SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20008
         (705 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X82782-1|CAA58023.1|  271|Drosophila melanogaster ribosomal prot...    96   5e-20
AY089570-1|AAL90308.1|  271|Drosophila melanogaster RE05022p pro...    96   5e-20
AE014298-903|AAF46169.1|  271|Drosophila melanogaster CG3314-PD,...    96   5e-20
AE014298-902|AAN09172.1|  271|Drosophila melanogaster CG3314-PC,...    96   5e-20
AE014298-901|AAN09170.1|  271|Drosophila melanogaster CG3314-PA,...    96   5e-20
AF208396-1|AAF20209.1|  127|Drosophila melanogaster Hoi-polloi p...    34   0.22 
AE014134-1677|AAF52798.2|  127|Drosophila melanogaster CG3949-PA...    34   0.22 
BT023752-1|AAZ41760.1|  160|Drosophila melanogaster RH66170p pro...    30   2.7  
AF217228-1|AAF27630.1|  160|Drosophila melanogaster nucleolar pr...    30   2.7  
AE014296-2434|AAF49701.1|  160|Drosophila melanogaster CG5258-PA...    30   2.7  
AY058343-1|AAL13572.1|  403|Drosophila melanogaster GH11867p pro...    29   8.1  
AE014297-1960|AAN13634.1|  403|Drosophila melanogaster CG31344-P...    29   8.1  
AE014134-2109|AAF53129.1|  174|Drosophila melanogaster CG14943-P...    29   8.1  

>X82782-1|CAA58023.1|  271|Drosophila melanogaster ribosomal protein
           L7a protein.
          Length = 271

 Score = 95.9 bits (228), Expect = 5e-20
 Identities = 47/92 (51%), Positives = 59/92 (64%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  + PKYIR+QRQKAVLQ+RLKVPPPI+QF+QTLDKTTA  LFK+LEKYRPE+    
Sbjct: 56  LSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESALAK 115

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                +P+ + +GTNT
Sbjct: 116 NVRLKKIAEAKAKGKDVEPKKKPSYVSAGTNT 147



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 47/65 (72%), Positives = 51/65 (78%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VTKL+E+KKAQL      + PL   LFLPALCRKMGVPYCIVKGK+RLG LV RKTCT L
Sbjct: 148 VTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRKTCTTL 207

Query: 689 ALTNV 703
           ALT V
Sbjct: 208 ALTTV 212



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 44/144 (30%), Positives = 61/144 (42%), Gaps = 2/144 (1%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCPLRSTNLPRHWT 348
           N LFEKRPKNF IGQ +QP RDLSRFVR P       ++       K P       +   
Sbjct: 34  NQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLD 93

Query: 349 R-LQLRAFSRFWRNTXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQAGR 525
           +   ++ F    +                         +   ++    S    T  +   
Sbjct: 94  KTTAVKLFKLLEKYRPESALAKNVRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIE 153

Query: 526 EEEGAVVVIAHDVDPIELV-SLPA 594
           +++  +VVIAHDVDP+ELV  LPA
Sbjct: 154 QKKAQLVVIAHDVDPLELVLFLPA 177


>AY089570-1|AAL90308.1|  271|Drosophila melanogaster RE05022p
           protein.
          Length = 271

 Score = 95.9 bits (228), Expect = 5e-20
 Identities = 47/92 (51%), Positives = 59/92 (64%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  + PKYIR+QRQKAVLQ+RLKVPPPI+QF+QTLDKTTA  LFK+LEKYRPE+    
Sbjct: 56  LSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAK 115

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                +P+ + +GTNT
Sbjct: 116 KLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNT 147



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 47/65 (72%), Positives = 51/65 (78%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VTKL+E+KKAQL      + PL   LFLPALCRKMGVPYCIVKGK+RLG LV RKTCT L
Sbjct: 148 VTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRKTCTTL 207

Query: 689 ALTNV 703
           ALT V
Sbjct: 208 ALTTV 212



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 44/144 (30%), Positives = 61/144 (42%), Gaps = 2/144 (1%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCPLRSTNLPRHWT 348
           N LFEKRPKNF IGQ +QP RDLSRFVR P       ++       K P       +   
Sbjct: 34  NQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLD 93

Query: 349 R-LQLRAFSRFWRNTXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQAGR 525
           +   ++ F    +                         +   ++    S    T  +   
Sbjct: 94  KTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIE 153

Query: 526 EEEGAVVVIAHDVDPIELV-SLPA 594
           +++  +VVIAHDVDP+ELV  LPA
Sbjct: 154 QKKAQLVVIAHDVDPLELVLFLPA 177


>AE014298-903|AAF46169.1|  271|Drosophila melanogaster CG3314-PD,
           isoform D protein.
          Length = 271

 Score = 95.9 bits (228), Expect = 5e-20
 Identities = 47/92 (51%), Positives = 59/92 (64%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  + PKYIR+QRQKAVLQ+RLKVPPPI+QF+QTLDKTTA  LFK+LEKYRPE+    
Sbjct: 56  LSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAK 115

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                +P+ + +GTNT
Sbjct: 116 KLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNT 147



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 47/65 (72%), Positives = 51/65 (78%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VTKL+E+KKAQL      + PL   LFLPALCRKMGVPYCIVKGK+RLG LV RKTCT L
Sbjct: 148 VTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRKTCTTL 207

Query: 689 ALTNV 703
           ALT V
Sbjct: 208 ALTTV 212



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 44/144 (30%), Positives = 61/144 (42%), Gaps = 2/144 (1%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCPLRSTNLPRHWT 348
           N LFEKRPKNF IGQ +QP RDLSRFVR P       ++       K P       +   
Sbjct: 34  NQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLD 93

Query: 349 R-LQLRAFSRFWRNTXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQAGR 525
           +   ++ F    +                         +   ++    S    T  +   
Sbjct: 94  KTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIE 153

Query: 526 EEEGAVVVIAHDVDPIELV-SLPA 594
           +++  +VVIAHDVDP+ELV  LPA
Sbjct: 154 QKKAQLVVIAHDVDPLELVLFLPA 177


>AE014298-902|AAN09172.1|  271|Drosophila melanogaster CG3314-PC,
           isoform C protein.
          Length = 271

 Score = 95.9 bits (228), Expect = 5e-20
 Identities = 47/92 (51%), Positives = 59/92 (64%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  + PKYIR+QRQKAVLQ+RLKVPPPI+QF+QTLDKTTA  LFK+LEKYRPE+    
Sbjct: 56  LSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAK 115

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                +P+ + +GTNT
Sbjct: 116 KLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNT 147



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 47/65 (72%), Positives = 51/65 (78%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VTKL+E+KKAQL      + PL   LFLPALCRKMGVPYCIVKGK+RLG LV RKTCT L
Sbjct: 148 VTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRKTCTTL 207

Query: 689 ALTNV 703
           ALT V
Sbjct: 208 ALTTV 212



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 44/144 (30%), Positives = 61/144 (42%), Gaps = 2/144 (1%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCPLRSTNLPRHWT 348
           N LFEKRPKNF IGQ +QP RDLSRFVR P       ++       K P       +   
Sbjct: 34  NQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLD 93

Query: 349 R-LQLRAFSRFWRNTXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQAGR 525
           +   ++ F    +                         +   ++    S    T  +   
Sbjct: 94  KTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIE 153

Query: 526 EEEGAVVVIAHDVDPIELV-SLPA 594
           +++  +VVIAHDVDP+ELV  LPA
Sbjct: 154 QKKAQLVVIAHDVDPLELVLFLPA 177


>AE014298-901|AAN09170.1|  271|Drosophila melanogaster CG3314-PA,
           isoform A protein.
          Length = 271

 Score = 95.9 bits (228), Expect = 5e-20
 Identities = 47/92 (51%), Positives = 59/92 (64%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  + PKYIR+QRQKAVLQ+RLKVPPPI+QF+QTLDKTTA  LFK+LEKYRPE+    
Sbjct: 56  LSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAK 115

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                +P+ + +GTNT
Sbjct: 116 KLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNT 147



 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 47/65 (72%), Positives = 51/65 (78%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           VTKL+E+KKAQL      + PL   LFLPALCRKMGVPYCIVKGK+RLG LV RKTCT L
Sbjct: 148 VTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRKTCTTL 207

Query: 689 ALTNV 703
           ALT V
Sbjct: 208 ALTTV 212



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 44/144 (30%), Positives = 61/144 (42%), Gaps = 2/144 (1%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCPLRSTNLPRHWT 348
           N LFEKRPKNF IGQ +QP RDLSRFVR P       ++       K P       +   
Sbjct: 34  NQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLD 93

Query: 349 R-LQLRAFSRFWRNTXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQAGR 525
           +   ++ F    +                         +   ++    S    T  +   
Sbjct: 94  KTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIE 153

Query: 526 EEEGAVVVIAHDVDPIELV-SLPA 594
           +++  +VVIAHDVDP+ELV  LPA
Sbjct: 154 QKKAQLVVIAHDVDPLELVLFLPA 177


>AF208396-1|AAF20209.1|  127|Drosophila melanogaster Hoi-polloi
           protein.
          Length = 127

 Score = 33.9 bits (74), Expect = 0.22
 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 2/46 (4%)
 Frame = +2

Query: 569 PLSWFLFLPALCRKMGVPYCIVKGKSRLGAL--VHRKTCTCLALTN 700
           P+   L LP LC    VPY  V+ K  LG    V R    C   TN
Sbjct: 61  PIEILLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIVACSVTTN 106


>AE014134-1677|AAF52798.2|  127|Drosophila melanogaster CG3949-PA
           protein.
          Length = 127

 Score = 33.9 bits (74), Expect = 0.22
 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 2/46 (4%)
 Frame = +2

Query: 569 PLSWFLFLPALCRKMGVPYCIVKGKSRLGAL--VHRKTCTCLALTN 700
           P+   L LP LC    VPY  V+ K  LG    V R    C   TN
Sbjct: 61  PIEILLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIVACSVTTN 106


>BT023752-1|AAZ41760.1|  160|Drosophila melanogaster RH66170p
           protein.
          Length = 160

 Score = 30.3 bits (65), Expect = 2.7
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = +2

Query: 569 PLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCLAL 694
           P+     LPA+C + G+PY     ++ LGA +  K  T   L
Sbjct: 94  PVDIMCHLPAVCEEKGIPYTYTPSRADLGAAMGVKRGTVALL 135


>AF217228-1|AAF27630.1|  160|Drosophila melanogaster nucleolar
           protein NHP2 protein.
          Length = 160

 Score = 30.3 bits (65), Expect = 2.7
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = +2

Query: 569 PLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCLAL 694
           P+     LPA+C + G+PY     ++ LGA +  K  T   L
Sbjct: 94  PVDIMCHLPAVCEEKGIPYTYTPSRADLGAAMGVKRGTVALL 135


>AE014296-2434|AAF49701.1|  160|Drosophila melanogaster CG5258-PA
           protein.
          Length = 160

 Score = 30.3 bits (65), Expect = 2.7
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = +2

Query: 569 PLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCLAL 694
           P+     LPA+C + G+PY     ++ LGA +  K  T   L
Sbjct: 94  PVDIMCHLPAVCEEKGIPYTYTPSRADLGAAMGVKRGTVALL 135


>AY058343-1|AAL13572.1|  403|Drosophila melanogaster GH11867p
           protein.
          Length = 403

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%)
 Frame = -3

Query: 301 RR*STAFWRWMRIYLGIL--QIWTSPELAECPDQWQSSLASSRREDSRSSWA 152
           R+ STAF  + R    I   Q W +  +A+   ++ +S+A+ RR  SRSS A
Sbjct: 123 RQSSTAFTAYRRYVRTIFHTQAWYNHNIADRGSRFWTSIAAVRRAHSRSSHA 174


>AE014297-1960|AAN13634.1|  403|Drosophila melanogaster CG31344-PA
           protein.
          Length = 403

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%)
 Frame = -3

Query: 301 RR*STAFWRWMRIYLGIL--QIWTSPELAECPDQWQSSLASSRREDSRSSWA 152
           R+ STAF  + R    I   Q W +  +A+   ++ +S+A+ RR  SRSS A
Sbjct: 123 RQSSTAFTAYRRYVRTIFHTQAWYNHNIADRGSRFWTSIAAVRRAHSRSSHA 174


>AE014134-2109|AAF53129.1|  174|Drosophila melanogaster CG14943-PA
           protein.
          Length = 174

 Score = 28.7 bits (61), Expect = 8.1
 Identities = 14/48 (29%), Positives = 27/48 (56%)
 Frame = +1

Query: 463 SLHQRGPTPSDPAQTRHQAGREEEGAVVVIAHDVDPIELVSLPASVMP 606
           +L +  PT  D  QT +  G+EE+G+     +   P+  +++PA+ +P
Sbjct: 4   TLDETPPTRRDKPQTLN-IGQEEQGSDPASGNTSSPVSSIAIPAARVP 50


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,579,884
Number of Sequences: 53049
Number of extensions: 616738
Number of successful extensions: 2072
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 1962
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2067
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3108380451
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -