SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20007
         (719 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y10618-2|CAA71628.1|  299|Drosophila melanogaster ADP/ATP transl...   147   2e-35
S71762-1|AAB31734.3|  297|Drosophila melanogaster ADP/ATP transl...   147   2e-35
BT011069-1|AAR31140.1|  299|Drosophila melanogaster GH27591p pro...   147   2e-35
AY070894-1|AAL48516.1|  299|Drosophila melanogaster LP02726p pro...   147   2e-35
AY060978-1|AAL28526.1|  299|Drosophila melanogaster GM12886p pro...   147   2e-35
AE014298-1497|AAF47957.1|  299|Drosophila melanogaster CG16944-P...   147   2e-35
AE014298-1496|AAG22341.1|  299|Drosophila melanogaster CG16944-P...   147   2e-35
AE014298-1495|AAN09268.1|  312|Drosophila melanogaster CG16944-P...   147   2e-35
AE014298-1494|AAN09267.1|  312|Drosophila melanogaster CG16944-P...   147   2e-35
S43651-1|AAB23114.1|  297|Drosophila melanogaster ADP/ATP transl...   145   6e-35
Y10618-1|CAA71629.1|  307|Drosophila melanogaster ADP/ATP transl...   137   2e-32
AE014298-1493|AAO41648.1|  307|Drosophila melanogaster CG1683-PB...   137   2e-32
AE014298-1492|AAF47956.1|  307|Drosophila melanogaster CG1683-PA...   137   2e-32
AY051433-1|AAK92857.1|  303|Drosophila melanogaster GH10708p pro...    45   9e-05
AE014296-2018|AAF50019.1|  303|Drosophila melanogaster CG7314-PB...    45   9e-05
AE014296-2017|AAN11881.1|  303|Drosophila melanogaster CG7314-PA...    45   9e-05
Y12495-1|CAA73099.1|  306|Drosophila melanogaster colt protein.        40   0.003
AY069277-1|AAL39422.1|  306|Drosophila melanogaster GM13207p pro...    40   0.003
AE014134-470|AAS64624.1|  306|Drosophila melanogaster CG3057-PD,...    40   0.003
AE014134-469|AAS64623.1|  306|Drosophila melanogaster CG3057-PC,...    40   0.003
AE014134-468|AAS64622.1|  306|Drosophila melanogaster CG3057-PB,...    40   0.003
AE014134-467|AAF51209.1|  306|Drosophila melanogaster CG3057-PA,...    40   0.003
BT021264-1|AAX33412.1|  365|Drosophila melanogaster RE52377p pro...    40   0.004
AY122132-1|AAM52644.1|  520|Drosophila melanogaster GH25190p pro...    40   0.004
AY119650-1|AAM50304.1|  363|Drosophila melanogaster RE56970p pro...    40   0.004
AE014297-2806|AAN14352.3|  290|Drosophila melanogaster CG4241-PB...    40   0.004
AE014297-2805|AAS65181.1|  365|Drosophila melanogaster CG4241-PC...    40   0.004
AE014297-2804|AAF55774.2|  365|Drosophila melanogaster CG4241-PA...    40   0.004
AE014296-2137|AAF49922.2|  363|Drosophila melanogaster CG32103-P...    40   0.004
AE014296-2136|AAF49921.2|  583|Drosophila melanogaster CG32103-P...    40   0.004
AE014296-2135|AAS65015.1|  583|Drosophila melanogaster CG32103-P...    40   0.004
AY071345-1|AAL48967.1|  303|Drosophila melanogaster RE38146p pro...    39   0.008
AE013599-1831|AAF58288.1|  303|Drosophila melanogaster CG8323-PA...    39   0.008
AE013599-1832|AAF58287.1|  304|Drosophila melanogaster CG18327-P...    37   0.024
BT001298-1|AAN71053.1|  323|Drosophila melanogaster AT11877p pro...    36   0.042
AE013599-3980|AAF47290.1|  323|Drosophila melanogaster CG2857-PA...    36   0.042
BT023526-1|AAY84926.1|  301|Drosophila melanogaster IP09951p pro...    35   0.13 
AY069591-1|AAL39736.1|  299|Drosophila melanogaster LD34154p pro...    35   0.13 
AM294746-1|CAL26732.1|  299|Drosophila melanogaster CG3476 protein.    35   0.13 
AM294745-1|CAL26731.1|  299|Drosophila melanogaster CG3476 protein.    35   0.13 
AM294743-1|CAL26729.1|  299|Drosophila melanogaster CG3476 protein.    35   0.13 
AM294742-1|CAL26728.1|  299|Drosophila melanogaster CG3476 protein.    35   0.13 
AM294741-1|CAL26727.1|  299|Drosophila melanogaster CG3476 protein.    35   0.13 
AM294740-1|CAL26726.1|  299|Drosophila melanogaster CG3476 protein.    35   0.13 
AM294739-1|CAL26725.1|  299|Drosophila melanogaster CG3476 protein.    35   0.13 
AM294738-1|CAL26724.1|  299|Drosophila melanogaster CG3476 protein.    35   0.13 
AM294737-1|CAL26723.1|  299|Drosophila melanogaster CG3476 protein.    35   0.13 
AM294736-1|CAL26722.1|  299|Drosophila melanogaster CG3476 protein.    35   0.13 
AE014134-1218|AAF52476.1|  299|Drosophila melanogaster CG3476-PA...    35   0.13 
AY051574-1|AAK92998.1|  339|Drosophila melanogaster GH22160p pro...    34   0.22 
AE014297-3625|AAF56335.1|  339|Drosophila melanogaster CG5805-PA...    34   0.22 
AM294744-1|CAL26730.1|  299|Drosophila melanogaster CG3476 protein.    33   0.30 
AY069712-1|AAL39857.1|  332|Drosophila melanogaster LP01207p pro...    33   0.52 
AE014297-1229|AAF54576.2|  332|Drosophila melanogaster CG6608-PB...    33   0.52 
AE014297-1228|AAF54575.1|  332|Drosophila melanogaster CG6608-PA...    33   0.52 
AY060454-1|AAL25493.1|  199|Drosophila melanogaster SD01736p pro...    32   0.68 
AE013599-1834|AAF58286.2|  199|Drosophila melanogaster CG18324-P...    32   0.68 
AE013599-1833|AAM70987.1|  307|Drosophila melanogaster CG18324-P...    32   0.68 
AF221715-1|AAF34661.1| 5554|Drosophila melanogaster split ends l...    32   0.90 
AF188205-1|AAF13218.1| 5533|Drosophila melanogaster Spen RNP mot...    32   0.90 
AF184612-1|AAF26299.1| 5476|Drosophila melanogaster split ends p...    32   0.90 
AE014134-58|AAN10511.1| 5476|Drosophila melanogaster CG18497-PC,...    32   0.90 
AE014134-57|AAF51534.2| 5533|Drosophila melanogaster CG18497-PB,...    32   0.90 
AE014134-56|AAF51535.2| 5560|Drosophila melanogaster CG18497-PA,...    32   0.90 
AY075266-1|AAL68133.1|  300|Drosophila melanogaster AT23224p pro...    31   1.2  
AE014134-1600|AAF52742.1|  300|Drosophila melanogaster CG9582-PA...    31   1.2  
AY089410-1|AAL90148.1|  287|Drosophila melanogaster AT23463p pro...    31   1.6  
AL132792-2|CAB60031.1|  306|Drosophila melanogaster EG:BACR19J1....    31   1.6  
AE014298-100|AAF45544.1|  306|Drosophila melanogaster CG5254-PA ...    31   1.6  
AE013599-565|AAF59153.1|  287|Drosophila melanogaster CG11196-PA...    31   2.1  
BT024341-1|ABC86403.1|  302|Drosophila melanogaster IP09652p pro...    30   2.8  
AE014297-2793|AAN13828.1|  304|Drosophila melanogaster CG4323-PB...    30   2.8  
AE014297-2792|AAF55767.2|  304|Drosophila melanogaster CG4323-PA...    30   2.8  
AE014296-3049|AAF49238.1|  302|Drosophila melanogaster CG18363-P...    30   2.8  
AE014297-1416|AAN13538.2|  240|Drosophila melanogaster CG12201-P...    30   3.6  
AE014297-1415|AAF54726.2|  319|Drosophila melanogaster CG12201-P...    30   3.6  
BT023505-1|AAY84905.1| 1231|Drosophila melanogaster LD15018p pro...    29   4.8  
AY094704-1|AAM11057.1|  311|Drosophila melanogaster GH11346p pro...    29   4.8  
AY060332-1|AAL25371.1|  304|Drosophila melanogaster GH22139p pro...    29   4.8  
AE014298-1282|AAF46448.3| 1231|Drosophila melanogaster CG7065-PA...    29   4.8  
AE013599-822|AAM68821.1|  304|Drosophila melanogaster CG8026-PB,...    29   4.8  
AE013599-821|AAF58969.1|  360|Drosophila melanogaster CG8026-PA,...    29   4.8  
BT022883-1|AAY55299.1|  199|Drosophila melanogaster IP07463p pro...    29   6.4  
AE014296-3048|AAF49239.1|  190|Drosophila melanogaster CG6893-PA...    29   8.4  

>Y10618-2|CAA71628.1|  299|Drosophila melanogaster ADP/ATP
           translocase protein.
          Length = 299

 Score =  147 bits (356), Expect = 2e-35
 Identities = 70/91 (76%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  SFWRGN ANVIRYFPTQALNFAFKDKYKQVFLGGVDK TQFWRYF        
Sbjct: 64  PKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGG 123

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAAD GKG GQR
Sbjct: 124 AAGATSLCFVYPLDFARTRLAADTGKG-GQR 153



 Score =  109 bits (261), Expect = 5e-24
 Identities = 51/63 (80%), Positives = 57/63 (90%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D V F KDF AGGISAAVSKTAVAPIERVKLLLQVQH+SKQI+ D++YKG+VD F+RIPK
Sbjct: 6   DAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPK 65

Query: 243 EQG 251
           EQG
Sbjct: 66  EQG 68



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 30/32 (93%), Positives = 31/32 (96%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISWA 695
           IIIYRA+YFGFYDTARGMLPDPKNTPI ISWA
Sbjct: 185 IIIYRAAYFGFYDTARGMLPDPKNTPIYISWA 216



 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 20/25 (80%), Positives = 25/25 (100%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F+GLGNC++KIFKSDG++GLYRGFG
Sbjct: 155 FTGLGNCLTKIFKSDGIVGLYRGFG 179


>S71762-1|AAB31734.3|  297|Drosophila melanogaster ADP/ATP
           translocase protein.
          Length = 297

 Score =  147 bits (356), Expect = 2e-35
 Identities = 70/91 (76%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  SFWRGN ANVIRYFPTQALNFAFKDKYKQVFLGGVDK TQFWRYF        
Sbjct: 64  PKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGG 123

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAAD GKG GQR
Sbjct: 124 AAGATSLCFVYPLDFARTRLAADTGKG-GQR 153



 Score =  105 bits (252), Expect = 6e-23
 Identities = 49/63 (77%), Positives = 56/63 (88%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D V F KDF AG +SAAVSKTAVAPIERVKLLLQVQH+SKQI+ D++YKG+VD F+RIPK
Sbjct: 6   DAVGFVKDFAAGQVSAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPK 65

Query: 243 EQG 251
           EQG
Sbjct: 66  EQG 68



 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 29/32 (90%), Positives = 30/32 (93%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISWA 695
           IIIYRA+YFGFYDTAR MLPDPKNTPI ISWA
Sbjct: 185 IIIYRAAYFGFYDTAR-MLPDPKNTPIYISWA 215



 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 20/25 (80%), Positives = 25/25 (100%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F+GLGNC++KIFKSDG++GLYRGFG
Sbjct: 155 FTGLGNCLTKIFKSDGIVGLYRGFG 179


>BT011069-1|AAR31140.1|  299|Drosophila melanogaster GH27591p
           protein.
          Length = 299

 Score =  147 bits (356), Expect = 2e-35
 Identities = 70/91 (76%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  SFWRGN ANVIRYFPTQALNFAFKDKYKQVFLGGVDK TQFWRYF        
Sbjct: 64  PKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGG 123

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAAD GKG GQR
Sbjct: 124 AAGATSLCFVYPLDFARTRLAADTGKG-GQR 153



 Score =  109 bits (261), Expect = 5e-24
 Identities = 51/63 (80%), Positives = 57/63 (90%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D V F KDF AGGISAAVSKTAVAPIERVKLLLQVQH+SKQI+ D++YKG+VD F+RIPK
Sbjct: 6   DAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPK 65

Query: 243 EQG 251
           EQG
Sbjct: 66  EQG 68



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 30/32 (93%), Positives = 31/32 (96%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISWA 695
           IIIYRA+YFGFYDTARGMLPDPKNTPI ISWA
Sbjct: 185 IIIYRAAYFGFYDTARGMLPDPKNTPIYISWA 216



 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 20/25 (80%), Positives = 25/25 (100%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F+GLGNC++KIFKSDG++GLYRGFG
Sbjct: 155 FTGLGNCLTKIFKSDGIVGLYRGFG 179


>AY070894-1|AAL48516.1|  299|Drosophila melanogaster LP02726p
           protein.
          Length = 299

 Score =  147 bits (356), Expect = 2e-35
 Identities = 70/91 (76%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  SFWRGN ANVIRYFPTQALNFAFKDKYKQVFLGGVDK TQFWRYF        
Sbjct: 64  PKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGG 123

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAAD GKG GQR
Sbjct: 124 AAGATSLCFVYPLDFARTRLAADTGKG-GQR 153



 Score =  109 bits (261), Expect = 5e-24
 Identities = 51/63 (80%), Positives = 57/63 (90%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D V F KDF AGGISAAVSKTAVAPIERVKLLLQVQH+SKQI+ D++YKG+VD F+RIPK
Sbjct: 6   DAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPK 65

Query: 243 EQG 251
           EQG
Sbjct: 66  EQG 68



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 30/32 (93%), Positives = 31/32 (96%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISWA 695
           IIIYRA+YFGFYDTARGMLPDPKNTPI ISWA
Sbjct: 185 IIIYRAAYFGFYDTARGMLPDPKNTPIYISWA 216



 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 20/25 (80%), Positives = 25/25 (100%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F+GLGNC++KIFKSDG++GLYRGFG
Sbjct: 155 FTGLGNCLTKIFKSDGIVGLYRGFG 179


>AY060978-1|AAL28526.1|  299|Drosophila melanogaster GM12886p
           protein.
          Length = 299

 Score =  147 bits (356), Expect = 2e-35
 Identities = 70/91 (76%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  SFWRGN ANVIRYFPTQALNFAFKDKYKQVFLGGVDK TQFWRYF        
Sbjct: 64  PKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGG 123

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAAD GKG GQR
Sbjct: 124 AAGATSLCFVYPLDFARTRLAADTGKG-GQR 153



 Score =  109 bits (261), Expect = 5e-24
 Identities = 51/63 (80%), Positives = 57/63 (90%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D V F KDF AGGISAAVSKTAVAPIERVKLLLQVQH+SKQI+ D++YKG+VD F+RIPK
Sbjct: 6   DAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPK 65

Query: 243 EQG 251
           EQG
Sbjct: 66  EQG 68



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 30/32 (93%), Positives = 31/32 (96%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISWA 695
           IIIYRA+YFGFYDTARGMLPDPKNTPI ISWA
Sbjct: 185 IIIYRAAYFGFYDTARGMLPDPKNTPIYISWA 216



 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 20/25 (80%), Positives = 25/25 (100%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F+GLGNC++KIFKSDG++GLYRGFG
Sbjct: 155 FTGLGNCLTKIFKSDGIVGLYRGFG 179


>AE014298-1497|AAF47957.1|  299|Drosophila melanogaster CG16944-PB,
           isoform B protein.
          Length = 299

 Score =  147 bits (356), Expect = 2e-35
 Identities = 70/91 (76%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  SFWRGN ANVIRYFPTQALNFAFKDKYKQVFLGGVDK TQFWRYF        
Sbjct: 64  PKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGG 123

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAAD GKG GQR
Sbjct: 124 AAGATSLCFVYPLDFARTRLAADTGKG-GQR 153



 Score =  109 bits (261), Expect = 5e-24
 Identities = 51/63 (80%), Positives = 57/63 (90%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D V F KDF AGGISAAVSKTAVAPIERVKLLLQVQH+SKQI+ D++YKG+VD F+RIPK
Sbjct: 6   DAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPK 65

Query: 243 EQG 251
           EQG
Sbjct: 66  EQG 68



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 30/32 (93%), Positives = 31/32 (96%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISWA 695
           IIIYRA+YFGFYDTARGMLPDPKNTPI ISWA
Sbjct: 185 IIIYRAAYFGFYDTARGMLPDPKNTPIYISWA 216



 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 20/25 (80%), Positives = 25/25 (100%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F+GLGNC++KIFKSDG++GLYRGFG
Sbjct: 155 FTGLGNCLTKIFKSDGIVGLYRGFG 179


>AE014298-1496|AAG22341.1|  299|Drosophila melanogaster CG16944-PA,
           isoform A protein.
          Length = 299

 Score =  147 bits (356), Expect = 2e-35
 Identities = 70/91 (76%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  SFWRGN ANVIRYFPTQALNFAFKDKYKQVFLGGVDK TQFWRYF        
Sbjct: 64  PKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGG 123

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAAD GKG GQR
Sbjct: 124 AAGATSLCFVYPLDFARTRLAADTGKG-GQR 153



 Score =  109 bits (261), Expect = 5e-24
 Identities = 51/63 (80%), Positives = 57/63 (90%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D V F KDF AGGISAAVSKTAVAPIERVKLLLQVQH+SKQI+ D++YKG+VD F+RIPK
Sbjct: 6   DAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPK 65

Query: 243 EQG 251
           EQG
Sbjct: 66  EQG 68



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 30/32 (93%), Positives = 31/32 (96%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISWA 695
           IIIYRA+YFGFYDTARGMLPDPKNTPI ISWA
Sbjct: 185 IIIYRAAYFGFYDTARGMLPDPKNTPIYISWA 216



 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 20/25 (80%), Positives = 25/25 (100%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F+GLGNC++KIFKSDG++GLYRGFG
Sbjct: 155 FTGLGNCLTKIFKSDGIVGLYRGFG 179


>AE014298-1495|AAN09268.1|  312|Drosophila melanogaster CG16944-PD,
           isoform D protein.
          Length = 312

 Score =  147 bits (356), Expect = 2e-35
 Identities = 70/91 (76%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  SFWRGN ANVIRYFPTQALNFAFKDKYKQVFLGGVDK TQFWRYF        
Sbjct: 77  PKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGG 136

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAAD GKG GQR
Sbjct: 137 AAGATSLCFVYPLDFARTRLAADTGKG-GQR 166



 Score =  113 bits (271), Expect = 3e-25
 Identities = 55/74 (74%), Positives = 62/74 (83%)
 Frame = +3

Query: 30  IT*SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYK 209
           IT  +KM    D V F KDF AGGISAAVSKTAVAPIERVKLLLQVQH+SKQI+ D++YK
Sbjct: 8   ITSQSKMGKDFDAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYK 67

Query: 210 GIVDAFVRIPKEQG 251
           G+VD F+RIPKEQG
Sbjct: 68  GMVDCFIRIPKEQG 81



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 30/32 (93%), Positives = 31/32 (96%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISWA 695
           IIIYRA+YFGFYDTARGMLPDPKNTPI ISWA
Sbjct: 198 IIIYRAAYFGFYDTARGMLPDPKNTPIYISWA 229



 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 20/25 (80%), Positives = 25/25 (100%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F+GLGNC++KIFKSDG++GLYRGFG
Sbjct: 168 FTGLGNCLTKIFKSDGIVGLYRGFG 192


>AE014298-1494|AAN09267.1|  312|Drosophila melanogaster CG16944-PC,
           isoform C protein.
          Length = 312

 Score =  147 bits (356), Expect = 2e-35
 Identities = 70/91 (76%), Positives = 71/91 (78%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  SFWRGN ANVIRYFPTQALNFAFKDKYKQVFLGGVDK TQFWRYF        
Sbjct: 77  PKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGG 136

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAAD GKG GQR
Sbjct: 137 AAGATSLCFVYPLDFARTRLAADTGKG-GQR 166



 Score =  113 bits (271), Expect = 3e-25
 Identities = 55/74 (74%), Positives = 62/74 (83%)
 Frame = +3

Query: 30  IT*SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYK 209
           IT  +KM    D V F KDF AGGISAAVSKTAVAPIERVKLLLQVQH+SKQI+ D++YK
Sbjct: 8   ITSQSKMGKDFDAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYK 67

Query: 210 GIVDAFVRIPKEQG 251
           G+VD F+RIPKEQG
Sbjct: 68  GMVDCFIRIPKEQG 81



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 30/32 (93%), Positives = 31/32 (96%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISWA 695
           IIIYRA+YFGFYDTARGMLPDPKNTPI ISWA
Sbjct: 198 IIIYRAAYFGFYDTARGMLPDPKNTPIYISWA 229



 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 20/25 (80%), Positives = 25/25 (100%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F+GLGNC++KIFKSDG++GLYRGFG
Sbjct: 168 FTGLGNCLTKIFKSDGIVGLYRGFG 192


>S43651-1|AAB23114.1|  297|Drosophila melanogaster ADP/ATP
           translocase protein.
          Length = 297

 Score =  145 bits (351), Expect = 6e-35
 Identities = 69/91 (75%), Positives = 70/91 (76%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  SFWRGN ANV RYFPTQALNFAFKDKYKQVFLGGVDK TQFWRYF        
Sbjct: 64  PKEQGFSSFWRGNLANVYRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGG 123

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
               TSLCFVYPLDFARTRLAAD GKG GQR
Sbjct: 124 AAGATSLCFVYPLDFARTRLAADTGKG-GQR 153



 Score =  105 bits (252), Expect = 6e-23
 Identities = 49/63 (77%), Positives = 56/63 (88%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D V F KDF AG +SAAVSKTAVAPIERVKLLLQVQH+SKQI+ D++YKG+VD F+RIPK
Sbjct: 6   DAVGFVKDFAAGQVSAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPK 65

Query: 243 EQG 251
           EQG
Sbjct: 66  EQG 68



 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 29/32 (90%), Positives = 30/32 (93%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISWA 695
           IIIYRA+YFGFYDTAR MLPDPKNTPI ISWA
Sbjct: 185 IIIYRAAYFGFYDTAR-MLPDPKNTPIYISWA 215



 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 20/25 (80%), Positives = 25/25 (100%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F+GLGNC++KIFKSDG++GLYRGFG
Sbjct: 155 FTGLGNCLTKIFKSDGIVGLYRGFG 179


>Y10618-1|CAA71629.1|  307|Drosophila melanogaster ADP/ATP
           translocase protein.
          Length = 307

 Score =  137 bits (331), Expect = 2e-32
 Identities = 64/87 (73%), Positives = 66/87 (75%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  SFWRGN ANVIRYFPTQALNFAFKD YK VFLGGVDK  QFWR+F        
Sbjct: 72  PKEQGFSSFWRGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGG 131

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKG 496
               TSLCFVYPLDFARTRLAADVGKG
Sbjct: 132 AAGATSLCFVYPLDFARTRLAADVGKG 158



 Score =  104 bits (250), Expect = 1e-22
 Identities = 49/63 (77%), Positives = 56/63 (88%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D  +F  DF+ GG+SAA++KTAVAPIERVKL+LQVQ VSKQIAADQRYKGIVD F+RIPK
Sbjct: 14  DLKSFLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPK 73

Query: 243 EQG 251
           EQG
Sbjct: 74  EQG 76



 Score = 58.4 bits (135), Expect = 9e-09
 Identities = 27/54 (50%), Positives = 37/54 (68%), Gaps = 3/54 (5%)
 Frame = +3

Query: 543 LQVRRSDWSVQRFRCVRAS---IIIYRASYFGFYDTARGMLPDPKNTPIVISWA 695
           ++V +SD  +  +R    S   I+IYRA+YFGFYDT R  LP+PK+TP  +SWA
Sbjct: 171 MKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCRDFLPNPKSTPFYVSWA 224



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F+GL +C+ K+ KSDG IGLYRGF
Sbjct: 163 FNGLIDCLMKVIKSDGPIGLYRGF 186


>AE014298-1493|AAO41648.1|  307|Drosophila melanogaster CG1683-PB,
           isoform B protein.
          Length = 307

 Score =  137 bits (331), Expect = 2e-32
 Identities = 64/87 (73%), Positives = 66/87 (75%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  SFWRGN ANVIRYFPTQALNFAFKD YK VFLGGVDK  QFWR+F        
Sbjct: 72  PKEQGFSSFWRGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGG 131

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKG 496
               TSLCFVYPLDFARTRLAADVGKG
Sbjct: 132 AAGATSLCFVYPLDFARTRLAADVGKG 158



 Score =  104 bits (250), Expect = 1e-22
 Identities = 49/63 (77%), Positives = 56/63 (88%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D  +F  DF+ GG+SAA++KTAVAPIERVKL+LQVQ VSKQIAADQRYKGIVD F+RIPK
Sbjct: 14  DLKSFLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPK 73

Query: 243 EQG 251
           EQG
Sbjct: 74  EQG 76



 Score = 58.4 bits (135), Expect = 9e-09
 Identities = 27/54 (50%), Positives = 37/54 (68%), Gaps = 3/54 (5%)
 Frame = +3

Query: 543 LQVRRSDWSVQRFRCVRAS---IIIYRASYFGFYDTARGMLPDPKNTPIVISWA 695
           ++V +SD  +  +R    S   I+IYRA+YFGFYDT R  LP+PK+TP  +SWA
Sbjct: 171 MKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCRDFLPNPKSTPFYVSWA 224



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F+GL +C+ K+ KSDG IGLYRGF
Sbjct: 163 FNGLIDCLMKVIKSDGPIGLYRGF 186


>AE014298-1492|AAF47956.1|  307|Drosophila melanogaster CG1683-PA,
           isoform A protein.
          Length = 307

 Score =  137 bits (331), Expect = 2e-32
 Identities = 64/87 (73%), Positives = 66/87 (75%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXX 415
           P+  G  SFWRGN ANVIRYFPTQALNFAFKD YK VFLGGVDK  QFWR+F        
Sbjct: 72  PKEQGFSSFWRGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGG 131

Query: 416 XXXXTSLCFVYPLDFARTRLAADVGKG 496
               TSLCFVYPLDFARTRLAADVGKG
Sbjct: 132 AAGATSLCFVYPLDFARTRLAADVGKG 158



 Score =  104 bits (250), Expect = 1e-22
 Identities = 49/63 (77%), Positives = 56/63 (88%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPK 242
           D  +F  DF+ GG+SAA++KTAVAPIERVKL+LQVQ VSKQIAADQRYKGIVD F+RIPK
Sbjct: 14  DLKSFLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPK 73

Query: 243 EQG 251
           EQG
Sbjct: 74  EQG 76



 Score = 58.4 bits (135), Expect = 9e-09
 Identities = 27/54 (50%), Positives = 37/54 (68%), Gaps = 3/54 (5%)
 Frame = +3

Query: 543 LQVRRSDWSVQRFRCVRAS---IIIYRASYFGFYDTARGMLPDPKNTPIVISWA 695
           ++V +SD  +  +R    S   I+IYRA+YFGFYDT R  LP+PK+TP  +SWA
Sbjct: 171 MKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCRDFLPNPKSTPFYVSWA 224



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F+GL +C+ K+ KSDG IGLYRGF
Sbjct: 163 FNGLIDCLMKVIKSDGPIGLYRGF 186


>AY051433-1|AAK92857.1|  303|Drosophila melanogaster GH10708p
           protein.
          Length = 303

 Score = 45.2 bits (102), Expect = 9e-05
 Identities = 23/66 (34%), Positives = 40/66 (60%), Gaps = 3/66 (4%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVS-KQIAADQRYKGIVDAFVRIPKEQGL- 254
           + F+ GG+++  ++    PI+  K  LQ+Q     Q  +  RY+G+ DAFV+I +E+GL 
Sbjct: 8   RPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLR 67

Query: 255 -FHSGV 269
             +SG+
Sbjct: 68  ALYSGI 73


>AE014296-2018|AAF50019.1|  303|Drosophila melanogaster CG7314-PB,
           isoform B protein.
          Length = 303

 Score = 45.2 bits (102), Expect = 9e-05
 Identities = 23/66 (34%), Positives = 40/66 (60%), Gaps = 3/66 (4%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVS-KQIAADQRYKGIVDAFVRIPKEQGL- 254
           + F+ GG+++  ++    PI+  K  LQ+Q     Q  +  RY+G+ DAFV+I +E+GL 
Sbjct: 8   RPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLR 67

Query: 255 -FHSGV 269
             +SG+
Sbjct: 68  ALYSGI 73


>AE014296-2017|AAN11881.1|  303|Drosophila melanogaster CG7314-PA,
           isoform A protein.
          Length = 303

 Score = 45.2 bits (102), Expect = 9e-05
 Identities = 23/66 (34%), Positives = 40/66 (60%), Gaps = 3/66 (4%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVS-KQIAADQRYKGIVDAFVRIPKEQGL- 254
           + F+ GG+++  ++    PI+  K  LQ+Q     Q  +  RY+G+ DAFV+I +E+GL 
Sbjct: 8   RPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLR 67

Query: 255 -FHSGV 269
             +SG+
Sbjct: 68  ALYSGI 73


>Y12495-1|CAA73099.1|  306|Drosophila melanogaster colt protein.
          Length = 306

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 21/62 (33%), Positives = 35/62 (56%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F+AG  S   S   +AP ER+K+LLQ Q        +++Y G++D   ++ KE 
Sbjct: 113 LTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQGQ---GGERKYNGMIDCAGKLYKEG 169

Query: 249 GL 254
           GL
Sbjct: 170 GL 171


>AY069277-1|AAL39422.1|  306|Drosophila melanogaster GM13207p
           protein.
          Length = 306

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 21/62 (33%), Positives = 35/62 (56%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F+AG  S   S   +AP ER+K+LLQ Q        +++Y G++D   ++ KE 
Sbjct: 113 LTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQGQ---GGERKYNGMIDCAGKLYKEG 169

Query: 249 GL 254
           GL
Sbjct: 170 GL 171


>AE014134-470|AAS64624.1|  306|Drosophila melanogaster CG3057-PD,
           isoform D protein.
          Length = 306

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 21/62 (33%), Positives = 35/62 (56%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F+AG  S   S   +AP ER+K+LLQ Q        +++Y G++D   ++ KE 
Sbjct: 113 LTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQGQ---GGERKYNGMIDCAGKLYKEG 169

Query: 249 GL 254
           GL
Sbjct: 170 GL 171


>AE014134-469|AAS64623.1|  306|Drosophila melanogaster CG3057-PC,
           isoform C protein.
          Length = 306

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 21/62 (33%), Positives = 35/62 (56%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F+AG  S   S   +AP ER+K+LLQ Q        +++Y G++D   ++ KE 
Sbjct: 113 LTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQGQ---GGERKYNGMIDCAGKLYKEG 169

Query: 249 GL 254
           GL
Sbjct: 170 GL 171


>AE014134-468|AAS64622.1|  306|Drosophila melanogaster CG3057-PB,
           isoform B protein.
          Length = 306

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 21/62 (33%), Positives = 35/62 (56%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F+AG  S   S   +AP ER+K+LLQ Q        +++Y G++D   ++ KE 
Sbjct: 113 LTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQGQ---GGERKYNGMIDCAGKLYKEG 169

Query: 249 GL 254
           GL
Sbjct: 170 GL 171


>AE014134-467|AAF51209.1|  306|Drosophila melanogaster CG3057-PA,
           isoform A protein.
          Length = 306

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 21/62 (33%), Positives = 35/62 (56%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F+AG  S   S   +AP ER+K+LLQ Q        +++Y G++D   ++ KE 
Sbjct: 113 LTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQGQ---GGERKYNGMIDCAGKLYKEG 169

Query: 249 GL 254
           GL
Sbjct: 170 GL 171


>BT021264-1|AAX33412.1|  365|Drosophila melanogaster RE52377p
           protein.
          Length = 365

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 24/77 (31%), Positives = 34/77 (44%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G L+ WRGN A + R  P  A+ F   ++++++     D      R F            
Sbjct: 125 GVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRF----LAGSLAGI 180

Query: 428 TSLCFVYPLDFARTRLA 478
           TS    YPLD AR R+A
Sbjct: 181 TSQSLTYPLDLARARMA 197



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 16/53 (30%), Positives = 29/53 (54%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G  + A  +TA  P++ V+  +Q   V+   A   RY  I++  V+I +E+G+
Sbjct: 271 GAAAGAAGQTASYPLDIVRRRMQTMRVNT--AGGDRYPTILETLVKIYREEGV 321


>AY122132-1|AAM52644.1|  520|Drosophila melanogaster GH25190p
           protein.
          Length = 520

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 16/30 (53%), Positives = 24/30 (80%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           +  +AGGI+ AVS+T  AP++R+K+ LQVQ
Sbjct: 287 RHLVAGGIAGAVSRTCTAPLDRIKVYLQVQ 316



 Score = 37.5 bits (83), Expect = 0.018
 Identities = 24/77 (31%), Positives = 35/77 (45%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           GS S WRGN  NV++  P  A  FA  ++ K++ + G D   Q                 
Sbjct: 334 GSRSMWRGNGINVLKIAPETAFKFAAYEQMKRL-IRGDDGSRQM--SIVERFYAGAAAGG 390

Query: 428 TSLCFVYPLDFARTRLA 478
            S   +YP++  +TRLA
Sbjct: 391 ISQTIIYPMEVLKTRLA 407



 Score = 31.5 bits (68), Expect = 1.2
 Identities = 22/82 (26%), Positives = 32/82 (39%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G  SF+RG   N++   P   ++ A  +  K+ ++   D   Q   +             
Sbjct: 429 GVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIANHDNNEQP-SFLVLLACGSTSSTL 487

Query: 428 TSLCFVYPLDFARTRLAADVGK 493
             LC  YPL   RTRL A   K
Sbjct: 488 GQLCS-YPLALVRTRLQAQAAK 508


>AY119650-1|AAM50304.1|  363|Drosophila melanogaster RE56970p
           protein.
          Length = 363

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 16/30 (53%), Positives = 24/30 (80%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           +  +AGGI+ AVS+T  AP++R+K+ LQVQ
Sbjct: 67  RHLVAGGIAGAVSRTCTAPLDRIKVYLQVQ 96



 Score = 37.5 bits (83), Expect = 0.018
 Identities = 24/77 (31%), Positives = 35/77 (45%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           GS S WRGN  NV++  P  A  FA  ++ K++ + G D   Q                 
Sbjct: 114 GSRSMWRGNGINVLKIAPETAFKFAAYEQMKRL-IRGDDGSRQM--SIVERFYAGAAAGG 170

Query: 428 TSLCFVYPLDFARTRLA 478
            S   +YP++  +TRLA
Sbjct: 171 ISQTIIYPMEVLKTRLA 187


>AE014297-2806|AAN14352.3|  290|Drosophila melanogaster CG4241-PB,
           isoform B protein.
          Length = 290

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 24/77 (31%), Positives = 34/77 (44%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G L+ WRGN A + R  P  A+ F   ++++++     D      R F            
Sbjct: 50  GVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRF----LAGSLAGI 105

Query: 428 TSLCFVYPLDFARTRLA 478
           TS    YPLD AR R+A
Sbjct: 106 TSQSLTYPLDLARARMA 122



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 16/53 (30%), Positives = 29/53 (54%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G  + A  +TA  P++ V+  +Q   V+   A   RY  I++  V+I +E+G+
Sbjct: 196 GAAAGAAGQTASYPLDIVRRRMQTMRVNT--AGGDRYPTILETLVKIYREEGV 246


>AE014297-2805|AAS65181.1|  365|Drosophila melanogaster CG4241-PC,
           isoform C protein.
          Length = 365

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 24/77 (31%), Positives = 34/77 (44%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G L+ WRGN A + R  P  A+ F   ++++++     D      R F            
Sbjct: 125 GVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRF----LAGSLAGI 180

Query: 428 TSLCFVYPLDFARTRLA 478
           TS    YPLD AR R+A
Sbjct: 181 TSQSLTYPLDLARARMA 197



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 16/53 (30%), Positives = 29/53 (54%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G  + A  +TA  P++ V+  +Q   V+   A   RY  I++  V+I +E+G+
Sbjct: 271 GAAAGAAGQTASYPLDIVRRRMQTMRVNT--AGGDRYPTILETLVKIYREEGV 321


>AE014297-2804|AAF55774.2|  365|Drosophila melanogaster CG4241-PA,
           isoform A protein.
          Length = 365

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 24/77 (31%), Positives = 34/77 (44%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G L+ WRGN A + R  P  A+ F   ++++++     D      R F            
Sbjct: 125 GVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRF----LAGSLAGI 180

Query: 428 TSLCFVYPLDFARTRLA 478
           TS    YPLD AR R+A
Sbjct: 181 TSQSLTYPLDLARARMA 197



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 16/53 (30%), Positives = 29/53 (54%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           G  + A  +TA  P++ V+  +Q   V+   A   RY  I++  V+I +E+G+
Sbjct: 271 GAAAGAAGQTASYPLDIVRRRMQTMRVNT--AGGDRYPTILETLVKIYREEGV 321


>AE014296-2137|AAF49922.2|  363|Drosophila melanogaster CG32103-PC,
           isoform C protein.
          Length = 363

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 16/30 (53%), Positives = 24/30 (80%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           +  +AGGI+ AVS+T  AP++R+K+ LQVQ
Sbjct: 67  RHLVAGGIAGAVSRTCTAPLDRIKVYLQVQ 96



 Score = 37.5 bits (83), Expect = 0.018
 Identities = 24/77 (31%), Positives = 35/77 (45%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           GS S WRGN  NV++  P  A  FA  ++ K++ + G D   Q                 
Sbjct: 114 GSRSMWRGNGINVLKIAPETAFKFAAYEQMKRL-IRGDDGSRQM--SIVERFYAGAAAGG 170

Query: 428 TSLCFVYPLDFARTRLA 478
            S   +YP++  +TRLA
Sbjct: 171 ISQTIIYPMEVLKTRLA 187


>AE014296-2136|AAF49921.2|  583|Drosophila melanogaster CG32103-PB,
           isoform B protein.
          Length = 583

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 16/30 (53%), Positives = 24/30 (80%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           +  +AGGI+ AVS+T  AP++R+K+ LQVQ
Sbjct: 287 RHLVAGGIAGAVSRTCTAPLDRIKVYLQVQ 316



 Score = 37.5 bits (83), Expect = 0.018
 Identities = 24/77 (31%), Positives = 35/77 (45%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           GS S WRGN  NV++  P  A  FA  ++ K++ + G D   Q                 
Sbjct: 334 GSRSMWRGNGINVLKIAPETAFKFAAYEQMKRL-IRGDDGSRQM--SIVERFYAGAAAGG 390

Query: 428 TSLCFVYPLDFARTRLA 478
            S   +YP++  +TRLA
Sbjct: 391 ISQTIIYPMEVLKTRLA 407


>AE014296-2135|AAS65015.1|  583|Drosophila melanogaster CG32103-PA,
           isoform A protein.
          Length = 583

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 16/30 (53%), Positives = 24/30 (80%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQ 170
           +  +AGGI+ AVS+T  AP++R+K+ LQVQ
Sbjct: 287 RHLVAGGIAGAVSRTCTAPLDRIKVYLQVQ 316



 Score = 37.5 bits (83), Expect = 0.018
 Identities = 24/77 (31%), Positives = 35/77 (45%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           GS S WRGN  NV++  P  A  FA  ++ K++ + G D   Q                 
Sbjct: 334 GSRSMWRGNGINVLKIAPETAFKFAAYEQMKRL-IRGDDGSRQM--SIVERFYAGAAAGG 390

Query: 428 TSLCFVYPLDFARTRLA 478
            S   +YP++  +TRLA
Sbjct: 391 ISQTIIYPMEVLKTRLA 407


>AY071345-1|AAL48967.1|  303|Drosophila melanogaster RE38146p
           protein.
          Length = 303

 Score = 38.7 bits (86), Expect = 0.008
 Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 1/58 (1%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           DF+ GG+++  +     PIE +K  +Q+Q  ++ +    + YKGIV+AF+ + K  G+
Sbjct: 5   DFVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGI 62



 Score = 29.9 bits (64), Expect = 3.6
 Identities = 16/57 (28%), Positives = 30/57 (52%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           F AG I+ ++   A+ P + +   L  Q V  +      Y+G +D FV+I + +G++
Sbjct: 211 FSAGLIAGSIMSVAITPPDVITTRLYNQGVDAE-GRGLLYRGWLDCFVKILRSEGVY 266



 Score = 29.1 bits (62), Expect = 6.4
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           + G  +C  KI +S+G+ G+Y+GF
Sbjct: 249 YRGWLDCFVKILRSEGVYGMYKGF 272


>AE013599-1831|AAF58288.1|  303|Drosophila melanogaster CG8323-PA
           protein.
          Length = 303

 Score = 38.7 bits (86), Expect = 0.008
 Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 1/58 (1%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           DF+ GG+++  +     PIE +K  +Q+Q  ++ +    + YKGIV+AF+ + K  G+
Sbjct: 5   DFVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGI 62



 Score = 29.9 bits (64), Expect = 3.6
 Identities = 16/57 (28%), Positives = 30/57 (52%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           F AG I+ ++   A+ P + +   L  Q V  +      Y+G +D FV+I + +G++
Sbjct: 211 FSAGLIAGSIMSVAITPPDVITTRLYNQGVDAE-GRGLLYRGWLDCFVKILRSEGVY 266



 Score = 29.1 bits (62), Expect = 6.4
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           + G  +C  KI +S+G+ G+Y+GF
Sbjct: 249 YRGWLDCFVKILRSEGVYGMYKGF 272


>AE013599-1832|AAF58287.1|  304|Drosophila melanogaster CG18327-PA
           protein.
          Length = 304

 Score = 37.1 bits (82), Expect = 0.024
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           DF+ GG++A  +     P+E +K  +Q+Q  ++ + +  Q YK +  AFV + K  G+
Sbjct: 5   DFVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGI 62



 Score = 28.7 bits (61), Expect = 8.4
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           + G  +C+  I +S+G+ GLY+GF
Sbjct: 249 YRGWLDCVLTILRSEGVYGLYKGF 272


>BT001298-1|AAN71053.1|  323|Drosophila melanogaster AT11877p
           protein.
          Length = 323

 Score = 36.3 bits (80), Expect = 0.042
 Identities = 15/55 (27%), Positives = 31/55 (56%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           + GGI+ A ++T   P++ +K+  Q+Q          +Y+G++ AF  +  E+G+
Sbjct: 14  VGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGM 68


>AE013599-3980|AAF47290.1|  323|Drosophila melanogaster CG2857-PA
           protein.
          Length = 323

 Score = 36.3 bits (80), Expect = 0.042
 Identities = 15/55 (27%), Positives = 31/55 (56%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           + GGI+ A ++T   P++ +K+  Q+Q          +Y+G++ AF  +  E+G+
Sbjct: 14  VGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGM 68


>BT023526-1|AAY84926.1|  301|Drosophila melanogaster IP09951p
           protein.
          Length = 301

 Score = 34.7 bits (76), Expect = 0.13
 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           DF+ GG++A  +     P+E +K  +Q+Q  ++ + +  Q YK +   FV + K  G+
Sbjct: 2   DFVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQDFVTVAKNDGI 59



 Score = 28.7 bits (61), Expect = 8.4
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           + G  +C+  I +S+G+ GLY+GF
Sbjct: 246 YRGWLDCVLTILRSEGVYGLYKGF 269


>AY069591-1|AAL39736.1|  299|Drosophila melanogaster LD34154p
           protein.
          Length = 299

 Score = 34.7 bits (76), Expect = 0.13
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F AG ++   S     P +R+K+LLQ Q VS        Y G +D   ++ ++ 
Sbjct: 112 LTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSN---GPLLYNGTIDTAAKLYRQG 168

Query: 249 GL 254
           G+
Sbjct: 169 GI 170



 Score = 33.9 bits (74), Expect = 0.22
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL-- 254
           K F+AGG+    +     P++ +K+ LQ            RYKG++D   R  + +G   
Sbjct: 16  KSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPP-GQPPRYKGVIDCAARTFRYEGFRG 74

Query: 255 FHSGV 269
           F+ G+
Sbjct: 75  FYRGI 79


>AM294746-1|CAL26732.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 34.7 bits (76), Expect = 0.13
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F AG ++   S     P +R+K+LLQ Q VS        Y G +D   ++ ++ 
Sbjct: 112 LTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSN---GPLLYNGTIDTAAKLYRQG 168

Query: 249 GL 254
           G+
Sbjct: 169 GI 170



 Score = 33.9 bits (74), Expect = 0.22
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL-- 254
           K F+AGG+    +     P++ +K+ LQ            RYKG++D   R  + +G   
Sbjct: 16  KSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPP-GQPPRYKGVIDCAARTFRYEGFRG 74

Query: 255 FHSGV 269
           F+ G+
Sbjct: 75  FYRGI 79


>AM294745-1|CAL26731.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 34.7 bits (76), Expect = 0.13
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F AG ++   S     P +R+K+LLQ Q VS        Y G +D   ++ ++ 
Sbjct: 112 LTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSN---GPLLYNGTIDTAAKLYRQG 168

Query: 249 GL 254
           G+
Sbjct: 169 GI 170



 Score = 33.9 bits (74), Expect = 0.22
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL-- 254
           K F+AGG+    +     P++ +K+ LQ            RYKG++D   R  + +G   
Sbjct: 16  KSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPP-GQPPRYKGVIDCAARTFRYEGFRG 74

Query: 255 FHSGV 269
           F+ G+
Sbjct: 75  FYRGI 79


>AM294743-1|CAL26729.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 34.7 bits (76), Expect = 0.13
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F AG ++   S     P +R+K+LLQ Q VS        Y G +D   ++ ++ 
Sbjct: 112 LTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSN---GPLLYNGTIDTAAKLYRQG 168

Query: 249 GL 254
           G+
Sbjct: 169 GI 170



 Score = 33.9 bits (74), Expect = 0.22
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL-- 254
           K F+AGG+    +     P++ +K+ LQ            RYKG++D   R  + +G   
Sbjct: 16  KSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPP-GQPPRYKGVIDCAARTFRYEGFRG 74

Query: 255 FHSGV 269
           F+ G+
Sbjct: 75  FYRGI 79


>AM294742-1|CAL26728.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 34.7 bits (76), Expect = 0.13
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F AG ++   S     P +R+K+LLQ Q VS        Y G +D   ++ ++ 
Sbjct: 112 LTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSN---GPLLYNGTIDTAAKLYRQG 168

Query: 249 GL 254
           G+
Sbjct: 169 GI 170



 Score = 33.9 bits (74), Expect = 0.22
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL-- 254
           K F+AGG+    +     P++ +K+ LQ            RYKG++D   R  + +G   
Sbjct: 16  KSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPP-GQPPRYKGVIDCAARTFRYEGFRG 74

Query: 255 FHSGV 269
           F+ G+
Sbjct: 75  FYRGI 79


>AM294741-1|CAL26727.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 34.7 bits (76), Expect = 0.13
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F AG ++   S     P +R+K+LLQ Q VS        Y G +D   ++ ++ 
Sbjct: 112 LTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSN---GPLLYNGTIDTAAKLYRQG 168

Query: 249 GL 254
           G+
Sbjct: 169 GI 170



 Score = 33.9 bits (74), Expect = 0.22
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL-- 254
           K F+AGG+    +     P++ +K+ LQ            RYKG++D   R  + +G   
Sbjct: 16  KSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPP-GQPPRYKGVIDCAARTFRYEGFRG 74

Query: 255 FHSGV 269
           F+ G+
Sbjct: 75  FYRGI 79


>AM294740-1|CAL26726.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 34.7 bits (76), Expect = 0.13
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F AG ++   S     P +R+K+LLQ Q VS        Y G +D   ++ ++ 
Sbjct: 112 LTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSN---GPLLYNGTIDTAAKLYRQG 168

Query: 249 GL 254
           G+
Sbjct: 169 GI 170



 Score = 33.9 bits (74), Expect = 0.22
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL-- 254
           K F+AGG+    +     P++ +K+ LQ            RYKG++D   R  + +G   
Sbjct: 16  KSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPP-GQPPRYKGVIDCAARTFRYEGFRG 74

Query: 255 FHSGV 269
           F+ G+
Sbjct: 75  FYRGI 79


>AM294739-1|CAL26725.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 34.7 bits (76), Expect = 0.13
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F AG ++   S     P +R+K+LLQ Q VS        Y G +D   ++ ++ 
Sbjct: 112 LTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSN---GPLLYNGTIDTAAKLYRQG 168

Query: 249 GL 254
           G+
Sbjct: 169 GI 170



 Score = 33.9 bits (74), Expect = 0.22
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL-- 254
           K F+AGG+    +     P++ +K+ LQ            RYKG++D   R  + +G   
Sbjct: 16  KSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPP-GQPPRYKGVIDCAARTFRYEGFRG 74

Query: 255 FHSGV 269
           F+ G+
Sbjct: 75  FYRGI 79


>AM294738-1|CAL26724.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 34.7 bits (76), Expect = 0.13
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F AG ++   S     P +R+K+LLQ Q VS        Y G +D   ++ ++ 
Sbjct: 112 LTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSN---GPLLYNGTIDTAAKLYRQG 168

Query: 249 GL 254
           G+
Sbjct: 169 GI 170



 Score = 33.9 bits (74), Expect = 0.22
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL-- 254
           K F+AGG+    +     P++ +K+ LQ            RYKG++D   R  + +G   
Sbjct: 16  KSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPP-GQPPRYKGVIDCAARTFRYEGFRG 74

Query: 255 FHSGV 269
           F+ G+
Sbjct: 75  FYRGI 79


>AM294737-1|CAL26723.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 34.7 bits (76), Expect = 0.13
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F AG ++   S     P +R+K+LLQ Q VS        Y G +D   ++ ++ 
Sbjct: 112 LTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSN---GPLLYNGTIDTAAKLYRQG 168

Query: 249 GL 254
           G+
Sbjct: 169 GI 170



 Score = 33.9 bits (74), Expect = 0.22
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL-- 254
           K F+AGG+    +     P++ +K+ LQ            RYKG++D   R  + +G   
Sbjct: 16  KSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPP-GQPPRYKGVIDCAARTFRYEGFRG 74

Query: 255 FHSGV 269
           F+ G+
Sbjct: 75  FYRGI 79


>AM294736-1|CAL26722.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 34.7 bits (76), Expect = 0.13
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F AG ++   S     P +R+K+LLQ Q VS        Y G +D   ++ ++ 
Sbjct: 112 LTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSN---GPLLYNGTIDTAAKLYRQG 168

Query: 249 GL 254
           G+
Sbjct: 169 GI 170



 Score = 33.5 bits (73), Expect = 0.30
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL-- 254
           K F+AGG+    +     P++ +K+ LQ            RYKG++D   R  + +G   
Sbjct: 16  KSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPLP-GQPPRYKGVIDCAARTFRYEGFRG 74

Query: 255 FHSGV 269
           F+ G+
Sbjct: 75  FYRGI 79


>AE014134-1218|AAF52476.1|  299|Drosophila melanogaster CG3476-PA
           protein.
          Length = 299

 Score = 34.7 bits (76), Expect = 0.13
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + F AG ++   S     P +R+K+LLQ Q VS        Y G +D   ++ ++ 
Sbjct: 112 LTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSN---GPLLYNGTIDTAAKLYRQG 168

Query: 249 GL 254
           G+
Sbjct: 169 GI 170



 Score = 33.9 bits (74), Expect = 0.22
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL-- 254
           K F+AGG+    +     P++ +K+ LQ            RYKG++D   R  + +G   
Sbjct: 16  KSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPP-GQPPRYKGVIDCAARTFRYEGFRG 74

Query: 255 FHSGV 269
           F+ G+
Sbjct: 75  FYRGI 79


>AY051574-1|AAK92998.1|  339|Drosophila melanogaster GH22160p
           protein.
          Length = 339

 Score = 33.9 bits (74), Expect = 0.22
 Identities = 12/24 (50%), Positives = 19/24 (79%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           + G+ +C  KI++S+G+ GLYRGF
Sbjct: 76  YKGMVDCAMKIYRSEGVPGLYRGF 99


>AE014297-3625|AAF56335.1|  339|Drosophila melanogaster CG5805-PA
           protein.
          Length = 339

 Score = 33.9 bits (74), Expect = 0.22
 Identities = 12/24 (50%), Positives = 19/24 (79%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           + G+ +C  KI++S+G+ GLYRGF
Sbjct: 76  YKGMVDCAMKIYRSEGVPGLYRGF 99


>AM294744-1|CAL26730.1|  299|Drosophila melanogaster CG3476 protein.
          Length = 299

 Score = 33.5 bits (73), Expect = 0.30
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL-- 254
           K F+AGG+    +     P++ +K+ LQ            RYKG++D   R  + +G   
Sbjct: 16  KSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPLP-GQPPRYKGVIDCAARTFRYEGFRG 74

Query: 255 FHSGV 269
           F+ G+
Sbjct: 75  FYRGI 79


>AY069712-1|AAL39857.1|  332|Drosophila melanogaster LP01207p
           protein.
          Length = 332

 Score = 32.7 bits (71), Expect = 0.52
 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 8/63 (12%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIE--RVKLLLQVQHVSKQIAAD------QRYKGIVDAFVRIPKE 245
           LAGG+SAA++++   P++  +++  LQV+ + K  A +       +Y  I  A   I +E
Sbjct: 33  LAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYRE 92

Query: 246 QGL 254
           +G+
Sbjct: 93  EGM 95


>AE014297-1229|AAF54576.2|  332|Drosophila melanogaster CG6608-PB,
           isoform B protein.
          Length = 332

 Score = 32.7 bits (71), Expect = 0.52
 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 8/63 (12%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIE--RVKLLLQVQHVSKQIAAD------QRYKGIVDAFVRIPKE 245
           LAGG+SAA++++   P++  +++  LQV+ + K  A +       +Y  I  A   I +E
Sbjct: 33  LAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYRE 92

Query: 246 QGL 254
           +G+
Sbjct: 93  EGM 95


>AE014297-1228|AAF54575.1|  332|Drosophila melanogaster CG6608-PA,
           isoform A protein.
          Length = 332

 Score = 32.7 bits (71), Expect = 0.52
 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 8/63 (12%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIE--RVKLLLQVQHVSKQIAAD------QRYKGIVDAFVRIPKE 245
           LAGG+SAA++++   P++  +++  LQV+ + K  A +       +Y  I  A   I +E
Sbjct: 33  LAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYRE 92

Query: 246 QGL 254
           +G+
Sbjct: 93  EGM 95


>AY060454-1|AAL25493.1|  199|Drosophila melanogaster SD01736p
           protein.
          Length = 199

 Score = 32.3 bits (70), Expect = 0.68
 Identities = 10/24 (41%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           + GL +C +KI++++G+ G+Y+GF
Sbjct: 141 YKGLVDCFTKIWRTEGIHGMYKGF 164


>AE013599-1834|AAF58286.2|  199|Drosophila melanogaster CG18324-PA,
           isoform A protein.
          Length = 199

 Score = 32.3 bits (70), Expect = 0.68
 Identities = 10/24 (41%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           + GL +C +KI++++G+ G+Y+GF
Sbjct: 141 YKGLVDCFTKIWRTEGIHGMYKGF 164


>AE013599-1833|AAM70987.1|  307|Drosophila melanogaster CG18324-PB,
           isoform B protein.
          Length = 307

 Score = 32.3 bits (70), Expect = 0.68
 Identities = 10/24 (41%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           + GL +C +KI++++G+ G+Y+GF
Sbjct: 249 YKGLVDCFTKIWRTEGIHGMYKGF 272


>AF221715-1|AAF34661.1| 5554|Drosophila melanogaster split ends long
            isoform protein.
          Length = 5554

 Score = 31.9 bits (69), Expect = 0.90
 Identities = 20/74 (27%), Positives = 31/74 (41%)
 Frame = -1

Query: 515  ENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGTPAC 336
            E    H P R + R+ +      + S  +  R HH   + +R +   +++      TP  
Sbjct: 2273 EELQSHQPKREKEREHFSSHANSSSSRHKSKRDHHHHREKKRHSVAESTNTDEEH-TPQQ 2331

Query: 335  TCP*RRS*APGSGS 294
              P RR  A GSGS
Sbjct: 2332 HNPHRRISAAGSGS 2345


>AF188205-1|AAF13218.1| 5533|Drosophila melanogaster Spen RNP motif
            protein long isoformprotein.
          Length = 5533

 Score = 31.9 bits (69), Expect = 0.90
 Identities = 20/74 (27%), Positives = 31/74 (41%)
 Frame = -1

Query: 515  ENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGTPAC 336
            E    H P R + R+ +      + S  +  R HH   + +R +   +++      TP  
Sbjct: 2279 EELQSHQPKREKEREHFSSHANSSSSRHKSKRDHHHHREKKRHSVAESTNTDEEH-TPQQ 2337

Query: 335  TCP*RRS*APGSGS 294
              P RR  A GSGS
Sbjct: 2338 HNPHRRISAAGSGS 2351


>AF184612-1|AAF26299.1| 5476|Drosophila melanogaster split ends
            protein.
          Length = 5476

 Score = 31.9 bits (69), Expect = 0.90
 Identities = 20/74 (27%), Positives = 31/74 (41%)
 Frame = -1

Query: 515  ENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGTPAC 336
            E    H P R + R+ +      + S  +  R HH   + +R +   +++      TP  
Sbjct: 2222 EELQSHQPKREKEREHFSSHANSSSSRHKSKRDHHHHREKKRHSVAESTNTDEEH-TPQQ 2280

Query: 335  TCP*RRS*APGSGS 294
              P RR  A GSGS
Sbjct: 2281 HNPHRRISAAGSGS 2294


>AE014134-58|AAN10511.1| 5476|Drosophila melanogaster CG18497-PC,
            isoform C protein.
          Length = 5476

 Score = 31.9 bits (69), Expect = 0.90
 Identities = 20/74 (27%), Positives = 31/74 (41%)
 Frame = -1

Query: 515  ENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGTPAC 336
            E    H P R + R+ +      + S  +  R HH   + +R +   +++      TP  
Sbjct: 2222 EELQSHQPKREKEREHFSSHANSSSSRHKSKRDHHHHREKKRHSVAESTNTDEEH-TPQQ 2280

Query: 335  TCP*RRS*APGSGS 294
              P RR  A GSGS
Sbjct: 2281 HNPHRRISAAGSGS 2294


>AE014134-57|AAF51534.2| 5533|Drosophila melanogaster CG18497-PB,
            isoform B protein.
          Length = 5533

 Score = 31.9 bits (69), Expect = 0.90
 Identities = 20/74 (27%), Positives = 31/74 (41%)
 Frame = -1

Query: 515  ENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGTPAC 336
            E    H P R + R+ +      + S  +  R HH   + +R +   +++      TP  
Sbjct: 2279 EELQSHQPKREKEREHFSSHANSSSSRHKSKRDHHHHREKKRHSVAESTNTDEEH-TPQQ 2337

Query: 335  TCP*RRS*APGSGS 294
              P RR  A GSGS
Sbjct: 2338 HNPHRRISAAGSGS 2351


>AE014134-56|AAF51535.2| 5560|Drosophila melanogaster CG18497-PA,
            isoform A protein.
          Length = 5560

 Score = 31.9 bits (69), Expect = 0.90
 Identities = 20/74 (27%), Positives = 31/74 (41%)
 Frame = -1

Query: 515  ENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGTPAC 336
            E    H P R + R+ +      + S  +  R HH   + +R +   +++      TP  
Sbjct: 2279 EELQSHQPKREKEREHFSSHANSSSSRHKSKRDHHHHREKKRHSVAESTNTDEEH-TPQQ 2337

Query: 335  TCP*RRS*APGSGS 294
              P RR  A GSGS
Sbjct: 2338 HNPHRRISAAGSGS 2351


>AY075266-1|AAL68133.1|  300|Drosophila melanogaster AT23224p
           protein.
          Length = 300

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 18/56 (32%), Positives = 30/56 (53%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           FLAGG+S  +      P++ VK  +Q+Q  +     +  Y   +DA V+I + +GL
Sbjct: 17  FLAGGLSGFIEIICFHPLDVVKTRMQIQG-AHPFGGEVVYTCPLDAIVKIYRYEGL 71


>AE014134-1600|AAF52742.1|  300|Drosophila melanogaster CG9582-PA
           protein.
          Length = 300

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 18/56 (32%), Positives = 30/56 (53%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           FLAGG+S  +      P++ VK  +Q+Q  +     +  Y   +DA V+I + +GL
Sbjct: 17  FLAGGLSGFIEIICFHPLDVVKTRMQIQG-AHPFGGEVVYTCPLDAIVKIYRYEGL 71


>AY089410-1|AAL90148.1|  287|Drosophila melanogaster AT23463p
           protein.
          Length = 287

 Score = 31.1 bits (67), Expect = 1.6
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGI 215
           GG+ AA++ T   PI+ +K+ LQ Q  + + +  +  KGI
Sbjct: 15  GGVCAAIAVTGTHPIDLIKVQLQTQSQADRKSVGEILKGI 54


>AL132792-2|CAB60031.1|  306|Drosophila melanogaster EG:BACR19J1.2
           protein.
          Length = 306

 Score = 31.1 bits (67), Expect = 1.6
 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 3/58 (5%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAA---DQRYKGIVDAFVRIPKEQGL 254
           LAGG +  +    + P++ VK  +Q+Q      AA   +  Y G+ D F ++ + +G+
Sbjct: 19  LAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGI 76


>AE014298-100|AAF45544.1|  306|Drosophila melanogaster CG5254-PA
           protein.
          Length = 306

 Score = 31.1 bits (67), Expect = 1.6
 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 3/58 (5%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAA---DQRYKGIVDAFVRIPKEQGL 254
           LAGG +  +    + P++ VK  +Q+Q      AA   +  Y G+ D F ++ + +G+
Sbjct: 19  LAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGI 76


>AE013599-565|AAF59153.1|  287|Drosophila melanogaster CG11196-PA
           protein.
          Length = 287

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 14/40 (35%), Positives = 23/40 (57%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGI 215
           GG+ AA++ T   PI+ +K+ LQ Q  + +    +  KGI
Sbjct: 15  GGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKGI 54


>BT024341-1|ABC86403.1|  302|Drosophila melanogaster IP09652p
           protein.
          Length = 302

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 18/80 (22%), Positives = 36/80 (45%)
 Frame = +3

Query: 12  HIHLVKIT*SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIA 191
           +IH +      KM  + D  ++    + G ++ A       P + + + +Q   + +   
Sbjct: 88  NIHFIVYDTGKKMEYV-DRDSYLGKIILGCVAGACGSAFGIPTDLINVRMQTD-MKEPPY 145

Query: 192 ADQRYKGIVDAFVRIPKEQG 251
             + YK + D  +RIPKE+G
Sbjct: 146 KRRNYKHVFDGLIRIPKEEG 165


>AE014297-2793|AAN13828.1|  304|Drosophila melanogaster CG4323-PB,
           isoform B protein.
          Length = 304

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 26/78 (33%), Positives = 34/78 (43%), Gaps = 1/78 (1%)
 Frame = +3

Query: 42  NKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVD 221
           ++M  L  P       LA  IS+ V+ T   PI+ VK         +  AA   Y G+ D
Sbjct: 190 SQMIKLGMPDYMGTYILASMISSVVATTLTQPIDVVK-------TRRMNAAPGEYSGLGD 242

Query: 222 AFVRIPKEQGL-FHSGVV 272
            FV+  KE  L F  G V
Sbjct: 243 VFVKTSKEGPLAFFKGYV 260


>AE014297-2792|AAF55767.2|  304|Drosophila melanogaster CG4323-PA,
           isoform A protein.
          Length = 304

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 26/78 (33%), Positives = 34/78 (43%), Gaps = 1/78 (1%)
 Frame = +3

Query: 42  NKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVD 221
           ++M  L  P       LA  IS+ V+ T   PI+ VK         +  AA   Y G+ D
Sbjct: 190 SQMIKLGMPDYMGTYILASMISSVVATTLTQPIDVVK-------TRRMNAAPGEYSGLGD 242

Query: 222 AFVRIPKEQGL-FHSGVV 272
            FV+  KE  L F  G V
Sbjct: 243 VFVKTSKEGPLAFFKGYV 260


>AE014296-3049|AAF49238.1|  302|Drosophila melanogaster CG18363-PA
           protein.
          Length = 302

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 18/80 (22%), Positives = 36/80 (45%)
 Frame = +3

Query: 12  HIHLVKIT*SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIA 191
           +IH +      KM  + D  ++    + G ++ A       P + + + +Q   + +   
Sbjct: 88  NIHFIVYDTGKKMEYV-DRDSYLGKIILGCVAGACGSAFGIPTDLINVRMQTD-MKEPPY 145

Query: 192 ADQRYKGIVDAFVRIPKEQG 251
             + YK + D  +RIPKE+G
Sbjct: 146 KRRNYKHVFDGLIRIPKEEG 165


>AE014297-1416|AAN13538.2|  240|Drosophila melanogaster CG12201-PA,
           isoform A protein.
          Length = 240

 Score = 29.9 bits (64), Expect = 3.6
 Identities = 20/70 (28%), Positives = 33/70 (47%)
 Frame = +3

Query: 45  KMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDA 224
           + S+ +    F    +AG +S   S   V P + VK  LQ          ++++KGI+D 
Sbjct: 136 RKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQAD-------GEKKFKGIMDC 188

Query: 225 FVRIPKEQGL 254
             R  KE+G+
Sbjct: 189 VNRTLKEEGI 198


>AE014297-1415|AAF54726.2|  319|Drosophila melanogaster CG12201-PB,
           isoform B protein.
          Length = 319

 Score = 29.9 bits (64), Expect = 3.6
 Identities = 20/70 (28%), Positives = 33/70 (47%)
 Frame = +3

Query: 45  KMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDA 224
           + S+ +    F    +AG +S   S   V P + VK  LQ          ++++KGI+D 
Sbjct: 215 RKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQAD-------GEKKFKGIMDC 267

Query: 225 FVRIPKEQGL 254
             R  KE+G+
Sbjct: 268 VNRTLKEEGI 277


>BT023505-1|AAY84905.1| 1231|Drosophila melanogaster LD15018p
           protein.
          Length = 1231

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 13/38 (34%), Positives = 18/38 (47%)
 Frame = -1

Query: 458 SRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGT 345
           +RG TRS  R +R   R P + R   R      + RG+
Sbjct: 477 NRGSTRSRSRSMRHRSRSPAHYRGRGRGREPASKERGS 514


>AY094704-1|AAM11057.1|  311|Drosophila melanogaster GH11346p
           protein.
          Length = 311

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 1/34 (2%)
 Frame = +3

Query: 156 LLQVQHVSKQIAADQR-YKGIVDAFVRIPKEQGL 254
           L+++   ++ I  D+R YK + DAFVRI K++G+
Sbjct: 136 LIRMMSDNRLIPEDRRNYKNVGDAFVRIVKDEGV 169


>AY060332-1|AAL25371.1|  304|Drosophila melanogaster GH22139p
           protein.
          Length = 304

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 10/24 (41%), Positives = 18/24 (75%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           + G+ + + +I+K +G+ GLYRGF
Sbjct: 162 YRGMIHALGQIYKEEGIRGLYRGF 185


>AE014298-1282|AAF46448.3| 1231|Drosophila melanogaster CG7065-PA
           protein.
          Length = 1231

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 13/38 (34%), Positives = 18/38 (47%)
 Frame = -1

Query: 458 SRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGT 345
           +RG TRS  R +R   R P + R   R      + RG+
Sbjct: 477 NRGSTRSRSRSMRHRSRSPAHYRGRGRGREPASKERGS 514


>AE013599-822|AAM68821.1|  304|Drosophila melanogaster CG8026-PB,
           isoform B protein.
          Length = 304

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 10/24 (41%), Positives = 18/24 (75%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           + G+ + + +I+K +G+ GLYRGF
Sbjct: 162 YRGMIHALGQIYKEEGIRGLYRGF 185


>AE013599-821|AAF58969.1|  360|Drosophila melanogaster CG8026-PA,
           isoform A protein.
          Length = 360

 Score = 29.5 bits (63), Expect = 4.8
 Identities = 10/24 (41%), Positives = 18/24 (75%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           + G+ + + +I+K +G+ GLYRGF
Sbjct: 162 YRGMIHALGQIYKEEGIRGLYRGF 185


>BT022883-1|AAY55299.1|  199|Drosophila melanogaster IP07463p
           protein.
          Length = 199

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 14/67 (20%), Positives = 28/67 (41%)
 Frame = +3

Query: 51  SNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFV 230
           ++L DP       L   ++  V+     P+E +   +QV     +      Y+ + D   
Sbjct: 2   TSLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPK-ETRWNYRNVFDGLY 60

Query: 231 RIPKEQG 251
           R+ +E+G
Sbjct: 61  RVTREEG 67


>AE014296-3048|AAF49239.1|  190|Drosophila melanogaster CG6893-PA
           protein.
          Length = 190

 Score = 28.7 bits (61), Expect = 8.4
 Identities = 14/66 (21%), Positives = 27/66 (40%)
 Frame = +3

Query: 54  NLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVR 233
           +L DP       L   ++  V+     P+E +   +QV     +      Y+ + D   R
Sbjct: 12  HLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPK-ETRWNYRNVFDGLYR 70

Query: 234 IPKEQG 251
           + +E+G
Sbjct: 71  VTREEG 76


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,042,321
Number of Sequences: 53049
Number of extensions: 563201
Number of successful extensions: 2752
Number of sequences better than 10.0: 84
Number of HSP's better than 10.0 without gapping: 2285
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2705
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3211306956
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -