI     + G  PT T  G
Sbjct: 491 GDIHMRLFFKEVPKTVENF---CVHAKNGYYNGHIFHRVIKGFMVQTG-DPTGTGTG 543


>AY061295-1|AAL28843.1|  517|Drosophila melanogaster LD20635p
           protein.
          Length = 517

 Score = 99.1 bits (236), Expect = 5e-21
 Identities = 49/99 (49%), Positives = 70/99 (70%), Gaps = 2/99 (2%)
 Frame = +1

Query: 253 HFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           +F++QGGD T  +G+GG+SI+G KFEDE    L HTG GVLSMAN+G +TNGSQFFIT  
Sbjct: 327 NFIVQGGDPTG-SGSGGESIWGKKFEDEFKPNLTHTGRGVLSMANSGPNTNGSQFFITYR 385

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIETLAA-TLGRPLRE 543
               LDG+H +FG +V G++ ++++E +      RP+ +
Sbjct: 386 SCKHLDGKHTIFGKLVGGLDTLQKMENIEVDNKDRPIED 424



 Score = 33.1 bits (72), Expect = 0.38
 Identities = 21/58 (36%), Positives = 30/58 (51%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           LG + +EL  D TP+ C+NF   C    G+ Y   +FHR I  +   +G  PT +  G
Sbjct: 288 LGPLNLELFCDQTPRACDNFIKHCA--NGY-YNNVMFHRSIR-NFIVQGGDPTGSGSG 341


>AE013599-2245|AAF58019.1|  517|Drosophila melanogaster CG7747-PA
           protein.
          Length = 517

 Score = 99.1 bits (236), Expect = 5e-21
 Identities = 49/99 (49%), Positives = 70/99 (70%), Gaps = 2/99 (2%)
 Frame = +1

Query: 253 HFMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTV 429
           +F++QGGD T  +G+GG+SI+G KFEDE    L HTG GVLSMAN+G +TNGSQFFIT  
Sbjct: 327 NFIVQGGDPTG-SGSGGESIWGKKFEDEFKPNLTHTGRGVLSMANSGPNTNGSQFFITYR 385

Query: 430 KTSWLDGRHVVFGNVVEGMEVVKQIETLAA-TLGRPLRE 543
               LDG+H +FG +V G++ ++++E +      RP+ +
Sbjct: 386 SCKHLDGKHTIFGKLVGGLDTLQKMENIEVDNKDRPIED 424



 Score = 33.1 bits (72), Expect = 0.38
 Identities = 21/58 (36%), Positives = 30/58 (51%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPISCCKEGTSPTITALG 301
           LG + +EL  D TP+ C+NF   C    G+ Y   +FHR I  +   +G  PT +  G
Sbjct: 288 LGPLNLELFCDQTPRACDNFIKHCA--NGY-YNNVMFHRSIR-NFIVQGGDPTGSGSG 341


>AY058303-1|AAL13532.1|  383|Drosophila melanogaster GH06403p
           protein.
          Length = 383

 Score = 85.4 bits (202), Expect = 7e-17
 Identities = 44/108 (40%), Positives = 63/108 (58%), Gaps = 1/108 (0%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAG- 390
           L  +G  F      F++Q GD   ++G+ G+SIYG  F+DENF L H   GV+SMAN G 
Sbjct: 64  LHYKGTKFHKIKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGK 123

Query: 391 ADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
            ++N SQFFI+      L+G +VV G V+ G+ +V ++E      G P
Sbjct: 124 PNSNNSQFFISAAGCENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGDP 171



 Score = 66.9 bits (156), Expect = 3e-11
 Identities = 32/73 (43%), Positives = 45/73 (61%), Gaps = 7/73 (9%)
 Frame = +2

Query: 77  KMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSI 235
           K + P V+ D+++     G+++IELR DV PKT ENFRALCTGE G G       YKG+ 
Sbjct: 11  KSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTK 70

Query: 236 FHRVIPISCCKEG 274
           FH++  +   + G
Sbjct: 71  FHKIKRVFVVQSG 83


>AE014296-1699|AAF50235.1|  383|Drosophila melanogaster CG8336-PC,
           isoform C protein.
          Length = 383

 Score = 85.4 bits (202), Expect = 7e-17
 Identities = 44/108 (40%), Positives = 63/108 (58%), Gaps = 1/108 (0%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAG- 390
           L  +G  F      F++Q GD   ++G+ G+SIYG  F+DENF L H   GV+SMAN G 
Sbjct: 64  LHYKGTKFHKIKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGK 123

Query: 391 ADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
            ++N SQFFI+      L+G +VV G V+ G+ +V ++E      G P
Sbjct: 124 PNSNNSQFFISAAGCENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGDP 171



 Score = 66.9 bits (156), Expect = 3e-11
 Identities = 32/73 (43%), Positives = 45/73 (61%), Gaps = 7/73 (9%)
 Frame = +2

Query: 77  KMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSI 235
           K + P V+ D+++     G+++IELR DV PKT ENFRALCTGE G G       YKG+ 
Sbjct: 11  KSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTK 70

Query: 236 FHRVIPISCCKEG 274
           FH++  +   + G
Sbjct: 71  FHKIKRVFVVQSG 83


>AE014296-1698|AAN11948.1|  383|Drosophila melanogaster CG8336-PB,
           isoform B protein.
          Length = 383

 Score = 85.4 bits (202), Expect = 7e-17
 Identities = 44/108 (40%), Positives = 63/108 (58%), Gaps = 1/108 (0%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAG- 390
           L  +G  F      F++Q GD   ++G+ G+SIYG  F+DENF L H   GV+SMAN G 
Sbjct: 64  LHYKGTKFHKIKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGK 123

Query: 391 ADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
            ++N SQFFI+      L+G +VV G V+ G+ +V ++E      G P
Sbjct: 124 PNSNNSQFFISAAGCENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGDP 171



 Score = 66.9 bits (156), Expect = 3e-11
 Identities = 32/73 (43%), Positives = 45/73 (61%), Gaps = 7/73 (9%)
 Frame = +2

Query: 77  KMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSI 235
           K + P V+ D+++     G+++IELR DV PKT ENFRALCTGE G G       YKG+ 
Sbjct: 11  KSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTK 70

Query: 236 FHRVIPISCCKEG 274
           FH++  +   + G
Sbjct: 71  FHKIKRVFVVQSG 83


>AE014296-1697|AAN11947.1|  383|Drosophila melanogaster CG8336-PA,
           isoform A protein.
          Length = 383

 Score = 85.4 bits (202), Expect = 7e-17
 Identities = 44/108 (40%), Positives = 63/108 (58%), Gaps = 1/108 (0%)
 Frame = +1

Query: 214 LRLQGLHFPSCHPHFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAG- 390
           L  +G  F      F++Q GD   ++G+ G+SIYG  F+DENF L H   GV+SMAN G 
Sbjct: 64  LHYKGTKFHKIKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGK 123

Query: 391 ADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATLGRP 534
            ++N SQFFI+      L+G +VV G V+ G+ +V ++E      G P
Sbjct: 124 PNSNNSQFFISAAGCENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGDP 171



 Score = 66.9 bits (156), Expect = 3e-11
 Identities = 32/73 (43%), Positives = 45/73 (61%), Gaps = 7/73 (9%)
 Frame = +2

Query: 77  KMSLPRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFG-------YKGSI 235
           K + P V+ D+++     G+++IELR DV PKT ENFRALCTGE G G       YKG+ 
Sbjct: 11  KSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTK 70

Query: 236 FHRVIPISCCKEG 274
           FH++  +   + G
Sbjct: 71  FHKIKRVFVVQSG 83


>AY113541-1|AAM29546.1|  161|Drosophila melanogaster RE61564p
           protein.
          Length = 161

 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 40/87 (45%), Positives = 58/87 (66%), Gaps = 1/87 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           F++Q GD TN  G  G+SI+G KF+DE   T+KHT  G++SMAN G + N SQFFIT   
Sbjct: 49  FIVQTGDPTN-TGKNGQSIWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAA 107

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETL 513
              LD ++ +FG V++G + + ++E L
Sbjct: 108 QPNLDLKYTLFGRVIDGFDALDELEKL 134



 Score = 37.1 bits (82), Expect = 0.024
 Identities = 19/41 (46%), Positives = 23/41 (56%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +G + IEL  D  PK CENF ALC  +    Y G +F R I
Sbjct: 9   VGDLKIELFCDACPKACENFLALCASDY---YSGCVFIRNI 46


>AE013599-1109|AAM68761.1|  161|Drosophila melanogaster CG11777-PA
           protein.
          Length = 161

 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 40/87 (45%), Positives = 58/87 (66%), Gaps = 1/87 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           F++Q GD TN  G  G+SI+G KF+DE   T+KHT  G++SMAN G + N SQFFIT   
Sbjct: 49  FIVQTGDPTN-TGKNGQSIWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAA 107

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETL 513
              LD ++ +FG V++G + + ++E L
Sbjct: 108 QPNLDLKYTLFGRVIDGFDALDELEKL 134



 Score = 37.1 bits (82), Expect = 0.024
 Identities = 19/41 (46%), Positives = 23/41 (56%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +G + IEL  D  PK CENF ALC  +    Y G +F R I
Sbjct: 9   VGDLKIELFCDACPKACENFLALCASDY---YSGCVFIRNI 46


>BT011449-1|AAR99107.1|  161|Drosophila melanogaster RE40650p
           protein.
          Length = 161

 Score = 79.8 bits (188), Expect = 3e-15
 Identities = 40/87 (45%), Positives = 58/87 (66%), Gaps = 1/87 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           F++Q GD TN  G  G+SI+G KF+DE   T+KHT  G++SMAN G + N SQFFIT   
Sbjct: 49  FIVQTGDPTN-TGKNGQSIWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAA 107

Query: 433 TSWLDGRHVVFGNVVEGMEVVKQIETL 513
              LD ++ +FG V++G + + ++E L
Sbjct: 108 QPNLDLKYTLFGRVIDGFDALGELEKL 134



 Score = 37.1 bits (82), Expect = 0.024
 Identities = 19/41 (46%), Positives = 23/41 (56%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +G + IEL  D  PK CENF ALC  +    Y G +F R I
Sbjct: 9   VGDLKIELFCDACPKACENFLALCASDY---YSGCVFIRNI 46


>AY070988-1|AAL48610.1|  502|Drosophila melanogaster RE08109p
           protein.
          Length = 502

 Score = 74.5 bits (175), Expect = 1e-13
 Identities = 36/74 (48%), Positives = 51/74 (68%), Gaps = 1/74 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           F++QGGD  N +GTGG+SIYG  F+DE +  L++T  G++ MAN+G D NGSQFF T   
Sbjct: 61  FIVQGGD-PNGDGTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAP 119

Query: 433 TSWLDGRHVVFGNV 474
           T  L  ++ +FG +
Sbjct: 120 TPELQNKNTLFGKI 133



 Score = 33.5 bits (73), Expect = 0.29
 Identities = 18/41 (43%), Positives = 25/41 (60%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +G I IEL +   PK C NF  LC   +G+ YK + FHR++
Sbjct: 21  VGDIDIELWARECPKACRNFVQLCL--EGY-YKNTEFHRLV 58


>AE014296-2031|AAF50009.1|  502|Drosophila melanogaster CG10907-PA
           protein.
          Length = 502

 Score = 74.5 bits (175), Expect = 1e-13
 Identities = 36/74 (48%), Positives = 51/74 (68%), Gaps = 1/74 (1%)
 Frame = +1

Query: 256 FMLQGGDFTNHNGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVK 432
           F++QGGD  N +GTGG+SIYG  F+DE +  L++T  G++ MAN+G D NGSQFF T   
Sbjct: 61  FIVQGGD-PNGDGTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAP 119

Query: 433 TSWLDGRHVVFGNV 474
           T  L  ++ +FG +
Sbjct: 120 TPELQNKNTLFGKI 133



 Score = 33.5 bits (73), Expect = 0.29
 Identities = 18/41 (43%), Positives = 25/41 (60%)
 Frame = +2

Query: 128 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 250
           +G I IEL +   PK C NF  LC   +G+ YK + FHR++
Sbjct: 21  VGDIDIELWARECPKACRNFVQLCL--EGY-YKNTEFHRLV 58


>AF132148-1|AAD34736.1|  653|Drosophila melanogaster unknown
           protein.
          Length = 653

 Score = 58.8 bits (136), Expect = 7e-09
 Identities = 43/121 (35%), Positives = 67/121 (55%), Gaps = 11/121 (9%)
 Frame = +1

Query: 235 FPSCHPHFMLQGGDFTNHNGTGGKSIYG------NKFEDENFTLK--HTGPGVLSMANAG 390
           F +    F+ Q GD  +  G GG SI+G       +F +  F  K  H+  G+LS+ +AG
Sbjct: 42  FHTVQQGFIAQTGD-PSGAGDGGSSIWGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAG 100

Query: 391 ADTNGSQFFITTVKT-SWLDGRHVVFGNVVEGMEVVKQI-ETLAATLGRPLRE-SLSKTV 561
            +  GSQFF+T  +  + LDG H V G VVEG EV++++ + +     RP ++  ++ TV
Sbjct: 101 KNLVGSQFFLTLGENLTSLDGNHCVIGEVVEGHEVLRKLNDAIVDDSFRPYQDIRITHTV 160

Query: 562 V 564
           V
Sbjct: 161 V 161


>AE014297-3634|AAF56342.1|  653|Drosophila melanogaster CG5808-PA
           protein.
          Length = 653

 Score = 58.8 bits (136), Expect = 7e-09
 Identities = 43/121 (35%), Positives = 67/121 (55%), Gaps = 11/121 (9%)
 Frame = +1

Query: 235 FPSCHPHFMLQGGDFTNHNGTGGKSIYG------NKFEDENFTLK--HTGPGVLSMANAG 390
           F +    F+ Q GD  +  G GG SI+G       +F +  F  K  H+  G+LS+ +AG
Sbjct: 42  FHTVQQGFIAQTGD-PSGAGDGGSSIWGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAG 100

Query: 391 ADTNGSQFFITTVKT-SWLDGRHVVFGNVVEGMEVVKQI-ETLAATLGRPLRE-SLSKTV 561
            +  GSQFF+T  +  + LDG H V G VVEG EV++++ + +     RP ++  ++ TV
Sbjct: 101 KNLVGSQFFLTLGENLTSLDGNHCVIGEVVEGHEVLRKLNDAIVDDSFRPYQDIRITHTV 160

Query: 562 V 564
           V
Sbjct: 161 V 161


>AE014297-3820|AAN14059.1|  680|Drosophila melanogaster CG5071-PB,
           isoform B protein.
          Length = 680

 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 19/47 (40%), Positives = 30/47 (63%)
 Frame = +2

Query: 89  PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKG 229
           P  F D+ +     G+++IE+RSD  P+  +NF AL   E+G+GY+G
Sbjct: 514 PIYFLDMEIAGELAGRVLIEVRSDAAPRMADNFGALVRHERGYGYRG 560



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 2/95 (2%)
 Frame = +1

Query: 271 GDFTNHNGTGGKSIYGNKF--EDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWL 444
           GDF + NG GG S + +++   DE     H G   +       D +G       +  + +
Sbjct: 575 GDFESQNGRGGHSAFESRYFLPDETGLPAHRGTVGMRRGQRRQDRSGFVGSQFRLVLNEM 634

Query: 445 DGRHVVFGNVVEGMEVVKQIETLAATLGRPLRESL 549
                +FG +V+G+E+V +I      LGRP   S+
Sbjct: 635 RSFTAIFGFIVQGIELVDRIAASGNALGRPALRSI 669


>BT001373-1|AAN71128.1|  139|Drosophila melanogaster AT31683p
           protein.
          Length = 139

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 2/95 (2%)
 Frame = +1

Query: 271 GDFTNHNGTGGKSIYGNKF--EDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWL 444
           GDF + NG GG S + +++   DE     H G   +       D +G       +  + +
Sbjct: 34  GDFESQNGRGGHSAFESRYFLPDETGLPAHRGTVGMRRGQRRQDRSGFVGSQFRLVLNEM 93

Query: 445 DGRHVVFGNVVEGMEVVKQIETLAATLGRPLRESL 549
                +FG +V+G+E+V +I      LGRP   S+
Sbjct: 94  RSFTAIFGFIVQGIELVDRIAASGNALGRPALRSI 128


>AL031028-1|CAA19845.2| 1795|Drosophila melanogaster EG:56G7.1
           protein.
          Length = 1795

 Score = 32.3 bits (70), Expect = 0.67
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%)
 Frame = -1

Query: 563 TTVFDNDSLRGLPR-VAAKVSICLTTSMPSTTFPKTTCLPSSQEVLTV 423
           TT+F   +    P   + +  I  TT  PSTT PKT+ + SS E  T+
Sbjct: 817 TTIFTRKTTTNNPEPTSTEKPITSTTPKPSTTTPKTSTVASSTEKTTI 864


>AE014298-231|AAF45644.1| 1795|Drosophila melanogaster CG14796-PA
           protein.
          Length = 1795

 Score = 32.3 bits (70), Expect = 0.67
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%)
 Frame = -1

Query: 563 TTVFDNDSLRGLPR-VAAKVSICLTTSMPSTTFPKTTCLPSSQEVLTV 423
           TT+F   +    P   + +  I  TT  PSTT PKT+ + SS E  T+
Sbjct: 817 TTIFTRKTTTNNPEPTSTEKPITSTTPKPSTTTPKTSTVASSTEKTTI 864


>AY119632-1|AAM50286.1|  796|Drosophila melanogaster RE37895p
           protein.
          Length = 796

 Score = 28.7 bits (61), Expect = 8.2
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 2/67 (2%)
 Frame = +2

Query: 194 LCTGEKGFG-YKGSIFHRVIPISCCK-EGTSPTITALGESPSTAISLKTRISPLSTLDLA 367
           +C  E+ F  + G     V P +C + + TSPT+T   E P+T I+  T  S     D A
Sbjct: 574 ICGSEEYFDPWTGKCGFGVSPEACREIQTTSPTVTDSTEGPTTVITPSTPGSEPGPCDGA 633

Query: 368 SSPWLMP 388
               L+P
Sbjct: 634 PEGKLVP 640


>AY061361-1|AAL28909.1|  940|Drosophila melanogaster LD28662p
           protein.
          Length = 940

 Score = 28.7 bits (61), Expect = 8.2
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = +3

Query: 93  EYSSTSLLTMPHWEKLLLS*EVTSLPRRVKTSVPCA-LARKASVTRAPFSIVSSPFHAAR 269
           ++ S +  ++ +W+K LL  E  S  R V   V C       + TR+ F  +SS +   +
Sbjct: 180 DWISVAPHSIHYWDKFLL--EPYSYARDVVYVVVCPDNEHVVNCTRSYFRELSSTYEMCK 237

Query: 270 RGLHQP*RHW 299
            G H P R W
Sbjct: 238 LGKHTPIRGW 247


>AY051526-1|AAK92950.1|  404|Drosophila melanogaster GH18016p
           protein.
          Length = 404

 Score = 28.7 bits (61), Expect = 8.2
 Identities = 13/38 (34%), Positives = 23/38 (60%)
 Frame = +1

Query: 412 FFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATL 525
           F I+    S L+GR + FG V +GM+++++I+     L
Sbjct: 352 FTISFKPLSILNGRRIAFGKVRKGMQLLERIQVAVGHL 389


>AF324425-1|AAG48327.1| 2618|Drosophila melanogaster transcriptional
            coactivator blindspot protein.
          Length = 2618

 Score = 28.7 bits (61), Expect = 8.2
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = +3

Query: 93   EYSSTSLLTMPHWEKLLLS*EVTSLPRRVKTSVPCA-LARKASVTRAPFSIVSSPFHAAR 269
            ++ S +  ++ +W+K LL  E  S  R V   V C       + TR+ F  +SS +   +
Sbjct: 1858 DWISVAPHSIHYWDKFLL--EPYSYARDVVYVVVCPDNEHVVNCTRSYFRELSSTYEMCK 1915

Query: 270  RGLHQP*RHW 299
             G H P R W
Sbjct: 1916 LGKHTPIRGW 1925


>AF227215-1|AAF43172.1| 2618|Drosophila melanogaster jlkjlkj protein.
          Length = 2618

 Score = 28.7 bits (61), Expect = 8.2
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = +3

Query: 93   EYSSTSLLTMPHWEKLLLS*EVTSLPRRVKTSVPCA-LARKASVTRAPFSIVSSPFHAAR 269
            ++ S +  ++ +W+K LL  E  S  R V   V C       + TR+ F  +SS +   +
Sbjct: 1858 DWISVAPHSIHYWDKFLL--EPYSYARDVVYVVVCPDNEHVVNCTRSYFRELSSTYEMCK 1915

Query: 270  RGLHQP*RHW 299
             G H P R W
Sbjct: 1916 LGKHTPIRGW 1925


>AF227214-1|AAF43021.1| 2618|Drosophila melanogaster Pap/DTRAP240
            protein.
          Length = 2618

 Score = 28.7 bits (61), Expect = 8.2
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = +3

Query: 93   EYSSTSLLTMPHWEKLLLS*EVTSLPRRVKTSVPCA-LARKASVTRAPFSIVSSPFHAAR 269
            ++ S +  ++ +W+K LL  E  S  R V   V C       + TR+ F  +SS +   +
Sbjct: 1858 DWISVAPHSIHYWDKFLL--EPYSYARDVVYVVVCPDNEHVVNCTRSYFRELSSTYEMCK 1915

Query: 270  RGLHQP*RHW 299
             G H P R W
Sbjct: 1916 LGKHTPIRGW 1925


>AF226855-1|AAF36691.1| 2618|Drosophila melanogaster TRAP240 protein.
          Length = 2618

 Score = 28.7 bits (61), Expect = 8.2
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = +3

Query: 93   EYSSTSLLTMPHWEKLLLS*EVTSLPRRVKTSVPCA-LARKASVTRAPFSIVSSPFHAAR 269
            ++ S +  ++ +W+K LL  E  S  R V   V C       + TR+ F  +SS +   +
Sbjct: 1858 DWISVAPHSIHYWDKFLL--EPYSYARDVVYVVVCPDNEHVVNCTRSYFRELSSTYEMCK 1915

Query: 270  RGLHQP*RHW 299
             G H P R W
Sbjct: 1916 LGKHTPIRGW 1925


>AE014296-3458|AAN12149.1| 2618|Drosophila melanogaster CG9936-PD,
            isoform D protein.
          Length = 2618

 Score = 28.7 bits (61), Expect = 8.2
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = +3

Query: 93   EYSSTSLLTMPHWEKLLLS*EVTSLPRRVKTSVPCA-LARKASVTRAPFSIVSSPFHAAR 269
            ++ S +  ++ +W+K LL  E  S  R V   V C       + TR+ F  +SS +   +
Sbjct: 1858 DWISVAPHSIHYWDKFLL--EPYSYARDVVYVVVCPDNEHVVNCTRSYFRELSSTYEMCK 1915

Query: 270  RGLHQP*RHW 299
             G H P R W
Sbjct: 1916 LGKHTPIRGW 1925


>AE014296-3457|AAN12148.1| 2618|Drosophila melanogaster CG9936-PC,
            isoform C protein.
          Length = 2618

 Score = 28.7 bits (61), Expect = 8.2
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = +3

Query: 93   EYSSTSLLTMPHWEKLLLS*EVTSLPRRVKTSVPCA-LARKASVTRAPFSIVSSPFHAAR 269
            ++ S +  ++ +W+K LL  E  S  R V   V C       + TR+ F  +SS +   +
Sbjct: 1858 DWISVAPHSIHYWDKFLL--EPYSYARDVVYVVVCPDNEHVVNCTRSYFRELSSTYEMCK 1915

Query: 270  RGLHQP*RHW 299
             G H P R W
Sbjct: 1916 LGKHTPIRGW 1925


>AE014296-2066|AAF49982.1|  796|Drosophila melanogaster CG7248-PA
           protein.
          Length = 796

 Score = 28.7 bits (61), Expect = 8.2
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 2/67 (2%)
 Frame = +2

Query: 194 LCTGEKGFG-YKGSIFHRVIPISCCK-EGTSPTITALGESPSTAISLKTRISPLSTLDLA 367
           +C  E+ F  + G     V P +C + + TSPT+T   E P+T I+  T  S     D A
Sbjct: 574 ICGSEEYFDPWTGKCGFGVSPEACREIQTTSPTVTDSTEGPTTVITPSTPGSEPDPCDGA 633

Query: 368 SSPWLMP 388
               L+P
Sbjct: 634 PEGKLVP 640


>AE014134-11|AAF51568.2| 2833|Drosophila melanogaster CG31973-PB,
            isoform B protein.
          Length = 2833

 Score = 28.7 bits (61), Expect = 8.2
 Identities = 19/65 (29%), Positives = 29/65 (44%)
 Frame = -3

Query: 465  KDNMSAIQPGGLDSGDEELGTISISTGISHGEDARSSVLKGEILVFKLIAVDGLSPSAVM 286
            KDN S   P  +DS  ++  TI+ +          ++    + L F   A  G SPS + 
Sbjct: 1557 KDNSSNSSPDNVDSAFDKSHTINQTVDPPKSRSFETTT-SSKFLDFINAAAYGTSPSGIR 1615

Query: 285  VGEVP 271
            + EVP
Sbjct: 1616 LNEVP 1620


>AE013599-3874|AAF47207.1|  404|Drosophila melanogaster CG3492-PA
           protein.
          Length = 404

 Score = 28.7 bits (61), Expect = 8.2
 Identities = 13/38 (34%), Positives = 23/38 (60%)
 Frame = +1

Query: 412 FFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETLAATL 525
           F I+    S L+GR + FG V +GM+++++I+     L
Sbjct: 352 FTISFKPLSILNGRRIAFGKVRKGMQLLERIQVAVGHL 389


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 34,789,275
Number of Sequences: 53049
Number of extensions: 826932
Number of successful extensions: 2596
Number of sequences better than 10.0: 55
Number of HSP's better than 10.0 without gapping: 2382
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2565
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3149551053
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -