SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20005
         (763 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

D84347-1|BAA21711.1|  207|Drosophila melanogaster rab8 protein.       166   3e-41
AY069671-1|AAL39816.1|  207|Drosophila melanogaster LD44762p pro...   166   3e-41
AE014296-3237|AAF49101.1|  207|Drosophila melanogaster CG8287-PA...   166   3e-41
AB112933-1|BAD07038.1|  207|Drosophila melanogaster Rab8 protein.     166   3e-41
AY060425-1|AAL25464.1|  204|Drosophila melanogaster LD39986p pro...   134   9e-32
AE014298-3000|AAF50924.1|  204|Drosophila melanogaster CG17060-P...   134   9e-32
AB006189-1|BAA21744.1|  204|Drosophila melanogaster Rab10 protein.    134   9e-32
AY094795-1|AAM11148.1|  201|Drosophila melanogaster LD21953p pro...   125   8e-29
AE014298-2969|AAF45371.1|  201|Drosophila melanogaster CG9575-PA...   125   8e-29
D84312-1|BAA21705.1|  205|Drosophila melanogaster rab1 protein.       123   2e-28
AE014297-2966|AAN13857.1|  146|Drosophila melanogaster CG3320-PB...   123   2e-28
AE014297-2965|AAF55873.1|  205|Drosophila melanogaster CG3320-PA...   123   2e-28
M64621-1|AAA28843.1|  220|Drosophila melanogaster rab3 protein.       113   3e-25
AY060449-1|AAL25488.1|  220|Drosophila melanogaster LP05860p pro...   113   3e-25
AE013599-1159|AAF58762.1|  220|Drosophila melanogaster CG7576-PA...   113   3e-25
AB112932-1|BAD07037.1|  220|Drosophila melanogaster Rab3 protein.     113   3e-25
D84315-1|BAA21708.1|  214|Drosophila melanogaster rab11 protein.      104   2e-22
BT001785-1|AAN71540.1|  214|Drosophila melanogaster RH21315p pro...   104   2e-22
AY113404-1|AAM29409.1|  214|Drosophila melanogaster RE11886p pro...   104   2e-22
AY070528-1|AAL47999.1|  214|Drosophila melanogaster GM06568p pro...   104   2e-22
AE014297-2931|AAN13849.1|  214|Drosophila melanogaster CG5771-PB...   104   2e-22
AE014297-2930|AAF55850.1|  214|Drosophila melanogaster CG5771-PA...   104   2e-22
AB035354-1|BAA87880.1|  214|Drosophila melanogaster Drab11 protein.   104   2e-22
AE014297-3639|AAF56345.2|  213|Drosophila melanogaster CG31118-P...   101   8e-22
BT022967-1|AAY55383.1|  132|Drosophila melanogaster IP11168p pro...    97   2e-20
BT023110-1|AAY55526.1|  410|Drosophila melanogaster IP08719p pro...    96   5e-20
BT023070-1|AAY55486.1|  433|Drosophila melanogaster IP08619p pro...    96   5e-20
AY071080-1|AAL48702.1|  223|Drosophila melanogaster RE14786p pro...    95   1e-19
AE014134-1221|AAN10613.1|  223|Drosophila melanogaster CG9100-PC...    95   1e-19
AE014134-1220|AAN10612.1|  223|Drosophila melanogaster CG9100-PB...    95   1e-19
AE014134-1219|AAF52477.1|  223|Drosophila melanogaster CG9100-PA...    95   1e-19
D84348-1|BAA21712.1|  219|Drosophila melanogaster rab-related pr...    93   4e-19
AY071400-1|AAL49022.1|  219|Drosophila melanogaster RE48347p pro...    93   4e-19
AE014296-1412|AAF50452.1|  219|Drosophila melanogaster CG7062-PA...    93   4e-19
BT024998-1|ABE01228.1|  214|Drosophila melanogaster IP08727p pro...    92   7e-19
AY752532-1|AAW31988.1|  174|Drosophila melanogaster CG2532 protein.    92   7e-19
AY752531-1|AAW31987.1|  174|Drosophila melanogaster CG2532 protein.    92   7e-19
AY752530-1|AAW31986.1|  174|Drosophila melanogaster CG2532 protein.    92   7e-19
AY752528-1|AAW31984.1|  146|Drosophila melanogaster CG2532 protein.    92   7e-19
AY752527-1|AAW31983.1|  174|Drosophila melanogaster CG2532 protein.    92   7e-19
AY752526-1|AAW31982.1|  174|Drosophila melanogaster CG2532 protein.    92   7e-19
AY752525-1|AAW31981.1|  174|Drosophila melanogaster CG2532 protein.    92   7e-19
AY752524-1|AAW31980.1|  174|Drosophila melanogaster CG2532 protein.    92   7e-19
AE014298-1531|AAN09277.1|  214|Drosophila melanogaster CG32670-P...    92   7e-19
AE013599-2512|AAS64815.1|  213|Drosophila melanogaster CG4921-PC...    92   9e-19
AE013599-2511|AAM68480.1|  213|Drosophila melanogaster CG4921-PB...    92   9e-19
AE013599-2510|AAF57831.1|  213|Drosophila melanogaster CG4921-PA...    92   9e-19
AB035670-1|BAA88243.1|  213|Drosophila melanogaster Rab4 protein...    92   9e-19
D84316-1|BAA21709.1|  215|Drosophila melanogaster rab14 protein.       91   2e-18
AY069563-1|AAL39708.1|  215|Drosophila melanogaster LD29476p pro...    91   2e-18
AE014134-2489|AAF53390.1|  215|Drosophila melanogaster CG4212-PA...    91   2e-18
AE014134-2488|AAO41194.1|  233|Drosophila melanogaster CG4212-PC...    91   2e-18
AE014134-2487|AAO41193.1|  239|Drosophila melanogaster CG4212-PB...    91   2e-18
AY752529-1|AAW31985.1|  174|Drosophila melanogaster CG2532 protein.    89   5e-18
AY752523-1|AAW31979.1|  174|Drosophila melanogaster CG2532 protein.    89   5e-18
BT003609-1|AAO39612.1|  230|Drosophila melanogaster GH17339p pro...    89   8e-18
AY060977-1|AAL28525.1|  230|Drosophila melanogaster GM10914p pro...    89   8e-18
AE014298-220|AAF45634.2|  230|Drosophila melanogaster CG14791-PC...    89   8e-18
AB112931-1|BAD07036.1|  230|Drosophila melanogaster Rab27 protein.     89   8e-18
D84313-1|BAA21706.1|  213|Drosophila melanogaster rab2 protein.        88   1e-17
BT003315-1|AAO25075.1|  213|Drosophila melanogaster GH01619p pro...    88   1e-17
AE013599-209|AAM70817.1|  213|Drosophila melanogaster CG3269-PA ...    88   1e-17
AB035352-1|BAA87878.1|  213|Drosophila melanogaster Drab2 protein.     88   1e-17
AY061826-1|AAL27637.1|  388|Drosophila melanogaster GH21984p pro...    86   4e-17
AE014296-3519|AAF51708.2|  388|Drosophila melanogaster CG7605-PA...    86   4e-17
D84314-1|BAA21707.1|  208|Drosophila melanogaster rab6 protein.        83   5e-16
AY752542-1|AAW31998.1|  195|Drosophila melanogaster CG2885 protein.    83   5e-16
AY752539-1|AAW31995.1|  195|Drosophila melanogaster CG2885 protein.    83   5e-16
AY752538-1|AAW31994.1|  195|Drosophila melanogaster CG2885 protein.    83   5e-16
AY752537-1|AAW31993.1|  195|Drosophila melanogaster CG2885 protein.    83   5e-16
AY752536-1|AAW31992.1|  195|Drosophila melanogaster CG2885 protein.    83   5e-16
AY752535-1|AAW31991.1|  195|Drosophila melanogaster CG2885 protein.    83   5e-16
AY752534-1|AAW31990.1|  195|Drosophila melanogaster CG2885 protein.    83   5e-16
AY752533-1|AAW31989.1|  195|Drosophila melanogaster CG2885 protein.    83   5e-16
AY060261-1|AAL25300.1|  208|Drosophila melanogaster GH09086p pro...    83   5e-16
AE014298-1452|AAF46585.1|  195|Drosophila melanogaster CG2885-PA...    83   5e-16
AE014134-2164|AAF53168.1|  208|Drosophila melanogaster CG6601-PA...    83   5e-16
AY752540-1|AAW31996.1|  195|Drosophila melanogaster CG2885 protein.    82   9e-16
AL031027-5|CAA19844.2|  236|Drosophila melanogaster EG:80H7.4 pr...    81   2e-15
AE014298-219|AAF45635.1|  236|Drosophila melanogaster CG14791-PB...    81   2e-15
AY071340-1|AAL48962.1|  218|Drosophila melanogaster RE37651p pro...    80   3e-15
AE014298-1056|AAF46271.1|  218|Drosophila melanogaster CG12156-P...    80   3e-15
D84317-1|BAA21710.1|  197|Drosophila melanogaster rab-related pr...    79   9e-15
AY075329-1|AAL68196.1|  197|Drosophila melanogaster GH11193p pro...    78   1e-14
AE014298-769|AAF46057.1|  197|Drosophila melanogaster CG3129-PA ...    78   1e-14
AY061365-1|AAL28913.1|  147|Drosophila melanogaster LD28840p pro...    76   5e-14
AY119634-1|AAM50288.1|  222|Drosophila melanogaster RE42508p pro...    76   6e-14
AY061218-1|AAL28766.1|  252|Drosophila melanogaster LD16331p pro...    76   6e-14
AE014298-3236|EAA46056.1|  189|Drosophila melanogaster CG17515-P...    76   6e-14
AE014298-3235|EAA46055.2|  273|Drosophila melanogaster CG17515-P...    76   6e-14
AE014298-1768|AAF48164.2|  255|Drosophila melanogaster CG1900-PA...    76   6e-14
AY113574-1|AAM29579.1|  268|Drosophila melanogaster RH23273p pro...    75   8e-14
AE014297-330|AAF51970.1|  268|Drosophila melanogaster CG2108-PA ...    75   8e-14
BT023374-1|AAY55790.1|  358|Drosophila melanogaster IP10363p pro...    75   1e-13
BT023330-1|AAY55746.1|  191|Drosophila melanogaster IP10163p pro...    75   1e-13
BT023274-1|AAY55690.1|  205|Drosophila melanogaster IP10063p pro...    75   1e-13
AY071139-1|AAL48761.1|  256|Drosophila melanogaster RE17845p pro...    75   1e-13
AE014296-330|AAF47546.1|  305|Drosophila melanogaster CG7980-PA ...    75   1e-13
AE014134-3093|AAF53798.1|  256|Drosophila melanogaster CG9994-PA...    75   1e-13
AY121695-1|AAM52022.1|  101|Drosophila melanogaster RE66843p pro...    74   2e-13
AY752541-1|AAW31997.1|  185|Drosophila melanogaster CG2885 protein.    73   3e-13
AY081181-1|AAN85553.1|  219|Drosophila melanogaster Rab5 protein.      71   1e-12
AY081180-1|AAN85552.1|  219|Drosophila melanogaster Rab5 protein.      71   1e-12
AY060343-1|AAL25382.1|  219|Drosophila melanogaster GH24702p pro...    71   1e-12
AE014134-396|AAN10426.1|  219|Drosophila melanogaster CG3664-PF,...    71   1e-12
AE014134-395|AAN10425.1|  219|Drosophila melanogaster CG3664-PE,...    71   1e-12
AE014134-394|AAN10424.1|  219|Drosophila melanogaster CG3664-PD,...    71   1e-12
AE014134-393|AAN10423.1|  219|Drosophila melanogaster CG3664-PC,...    71   1e-12
AE014134-392|AAN10422.1|  219|Drosophila melanogaster CG3664-PB,...    71   1e-12
AE014134-391|AAF51265.1|  219|Drosophila melanogaster CG3664-PA,...    71   1e-12
AB035671-1|BAA88244.1|  219|Drosophila melanogaster Rab5 protein...    71   1e-12
AB035353-1|BAA87879.1|  219|Drosophila melanogaster Drab5 protein.     71   1e-12
BT001448-1|AAN71203.1|  306|Drosophila melanogaster GH26660p pro...    71   2e-12
AY069328-1|AAL39473.1|  388|Drosophila melanogaster LD04613p pro...    71   2e-12
AE013599-820|AAF58970.1|  686|Drosophila melanogaster CG8024-PB,...    71   2e-12
AE013599-819|AAG22295.2|  385|Drosophila melanogaster CG8024-PA,...    71   2e-12
AE013599-818|AAM68818.1|  388|Drosophila melanogaster CG8024-PE,...    71   2e-12
AE013599-817|AAM68817.1|  388|Drosophila melanogaster CG8024-PC,...    71   2e-12
AE013599-816|AAM68816.2|  222|Drosophila melanogaster CG8024-PD,...    71   2e-12
AB035646-1|BAA88238.1|  231|Drosophila melanogaster Rab-related ...    71   2e-12
BT003196-1|AAO24951.1|  222|Drosophila melanogaster RE56408p pro...    69   5e-12
AY060236-1|AAL25275.1|  207|Drosophila melanogaster GH03685p pro...    69   5e-12
AM294833-1|CAL26819.1|  207|Drosophila melanogaster CG5915 protein.    69   5e-12
AM294832-1|CAL26818.1|  207|Drosophila melanogaster CG5915 protein.    69   5e-12
AM294831-1|CAL26817.1|  207|Drosophila melanogaster CG5915 protein.    69   5e-12
AM294830-1|CAL26816.1|  207|Drosophila melanogaster CG5915 protein.    69   5e-12
AM294829-1|CAL26815.1|  207|Drosophila melanogaster CG5915 protein.    69   5e-12
AM294828-1|CAL26814.1|  207|Drosophila melanogaster CG5915 protein.    69   5e-12
AM294827-1|CAL26813.1|  207|Drosophila melanogaster CG5915 protein.    69   5e-12
AM294826-1|CAL26812.1|  207|Drosophila melanogaster CG5915 protein.    69   5e-12
AM294825-1|CAL26811.1|  207|Drosophila melanogaster CG5915 protein.    69   5e-12
AM294824-1|CAL26810.1|  207|Drosophila melanogaster CG5915 protein.    69   5e-12
AM294823-1|CAL26809.1|  207|Drosophila melanogaster CG5915 protein.    69   5e-12
AF263363-1|AAF73041.1|  207|Drosophila melanogaster small ras-li...    69   5e-12
AF079459-1|AAC32270.1|  207|Drosophila melanogaster small ras-li...    69   5e-12
AE014297-3431|AAF56218.1|  207|Drosophila melanogaster CG5915-PA...    69   5e-12
AB035672-1|BAA88245.1|  207|Drosophila melanogaster Rab7 protein...    69   5e-12
AE014298-1530|AAF47981.2|  197|Drosophila melanogaster CG32671-P...    69   7e-12
AE014298-1475|AAF46610.2|  197|Drosophila melanogaster CG9807-PA...    69   7e-12
BT015987-1|AAV36872.1|  265|Drosophila melanogaster RE54550p pro...    69   9e-12
AE014298-1769|AAN09309.1|  265|Drosophila melanogaster CG1900-PB...    69   9e-12
AY752522-1|AAW31978.1|  160|Drosophila melanogaster CG2532 protein.    68   1e-11
AY752521-1|AAW31977.1|  160|Drosophila melanogaster CG2532 protein.    68   1e-11
AY752520-1|AAW31976.1|  160|Drosophila melanogaster CG2532 protein.    68   1e-11
AY752519-1|AAW31975.1|  160|Drosophila melanogaster CG2532 protein.    68   1e-11
AY752518-1|AAW31974.1|  160|Drosophila melanogaster CG2532 protein.    68   1e-11
AY752517-1|AAW31973.1|  160|Drosophila melanogaster CG2532 protein.    68   1e-11
AY752516-1|AAW31972.1|  160|Drosophila melanogaster CG2532 protein.    68   1e-11
AY752515-1|AAW31971.1|  160|Drosophila melanogaster CG2532 protein.    68   1e-11
AY752514-1|AAW31970.1|  160|Drosophila melanogaster CG2532 protein.    68   1e-11
AY752513-1|AAW31969.1|  160|Drosophila melanogaster CG2532 protein.    68   1e-11
AE014298-1478|AAN09264.1|  197|Drosophila melanogaster CG32673-P...    68   1e-11
AE014298-1469|AAN09263.1|  197|Drosophila melanogaster CG32678-P...    68   1e-11
M80535-1|AAA28845.1|  184|Drosophila melanogaster GTP-binding pr...    66   5e-11
DQ138746-1|ABA86352.1|  171|Drosophila melanogaster CG1956 protein.    66   5e-11
AY121688-1|AAM52015.1|  184|Drosophila melanogaster RE42418p pro...    66   5e-11
AF186654-1|AAF15520.1|  184|Drosophila melanogaster roughened pr...    66   5e-11
AE014296-375|AAF47583.1|  184|Drosophila melanogaster CG1956-PA ...    66   5e-11
AY122200-1|AAM52712.1|  261|Drosophila melanogaster LD47384p pro...    64   2e-10
AF209706-1|AAF21440.1|  261|Drosophila melanogaster Rab-related ...    64   2e-10
AE013599-3617|AAF47018.1|  261|Drosophila melanogaster CG3870-PA...    64   2e-10
AY071647-1|AAL49269.1|  213|Drosophila melanogaster RE70650p pro...    62   6e-10
AE014296-128|AAF47406.1|  213|Drosophila melanogaster CG12015-PA...    62   6e-10
M16429-1|AAA28847.1|  189|Drosophila melanogaster protein ( D.me...    61   2e-09
AY094888-1|AAM11241.1|  189|Drosophila melanogaster RE53955p pro...    61   2e-09
AY089541-1|AAL90279.1|  189|Drosophila melanogaster LD17536p pro...    61   2e-09
AF186648-1|AAF15514.1|  189|Drosophila melanogaster Ras1 protein.      61   2e-09
AE014297-953|AAF54388.1|  189|Drosophila melanogaster CG9375-PA ...    61   2e-09
K01960-1|AAA28846.1|  189|Drosophila melanogaster protein ( D.me...    60   2e-09
BT029985-1|ABM92859.1|  207|Drosophila melanogaster RE30129p pro...    60   3e-09
AE014296-1145|AAF50649.2|  207|Drosophila melanogaster CG8519-PA...    60   3e-09
L38311-1|AAA67042.1|  192|Drosophila melanogaster Rho1 protein.        60   4e-09
BT012453-1|AAS93724.1|  182|Drosophila melanogaster RE63021p pro...    60   4e-09
BT010085-1|AAQ22554.1|  192|Drosophila melanogaster LD03419p pro...    60   4e-09
AY119536-1|AAM50190.1|  192|Drosophila melanogaster GH20776p pro...    60   4e-09
AF177874-1|AAF01186.1|  192|Drosophila melanogaster small GTPase...    60   4e-09
AF177873-1|AAF01185.1|  192|Drosophila melanogaster small GTPase...    60   4e-09
AF177872-1|AAF01184.1|  192|Drosophila melanogaster small GTPase...    60   4e-09
AF177871-1|AAF01183.1|  192|Drosophila melanogaster small GTPase...    60   4e-09
AF111427-1|AAC98693.1|  182|Drosophila melanogaster Ras-related ...    60   4e-09
AE013599-3799|AAF47155.1|  182|Drosophila melanogaster CG3204-PA...    60   4e-09
AE013599-2180|AAS64844.1|  192|Drosophila melanogaster CG8416-PG...    60   4e-09
AE013599-2179|AAS64843.1|  192|Drosophila melanogaster CG8416-PF...    60   4e-09
AE013599-2178|AAS64842.1|  192|Drosophila melanogaster CG8416-PE...    60   4e-09
AE013599-2177|AAM70946.1|  192|Drosophila melanogaster CG8416-PD...    60   4e-09
AE013599-2176|AAM70945.1|  192|Drosophila melanogaster CG8416-PC...    60   4e-09
AE013599-2175|AAF58066.1|  192|Drosophila melanogaster CG8416-PB...    60   4e-09
AE013599-2174|AAM70944.1|  192|Drosophila melanogaster CG8416-PA...    60   4e-09
AY070523-1|AAL47994.1|  217|Drosophila melanogaster GH25818p pro...    59   6e-09
AE014296-2503|AAF49642.1|  217|Drosophila melanogaster CG7815-PA...    59   6e-09
U15967-3|AAB60243.1|  192|Drosophila melanogaster small GTP bind...    58   2e-08
M16431-1|AAA28849.1|  195|Drosophila melanogaster protein ( D.me...    58   2e-08
M10804-1|AAA99202.1|  195|Drosophila melanogaster ras protein pr...    58   2e-08
AY119135-1|AAM50995.1|  192|Drosophila melanogaster RE36103p pro...    58   2e-08
AF186651-1|AAF15517.1|  165|Drosophila melanogaster TC21 ras-rel...    58   2e-08
AE014296-774|AAF47845.2|  192|Drosophila melanogaster CG1167-PA ...    58   2e-08
AY094697-1|AAM11050.1|  182|Drosophila melanogaster GH10361p pro...    57   2e-08
AE014297-281|AAF52005.3|  182|Drosophila melanogaster CG1081-PB,...    57   2e-08
AE014297-280|AAF52004.3|  182|Drosophila melanogaster CG1081-PA,...    57   2e-08
K01962-1|AAA28848.1|  187|Drosophila melanogaster protein ( D.me...    56   4e-08
BT003574-1|AAO39578.1|  216|Drosophila melanogaster LD40852p pro...    55   9e-08
AY070533-1|AAL48004.1|  216|Drosophila melanogaster GM14354p pro...    55   9e-08
AY061398-1|AAL28946.1|  216|Drosophila melanogaster LD32416p pro...    55   9e-08
AF233584-1|AAF60289.1|  216|Drosophila melanogaster Ran10A protein.    55   9e-08
AF220950-1|AAF30287.1|  216|Drosophila melanogaster GTP-binding ...    55   9e-08
AE014298-1568|AAN09287.1|  216|Drosophila melanogaster CG1404-PB...    55   9e-08
AE014298-1567|AAF48008.1|  216|Drosophila melanogaster CG1404-PA...    55   9e-08
X02200-1|CAA26131.1|  182|Drosophila melanogaster protein ( Dros...    54   2e-07
Y07564-1|CAA68849.1|  264|Drosophila melanogaster RIC (Ras which...    54   3e-07
BT024201-1|ABC86263.1|  283|Drosophila melanogaster RE46661p pro...    54   3e-07
AE014297-1044|AAF54453.1|  233|Drosophila melanogaster CG8500-PA...    54   3e-07
AE013599-2181|AAF58065.1|  264|Drosophila melanogaster CG8418-PA...    54   3e-07
U23800-1|AAC34902.1|  201|Drosophila melanogaster ral protein.         51   2e-06
AY118912-1|AAM50772.1|  201|Drosophila melanogaster LD21679p pro...    51   2e-06
AY024366-1|AAK00587.1|  197|Drosophila melanogaster RAL2 protein.      51   2e-06
AE014298-551|AAF45890.1|  201|Drosophila melanogaster CG2849-PC,...    51   2e-06
AE014298-550|AAF45889.1|  201|Drosophila melanogaster CG2849-PA,...    51   2e-06
AE014298-549|AAN09102.1|  197|Drosophila melanogaster CG2849-PB,...    51   2e-06
Z35643-1|CAA84710.1|  192|Drosophila melanogaster RacB protein.        50   3e-06
Z35642-1|CAA84709.1|  192|Drosophila melanogaster RacA protein.        50   3e-06
U11823-1|AAA62870.1|  192|Drosophila melanogaster Drac1 protein.       50   3e-06
L38310-1|AAA67041.1|  192|Drosophila melanogaster Rac2 protein.        50   3e-06
L38309-1|AAA67040.1|  192|Drosophila melanogaster Rac1 protein.        50   3e-06
AY118845-1|AAM50705.1|  192|Drosophila melanogaster GM13874p pro...    50   3e-06
AY060408-1|AAL25447.1|  192|Drosophila melanogaster LD34217p pro...    50   3e-06
AE014296-1260|AAF50559.1|  192|Drosophila melanogaster CG8556-PA...    50   3e-06
AE014296-217|AAF47469.1|  192|Drosophila melanogaster CG2248-PA ...    50   3e-06
AY118519-1|AAM49888.1|  104|Drosophila melanogaster LD16736p pro...    49   8e-06
BT011477-1|AAR99135.1|  740|Drosophila melanogaster RE10036p pro...    47   2e-05
AE013599-2719|AAM68464.1|  210|Drosophila melanogaster CG15069-P...    47   2e-05
AE013599-2718|AAF57675.3|  740|Drosophila melanogaster CG15069-P...    47   2e-05
U50314-1|AAB05666.1|  190|Drosophila melanogaster RhoL protein.        47   3e-05
AY069811-1|AAL39956.1|  190|Drosophila melanogaster SD05212p pro...    47   3e-05
AE014297-950|AAF54385.1|  190|Drosophila melanogaster CG9366-PA ...    47   3e-05
AB035355-1|BAA87881.1|  190|Drosophila melanogaster Drac3 protein.     47   3e-05
AY113279-1|AAM29284.1|  195|Drosophila melanogaster AT17867p pro...    46   4e-05
AJ413188-1|CAC88352.1|  195|Drosophila melanogaster small GTPase...    46   4e-05
AF238044-1|AAF44665.1|  195|Drosophila melanogaster Mig-2-like G...    46   4e-05
AE014297-4152|AAN14120.1|  195|Drosophila melanogaster CG5588-PC...    46   4e-05
AE014297-4151|AAF56727.1|  195|Drosophila melanogaster CG5588-PB...    46   4e-05
AE014297-4150|AAF56728.1|  195|Drosophila melanogaster CG5588-PA...    46   4e-05
AY118407-1|AAM48436.1|  282|Drosophila melanogaster RE62293p pro...    45   1e-04
AL050231-7|CAB43324.1|  306|Drosophila melanogaster EG:BACR37P7....    44   2e-04
AF153428-1|AAD43792.1|  191|Drosophila melanogaster CDC42 protei...    44   2e-04
AE014298-18|AAF45493.2|  306|Drosophila melanogaster CG13375-PA ...    44   2e-04
U11824-1|AAA62871.1|  191|Drosophila melanogaster Dcdc42 protein.      44   2e-04
AY119570-1|AAM50224.1|  191|Drosophila melanogaster HL08128p pro...    44   2e-04
AF153429-1|AAD43793.1|  191|Drosophila melanogaster CDC42 protei...    44   2e-04
AF153427-1|AAD43791.1|  191|Drosophila melanogaster CDC42 protei...    44   2e-04
AF153426-1|AAD43790.1|  191|Drosophila melanogaster CDC42 protei...    44   2e-04
AF153425-1|AAD43789.1|  191|Drosophila melanogaster CDC42 protei...    44   2e-04
AF153423-1|AAD43787.1|  191|Drosophila melanogaster CDC42 protei...    44   2e-04
AE014298-2918|AAN09512.1|  191|Drosophila melanogaster CG12530-P...    44   2e-04
AE014298-2917|AAF49007.1|  191|Drosophila melanogaster CG12530-P...    44   2e-04
BT010242-1|AAQ23560.1|  498|Drosophila melanogaster RE48016p pro...    43   4e-04
AE013599-2858|AAF57577.1|  537|Drosophila melanogaster CG9811-PA...    43   4e-04
AE013599-257|AAF57410.3|  280|Drosophila melanogaster CG30158-PA...    43   4e-04
BT023048-1|AAY55464.1|  216|Drosophila melanogaster IP04009p pro...    43   5e-04
BT023013-1|AAY55429.1|  216|Drosophila melanogaster IP04109p pro...    43   5e-04
BT022972-1|AAY55388.1|  216|Drosophila melanogaster IP04209p pro...    43   5e-04
AE014298-1411|ABI30973.1|  582|Drosophila melanogaster CG34104-P...    43   5e-04
L25064-1|AAA53668.1|  175|Drosophila melanogaster ADP ribosylati...    42   7e-04
L25063-1|AAA28378.1|  175|Drosophila melanogaster ADP ribosylati...    42   7e-04
AY071116-1|AAL48738.1|  175|Drosophila melanogaster RE16882p pro...    42   0.001
AE013599-2044|AAM68535.1|  175|Drosophila melanogaster CG8156-PE...    42   0.001
AE013599-2043|AAM68534.1|  175|Drosophila melanogaster CG8156-PD...    42   0.001
AE013599-2042|AAM68533.1|  175|Drosophila melanogaster CG8156-PC...    42   0.001
AE013599-2041|AAM68532.1|  175|Drosophila melanogaster CG8156-PB...    42   0.001
AE013599-2040|AAF58148.1|  175|Drosophila melanogaster CG8156-PA...    42   0.001
AF153424-1|AAD43788.1|  191|Drosophila melanogaster CDC42 protei...    41   0.002
S62079-1|AAB27066.1|  182|Drosophila melanogaster ADP-ribosylati...    41   0.002
M61127-1|AAA28365.1|  180|Drosophila melanogaster GTP-binding pr...    41   0.002
L14923-1|AAA74629.1|  184|Drosophila melanogaster GTP-binding pr...    41   0.002
BT011133-1|AAR82800.1|  780|Drosophila melanogaster HL01056p pro...    41   0.002
BT001460-1|AAN71215.1|  180|Drosophila melanogaster GM20805p pro...    41   0.002
AY122142-1|AAM52654.1|  682|Drosophila melanogaster HL02867p pro...    41   0.002
AY060375-1|AAL25414.1|  182|Drosophila melanogaster LD24904p pro...    41   0.002
AE014298-576|ABC67173.1|  682|Drosophila melanogaster CG32776-PC...    41   0.002
AE014298-575|AAF45905.3|  682|Drosophila melanogaster CG32776-PA...    41   0.002
AE014298-574|ABC67172.1| 1059|Drosophila melanogaster CG32776-PD...    41   0.002
AE014298-573|AAS72338.2| 1058|Drosophila melanogaster CG32776-PB...    41   0.002
AE014297-742|AAF54228.1|  184|Drosophila melanogaster CG7435-PA ...    41   0.002
AE014296-3733|AAF51872.1|  182|Drosophila melanogaster CG8385-PE...    41   0.002
AE014296-3732|AAN12207.1|  182|Drosophila melanogaster CG8385-PD...    41   0.002
AE014296-3731|AAF51873.1|  182|Drosophila melanogaster CG8385-PC...    41   0.002
AE014296-3730|AAF51874.1|  182|Drosophila melanogaster CG8385-PB...    41   0.002
AE014296-3729|AAF51871.1|  182|Drosophila melanogaster CG8385-PA...    41   0.002
AE014296-2610|AAF49556.2|  180|Drosophila melanogaster CG6025-PA...    41   0.002
AY129454-1|AAM76196.1|  280|Drosophila melanogaster RE28276p pro...    40   0.003
AY058480-1|AAL13709.1|  184|Drosophila melanogaster GM01555p pro...    40   0.003
L25062-1|AAA53667.1|  180|Drosophila melanogaster ADP ribosylati...    40   0.005
AY113302-1|AAM29307.1|  312|Drosophila melanogaster AT26185p pro...    40   0.005
AY071450-1|AAL49072.1|  180|Drosophila melanogaster RE53354p pro...    40   0.005
AE014135-196|AAF59383.1|  180|Drosophila melanogaster CG11027-PA...    40   0.005
AE014135-31|AAF59368.2|  312|Drosophila melanogaster CG2219-PA p...    40   0.005
BT016011-1|AAV36896.1|  652|Drosophila melanogaster RE22983p pro...    38   0.011
AY058555-1|AAL13784.1|  345|Drosophila melanogaster LD24810p pro...    38   0.011
AE014297-3439|AAN13972.1|  673|Drosophila melanogaster CG5410-PE...    38   0.011
AE014297-3438|AAN13971.1|  652|Drosophila melanogaster CG5410-PD...    38   0.011
AY070906-1|AAL48528.1|  179|Drosophila melanogaster RE02160p pro...    38   0.020
AE014297-3070|AAF55936.2|  179|Drosophila melanogaster CG6560-PA...    38   0.020
AY094809-1|AAM11162.1|  186|Drosophila melanogaster LD29185p pro...    36   0.080
AE014297-699|AAF54194.1|  186|Drosophila melanogaster CG7891-PA ...    36   0.080
AB185208-1|BAD30092.1|  186|Drosophila melanogaster novel small ...    36   0.080
AY060482-1|AAL25521.1|  111|Drosophila melanogaster SD07888p pro...    28   0.083
BT024347-1|ABC86409.1|  258|Drosophila melanogaster IP09454p pro...    34   0.18 
AY071187-1|AAL48809.1|  328|Drosophila melanogaster RE23556p pro...    34   0.24 
AE014134-1267|AAF52508.1|  328|Drosophila melanogaster CG5160-PA...    34   0.24 
DQ138656-1|ABA86262.1|  166|Drosophila melanogaster CG7197 protein.    33   0.56 
AY095045-1|AAM11373.1|  179|Drosophila melanogaster LD31204p pro...    33   0.56 
AE014296-1413|AAF50451.1|  179|Drosophila melanogaster CG7197-PA...    33   0.56 
AY075502-1|AAL68311.1|  431|Drosophila melanogaster RE52190p pro...    32   0.74 
AE014298-1412|AAF46555.2|  431|Drosophila melanogaster CG34104-P...    32   0.74 
AY070945-1|AAL48567.1|  274|Drosophila melanogaster RE04047p pro...    31   1.3  
AY061235-1|AAL28783.1|  200|Drosophila melanogaster LD17730p pro...    31   1.3  
AE014298-2483|AAF48668.2|  274|Drosophila melanogaster CG4789-PA...    31   1.3  
AE014298-1275|AAF46445.2|  200|Drosophila melanogaster CG7039-PA...    31   1.3  
U28966-1|AAB52512.1|  419|Drosophila melanogaster septin protein.      30   3.0  
AY061281-1|AAL28829.1|  419|Drosophila melanogaster LD20082p pro...    30   3.0  
AE014297-2823|AAF55783.1|  419|Drosophila melanogaster CG4173-PA...    30   3.0  
AE014298-1447|AAN09260.1| 1506|Drosophila melanogaster CG32681-P...    30   4.0  
AY121666-1|AAM51993.1| 1561|Drosophila melanogaster RE10888p pro...    29   6.9  
AF387518-1|AAL01872.1| 1564|Drosophila melanogaster Rho-GTPase a...    29   6.9  
AE014298-2594|AAN09591.1| 1561|Drosophila melanogaster CG32555-P...    29   6.9  
AE014298-2593|AAF48748.2| 1561|Drosophila melanogaster CG32555-P...    29   6.9  
AE014298-2592|AAF48749.2| 1561|Drosophila melanogaster CG32555-P...    29   6.9  

>D84347-1|BAA21711.1|  207|Drosophila melanogaster rab8 protein.
          Length = 207

 Score =  166 bits (403), Expect = 3e-41
 Identities = 100/212 (47%), Positives = 129/212 (60%), Gaps = 3/212 (1%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAKTYD LFKLLLIGDSGVGKT ILFRFSEDAFN +FISTIGIDFKIRTI+LD KK+KLQ
Sbjct: 1   MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQ 60

Query: 203 IWDTAGQERFRTITTAYSVVLWELCLSTMLRMRRALKTLRIGLGTLKRMPVLMLRK*YLE 382
           IWDTAGQERFRTITTAY      + L   +   ++ + ++  +  ++      + K  L 
Sbjct: 61  IWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLG 120

Query: 383 ISVT*ILKDRYQRSEVNN*P*NIR*NLWRHQQKTR*MLNMHFHF---SQGLKAKMEKKQE 553
                 L D+ Q S+       I   +   +   +  +N+   F   +  +KAK EK+ E
Sbjct: 121 NKCE--LTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRME 178

Query: 554 ASNPSGGRSGVHKPTLNDARKPVTWLSRCSVL 649
           A+NP     G H+    D+R   +WLSRCS+L
Sbjct: 179 ANNPP---KGGHQLKPMDSRTKDSWLSRCSLL 207



 Score =  151 bits (365), Expect = 1e-36
 Identities = 71/84 (84%), Positives = 78/84 (92%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGIMLVYD+T EKSFENIKNWIRNIEENASADVEKM+LGNKC+L  +RQVSKERGEQ
Sbjct: 79  RGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQ 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LAIEY IKF+ETSAK S+NVE AF
Sbjct: 139 LAIEYGIKFMETSAKASINVEEAF 162


>AY069671-1|AAL39816.1|  207|Drosophila melanogaster LD44762p
           protein.
          Length = 207

 Score =  166 bits (403), Expect = 3e-41
 Identities = 100/212 (47%), Positives = 129/212 (60%), Gaps = 3/212 (1%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAKTYD LFKLLLIGDSGVGKT ILFRFSEDAFN +FISTIGIDFKIRTI+LD KK+KLQ
Sbjct: 1   MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQ 60

Query: 203 IWDTAGQERFRTITTAYSVVLWELCLSTMLRMRRALKTLRIGLGTLKRMPVLMLRK*YLE 382
           IWDTAGQERFRTITTAY      + L   +   ++ + ++  +  ++      + K  L 
Sbjct: 61  IWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLG 120

Query: 383 ISVT*ILKDRYQRSEVNN*P*NIR*NLWRHQQKTR*MLNMHFHF---SQGLKAKMEKKQE 553
                 L D+ Q S+       I   +   +   +  +N+   F   +  +KAK EK+ E
Sbjct: 121 NKCE--LTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRME 178

Query: 554 ASNPSGGRSGVHKPTLNDARKPVTWLSRCSVL 649
           A+NP     G H+    D+R   +WLSRCS+L
Sbjct: 179 ANNPP---KGGHQLKPMDSRTKDSWLSRCSLL 207



 Score =  151 bits (365), Expect = 1e-36
 Identities = 71/84 (84%), Positives = 78/84 (92%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGIMLVYD+T EKSFENIKNWIRNIEENASADVEKM+LGNKC+L  +RQVSKERGEQ
Sbjct: 79  RGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQ 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LAIEY IKF+ETSAK S+NVE AF
Sbjct: 139 LAIEYGIKFMETSAKASINVEEAF 162


>AE014296-3237|AAF49101.1|  207|Drosophila melanogaster CG8287-PA
           protein.
          Length = 207

 Score =  166 bits (403), Expect = 3e-41
 Identities = 100/212 (47%), Positives = 129/212 (60%), Gaps = 3/212 (1%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAKTYD LFKLLLIGDSGVGKT ILFRFSEDAFN +FISTIGIDFKIRTI+LD KK+KLQ
Sbjct: 1   MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQ 60

Query: 203 IWDTAGQERFRTITTAYSVVLWELCLSTMLRMRRALKTLRIGLGTLKRMPVLMLRK*YLE 382
           IWDTAGQERFRTITTAY      + L   +   ++ + ++  +  ++      + K  L 
Sbjct: 61  IWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLG 120

Query: 383 ISVT*ILKDRYQRSEVNN*P*NIR*NLWRHQQKTR*MLNMHFHF---SQGLKAKMEKKQE 553
                 L D+ Q S+       I   +   +   +  +N+   F   +  +KAK EK+ E
Sbjct: 121 NKCE--LTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRME 178

Query: 554 ASNPSGGRSGVHKPTLNDARKPVTWLSRCSVL 649
           A+NP     G H+    D+R   +WLSRCS+L
Sbjct: 179 ANNPP---KGGHQLKPMDSRTKDSWLSRCSLL 207



 Score =  151 bits (365), Expect = 1e-36
 Identities = 71/84 (84%), Positives = 78/84 (92%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGIMLVYD+T EKSFENIKNWIRNIEENASADVEKM+LGNKC+L  +RQVSKERGEQ
Sbjct: 79  RGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQ 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LAIEY IKF+ETSAK S+NVE AF
Sbjct: 139 LAIEYGIKFMETSAKASINVEEAF 162


>AB112933-1|BAD07038.1|  207|Drosophila melanogaster Rab8 protein.
          Length = 207

 Score =  166 bits (403), Expect = 3e-41
 Identities = 100/212 (47%), Positives = 129/212 (60%), Gaps = 3/212 (1%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MAKTYD LFKLLLIGDSGVGKT ILFRFSEDAFN +FISTIGIDFKIRTI+LD KK+KLQ
Sbjct: 1   MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQ 60

Query: 203 IWDTAGQERFRTITTAYSVVLWELCLSTMLRMRRALKTLRIGLGTLKRMPVLMLRK*YLE 382
           IWDTAGQERFRTITTAY      + L   +   ++ + ++  +  ++      + K  L 
Sbjct: 61  IWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLG 120

Query: 383 ISVT*ILKDRYQRSEVNN*P*NIR*NLWRHQQKTR*MLNMHFHF---SQGLKAKMEKKQE 553
                 L D+ Q S+       I   +   +   +  +N+   F   +  +KAK EK+ E
Sbjct: 121 NKCE--LTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRME 178

Query: 554 ASNPSGGRSGVHKPTLNDARKPVTWLSRCSVL 649
           A+NP     G H+    D+R   +WLSRCS+L
Sbjct: 179 ANNPP---KGGHQLKPMDSRTKDSWLSRCSLL 207



 Score =  151 bits (365), Expect = 1e-36
 Identities = 71/84 (84%), Positives = 78/84 (92%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGIMLVYD+T EKSFENIKNWIRNIEENASADVEKM+LGNKC+L  +RQVSKERGEQ
Sbjct: 79  RGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQ 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LAIEY IKF+ETSAK S+NVE AF
Sbjct: 139 LAIEYGIKFMETSAKASINVEEAF 162


>AY060425-1|AAL25464.1|  204|Drosophila melanogaster LD39986p
           protein.
          Length = 204

 Score =  134 bits (325), Expect = 9e-32
 Identities = 62/75 (82%), Positives = 69/75 (92%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           KTYD LFKLLLIGDSGVGKT ILFRFS+DAF  +FISTIGIDFKI+T++L GKK+KLQIW
Sbjct: 4   KTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIW 63

Query: 209 DTAGQERFRTITTAY 253
           DTAGQERF TITT+Y
Sbjct: 64  DTAGQERFHTITTSY 78



 Score =  129 bits (311), Expect = 5e-30
 Identities = 58/87 (66%), Positives = 74/87 (85%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+MGIMLVYD+TNEKSFENI  W+RNI+E+A+ DVEKMILGNKCD+  +R V+KER
Sbjct: 77  SYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKER 136

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE +A E+ I+F+ETSAK ++N+E AF
Sbjct: 137 GEAIAREHGIRFMETSAKSNINIERAF 163


>AE014298-3000|AAF50924.1|  204|Drosophila melanogaster CG17060-PA
           protein.
          Length = 204

 Score =  134 bits (325), Expect = 9e-32
 Identities = 62/75 (82%), Positives = 69/75 (92%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           KTYD LFKLLLIGDSGVGKT ILFRFS+DAF  +FISTIGIDFKI+T++L GKK+KLQIW
Sbjct: 4   KTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIW 63

Query: 209 DTAGQERFRTITTAY 253
           DTAGQERF TITT+Y
Sbjct: 64  DTAGQERFHTITTSY 78



 Score =  129 bits (311), Expect = 5e-30
 Identities = 58/87 (66%), Positives = 74/87 (85%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+MGIMLVYD+TNEKSFENI  W+RNI+E+A+ DVEKMILGNKCD+  +R V+KER
Sbjct: 77  SYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKER 136

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE +A E+ I+F+ETSAK ++N+E AF
Sbjct: 137 GEAIAREHGIRFMETSAKSNINIERAF 163


>AB006189-1|BAA21744.1|  204|Drosophila melanogaster Rab10 protein.
          Length = 204

 Score =  134 bits (325), Expect = 9e-32
 Identities = 62/75 (82%), Positives = 69/75 (92%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           KTYD LFKLLLIGDSGVGKT ILFRFS+DAF  +FISTIGIDFKI+T++L GKK+KLQIW
Sbjct: 4   KTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIW 63

Query: 209 DTAGQERFRTITTAY 253
           DTAGQERF TITT+Y
Sbjct: 64  DTAGQERFHTITTSY 78



 Score =  129 bits (311), Expect = 5e-30
 Identities = 58/87 (66%), Positives = 74/87 (85%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+MGIMLVYD+TNEKSFENI  W+RNI+E+A+ DVEKMILGNKCD+  +R V+KER
Sbjct: 77  SYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKER 136

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE +A E+ I+F+ETSAK ++N+E AF
Sbjct: 137 GEAIAREHGIRFMETSAKSNINIERAF 163


>AY094795-1|AAM11148.1|  201|Drosophila melanogaster LD21953p
           protein.
          Length = 201

 Score =  125 bits (301), Expect = 8e-29
 Identities = 55/77 (71%), Positives = 70/77 (90%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA+ +D LFKLL+IGDSGVGK+S+L RFS+D F+ S+I+TIG+DFKIRT+D++G +VKLQ
Sbjct: 1   MARGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT+ Y
Sbjct: 61  IWDTAGQERFRTITSTY 77



 Score = 76.2 bits (179), Expect = 5e-14
 Identities = 35/84 (41%), Positives = 56/84 (66%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+ G+++VYDVTN +SF N++ W+  I+ N    V+K+++GNK D   ++ V  E  ++
Sbjct: 79  RGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDV-VKKVLVGNKNDDPDRKVVITEDAQR 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  I+  ETSAKD++NVE  F
Sbjct: 138 FAKQMDIELFETSAKDNINVENMF 161


>AE014298-2969|AAF45371.1|  201|Drosophila melanogaster CG9575-PA
           protein.
          Length = 201

 Score =  125 bits (301), Expect = 8e-29
 Identities = 55/77 (71%), Positives = 70/77 (90%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA+ +D LFKLL+IGDSGVGK+S+L RFS+D F+ S+I+TIG+DFKIRT+D++G +VKLQ
Sbjct: 1   MARGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRTIT+ Y
Sbjct: 61  IWDTAGQERFRTITSTY 77



 Score = 76.2 bits (179), Expect = 5e-14
 Identities = 35/84 (41%), Positives = 56/84 (66%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+ G+++VYDVTN +SF N++ W+  I+ N    V+K+++GNK D   ++ V  E  ++
Sbjct: 79  RGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDV-VKKVLVGNKNDDPDRKVVITEDAQR 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  I+  ETSAKD++NVE  F
Sbjct: 138 FAKQMDIELFETSAKDNINVENMF 161


>D84312-1|BAA21705.1|  205|Drosophila melanogaster rab1 protein.
          Length = 205

 Score =  123 bits (297), Expect = 2e-28
 Identities = 55/73 (75%), Positives = 66/73 (90%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFKLLLIGDSGVGK+ +L RF++D +  S+ISTIG+DFKIRTI+LDGK +KLQIWDT
Sbjct: 8   YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQERFRTIT++Y
Sbjct: 68  AGQERFRTITSSY 80



 Score = 83.8 bits (198), Expect = 2e-16
 Identities = 38/88 (43%), Positives = 58/88 (65%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           +S  RG+ GI++VYD T+++SF N+K W+  IE  A  +V K+++GNK DL +++ V   
Sbjct: 78  SSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHT 137

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
              + A +  I F+ETSAK + NVE AF
Sbjct: 138 TAAEYAAQLGIPFLETSAKSATNVEQAF 165


>AE014297-2966|AAN13857.1|  146|Drosophila melanogaster CG3320-PB,
           isoform B protein.
          Length = 146

 Score =  123 bits (297), Expect = 2e-28
 Identities = 55/73 (75%), Positives = 66/73 (90%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFKLLLIGDSGVGK+ +L RF++D +  S+ISTIG+DFKIRTI+LDGK +KLQIWDT
Sbjct: 8   YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQERFRTIT++Y
Sbjct: 68  AGQERFRTITSSY 80



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 25/57 (43%), Positives = 41/57 (71%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQV 414
           +S  RG+ GI++VYD T+++SF N+K W+  IE  A  +V K+++GNK DL +++ V
Sbjct: 78  SSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVV 134


>AE014297-2965|AAF55873.1|  205|Drosophila melanogaster CG3320-PA,
           isoform A protein.
          Length = 205

 Score =  123 bits (297), Expect = 2e-28
 Identities = 55/73 (75%), Positives = 66/73 (90%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFKLLLIGDSGVGK+ +L RF++D +  S+ISTIG+DFKIRTI+LDGK +KLQIWDT
Sbjct: 8   YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQERFRTIT++Y
Sbjct: 68  AGQERFRTITSSY 80



 Score = 83.8 bits (198), Expect = 2e-16
 Identities = 38/88 (43%), Positives = 58/88 (65%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           +S  RG+ GI++VYD T+++SF N+K W+  IE  A  +V K+++GNK DL +++ V   
Sbjct: 78  SSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHT 137

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
              + A +  I F+ETSAK + NVE AF
Sbjct: 138 TAAEYAAQLGIPFLETSAKSATNVEQAF 165


>M64621-1|AAA28843.1|  220|Drosophila melanogaster rab3 protein.
          Length = 220

 Score =  113 bits (271), Expect = 3e-25
 Identities = 48/75 (64%), Positives = 65/75 (86%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FKLL+IG+S VGKTS LFR+++D+F  +F+ST+GIDFK++T+    K+VKLQIW
Sbjct: 16  QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIW 75

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 76  DTAGQERYRTITTAY 90



 Score = 91.5 bits (217), Expect = 1e-18
 Identities = 38/84 (45%), Positives = 63/84 (75%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YDVTNE SF ++++W+  I+  +  + + +++GNKCD++ QR +S ERG Q
Sbjct: 92  RGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFERGRQ 151

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA +  ++F ETSAK+++NV+  F
Sbjct: 152 LADQLGVEFFETSAKENVNVKAVF 175


>AY060449-1|AAL25488.1|  220|Drosophila melanogaster LP05860p
           protein.
          Length = 220

 Score =  113 bits (271), Expect = 3e-25
 Identities = 48/75 (64%), Positives = 65/75 (86%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FKLL+IG+S VGKTS LFR+++D+F  +F+ST+GIDFK++T+    K+VKLQIW
Sbjct: 16  QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIW 75

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 76  DTAGQERYRTITTAY 90



 Score = 91.5 bits (217), Expect = 1e-18
 Identities = 38/84 (45%), Positives = 63/84 (75%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YDVTNE SF ++++W+  I+  +  + + +++GNKCD++ QR +S ERG Q
Sbjct: 92  RGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFERGRQ 151

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA +  ++F ETSAK+++NV+  F
Sbjct: 152 LADQLGVEFFETSAKENVNVKAVF 175


>AE013599-1159|AAF58762.1|  220|Drosophila melanogaster CG7576-PA
           protein.
          Length = 220

 Score =  113 bits (271), Expect = 3e-25
 Identities = 48/75 (64%), Positives = 65/75 (86%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FKLL+IG+S VGKTS LFR+++D+F  +F+ST+GIDFK++T+    K+VKLQIW
Sbjct: 16  QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIW 75

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 76  DTAGQERYRTITTAY 90



 Score = 91.5 bits (217), Expect = 1e-18
 Identities = 38/84 (45%), Positives = 63/84 (75%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YDVTNE SF ++++W+  I+  +  + + +++GNKCD++ QR +S ERG Q
Sbjct: 92  RGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFERGRQ 151

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA +  ++F ETSAK+++NV+  F
Sbjct: 152 LADQLGVEFFETSAKENVNVKAVF 175


>AB112932-1|BAD07037.1|  220|Drosophila melanogaster Rab3 protein.
          Length = 220

 Score =  113 bits (271), Expect = 3e-25
 Identities = 48/75 (64%), Positives = 65/75 (86%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FKLL+IG+S VGKTS LFR+++D+F  +F+ST+GIDFK++T+    K+VKLQIW
Sbjct: 16  QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIW 75

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 76  DTAGQERYRTITTAY 90



 Score = 91.5 bits (217), Expect = 1e-18
 Identities = 38/84 (45%), Positives = 63/84 (75%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +L+YDVTNE SF ++++W+  I+  +  + + +++GNKCD++ QR +S ERG Q
Sbjct: 92  RGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFERGRQ 151

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA +  ++F ETSAK+++NV+  F
Sbjct: 152 LADQLGVEFFETSAKENVNVKAVF 175


>D84315-1|BAA21708.1|  214|Drosophila melanogaster rab11 protein.
          Length = 214

 Score =  104 bits (249), Expect = 2e-22
 Identities = 45/73 (61%), Positives = 61/73 (83%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I++DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 76.2 bits (179), Expect = 5e-14
 Identities = 33/84 (39%), Positives = 53/84 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W+R + ++A  ++  M++GNK DL   R V  +  + 
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTDEAKL 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A    + F+ETSA DS NVE AF
Sbjct: 142 FAERNGLSFIETSALDSTNVETAF 165


>BT001785-1|AAN71540.1|  214|Drosophila melanogaster RH21315p
           protein.
          Length = 214

 Score =  104 bits (249), Expect = 2e-22
 Identities = 45/73 (61%), Positives = 61/73 (83%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I++DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESNSTIGVEFATRSIEVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 76.2 bits (179), Expect = 5e-14
 Identities = 33/84 (39%), Positives = 53/84 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W+R + ++A  ++  M++GNK DL   R V  +  + 
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTDEAKL 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A    + F+ETSA DS NVE AF
Sbjct: 142 FAERNGLSFIETSALDSTNVETAF 165


>AY113404-1|AAM29409.1|  214|Drosophila melanogaster RE11886p
           protein.
          Length = 214

 Score =  104 bits (249), Expect = 2e-22
 Identities = 45/73 (61%), Positives = 61/73 (83%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I++DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 76.2 bits (179), Expect = 5e-14
 Identities = 33/84 (39%), Positives = 53/84 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W+R + ++A  ++  M++GNK DL   R V  +  + 
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTDEAKL 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A    + F+ETSA DS NVE AF
Sbjct: 142 FAERNGLSFIETSALDSTNVETAF 165


>AY070528-1|AAL47999.1|  214|Drosophila melanogaster GM06568p
           protein.
          Length = 214

 Score =  104 bits (249), Expect = 2e-22
 Identities = 45/73 (61%), Positives = 61/73 (83%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I++DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 76.2 bits (179), Expect = 5e-14
 Identities = 33/84 (39%), Positives = 53/84 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W+R + ++A  ++  M++GNK DL   R V  +  + 
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTDEAKL 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A    + F+ETSA DS NVE AF
Sbjct: 142 FAERNGLSFIETSALDSTNVETAF 165


>AE014297-2931|AAN13849.1|  214|Drosophila melanogaster CG5771-PB,
           isoform B protein.
          Length = 214

 Score =  104 bits (249), Expect = 2e-22
 Identities = 45/73 (61%), Positives = 61/73 (83%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I++DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 76.2 bits (179), Expect = 5e-14
 Identities = 33/84 (39%), Positives = 53/84 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W+R + ++A  ++  M++GNK DL   R V  +  + 
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTDEAKL 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A    + F+ETSA DS NVE AF
Sbjct: 142 FAERNGLSFIETSALDSTNVETAF 165


>AE014297-2930|AAF55850.1|  214|Drosophila melanogaster CG5771-PA,
           isoform A protein.
          Length = 214

 Score =  104 bits (249), Expect = 2e-22
 Identities = 45/73 (61%), Positives = 61/73 (83%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I++DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 76.2 bits (179), Expect = 5e-14
 Identities = 33/84 (39%), Positives = 53/84 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W+R + ++A  ++  M++GNK DL   R V  +  + 
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTDEAKL 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A    + F+ETSA DS NVE AF
Sbjct: 142 FAERNGLSFIETSALDSTNVETAF 165


>AB035354-1|BAA87880.1|  214|Drosophila melanogaster Drab11 protein.
          Length = 214

 Score =  104 bits (249), Expect = 2e-22
 Identities = 45/73 (61%), Positives = 61/73 (83%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I++DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 68  AGQERYRAITSAY 80



 Score = 76.2 bits (179), Expect = 5e-14
 Identities = 33/84 (39%), Positives = 53/84 (63%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W+R + ++A  ++  M++GNK DL   R V  +  + 
Sbjct: 82  RGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTDEAKL 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A    + F+ETSA DS NVE AF
Sbjct: 142 FAERNGLSFIETSALDSTNVETAF 165


>AE014297-3639|AAF56345.2|  213|Drosophila melanogaster CG31118-PA
           protein.
          Length = 213

 Score =  101 bits (243), Expect = 8e-22
 Identities = 45/85 (52%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLD-SQRQVSKERGE 432
           RG+MGI+L+YDVTN +S+ N+  W+RNI+ENAS DV K++ GNKC+   +QR V KERGE
Sbjct: 79  RGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKERGE 138

Query: 433 QLAIEYQIKFVETSAKDSLNVEYAF 507
           ++A  + + F E S K ++N+E AF
Sbjct: 139 KIAENFDMPFFEVSCKSNINIEDAF 163



 Score =  100 bits (239), Expect = 2e-21
 Identities = 45/77 (58%), Positives = 61/77 (79%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           MA  +   +K+L++GDS VGKT I+ R+ ++ +  ++ISTIGIDFK + I+LDG  +KLQ
Sbjct: 1   MALDFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRT+TTAY
Sbjct: 61  IWDTAGQERFRTLTTAY 77


>BT022967-1|AAY55383.1|  132|Drosophila melanogaster IP11168p
           protein.
          Length = 132

 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 43/82 (52%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = +1

Query: 265 MGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLD-SQRQVSKERGEQLA 441
           MGI+L+YDVTN +S+ N+  W+RNI+ENAS DV K++ GNKC+   +QR V KERGE++A
Sbjct: 1   MGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKERGEKIA 60

Query: 442 IEYQIKFVETSAKDSLNVEYAF 507
             + + F E S K ++N+E AF
Sbjct: 61  ENFDMPFFEVSCKSNINIEDAF 82


>BT023110-1|AAY55526.1|  410|Drosophila melanogaster IP08719p
           protein.
          Length = 410

 Score = 95.9 bits (228), Expect = 5e-20
 Identities = 47/104 (45%), Positives = 70/104 (67%), Gaps = 1/104 (0%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNIS-FISTIGIDFKIRTIDLDGKKVKLQIWD 211
           +D + K++++GDSGVGKTS+L RF +  +  S F+ST+GIDF+ + + +DG +VKLQIWD
Sbjct: 209 FDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWD 268

Query: 212 TAGQERFRTITTAYSVVLWELCLSTMLRMRRALKTLRIGLGTLK 343
           TAGQERFR++T AY      L L   +  +     +R  LG ++
Sbjct: 269 TAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIR 312



 Score = 86.2 bits (204), Expect = 4e-17
 Identities = 42/102 (41%), Positives = 64/102 (62%), Gaps = 1/102 (0%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLD-SQRQVSKERGE 432
           R +  ++L+YDVTN+ +++NI+ W+  I E A  DV  +++GNK D   S+RQV +E GE
Sbjct: 284 RDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVKREDGE 343

Query: 433 QLAIEYQIKFVETSAKDSLNVEYAFSL*PGTKSENGKETGSE 558
           +L  E+ + F+ETSAK  LNVE +F+         G E G +
Sbjct: 344 RLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDD 385


>BT023070-1|AAY55486.1|  433|Drosophila melanogaster IP08619p
           protein.
          Length = 433

 Score = 95.9 bits (228), Expect = 5e-20
 Identities = 47/104 (45%), Positives = 70/104 (67%), Gaps = 1/104 (0%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNIS-FISTIGIDFKIRTIDLDGKKVKLQIWD 211
           +D + K++++GDSGVGKTS+L RF +  +  S F+ST+GIDF+ + + +DG +VKLQIWD
Sbjct: 232 FDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWD 291

Query: 212 TAGQERFRTITTAYSVVLWELCLSTMLRMRRALKTLRIGLGTLK 343
           TAGQERFR++T AY      L L   +  +     +R  LG ++
Sbjct: 292 TAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIR 335



 Score = 86.2 bits (204), Expect = 4e-17
 Identities = 42/102 (41%), Positives = 64/102 (62%), Gaps = 1/102 (0%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLD-SQRQVSKERGE 432
           R +  ++L+YDVTN+ +++NI+ W+  I E A  DV  +++GNK D   S+RQV +E GE
Sbjct: 307 RDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVKREDGE 366

Query: 433 QLAIEYQIKFVETSAKDSLNVEYAFSL*PGTKSENGKETGSE 558
           +L  E+ + F+ETSAK  LNVE +F+         G E G +
Sbjct: 367 RLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDD 408


>AY071080-1|AAL48702.1|  223|Drosophila melanogaster RE14786p
           protein.
          Length = 223

 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 40/73 (54%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  LFK++L+G++GVGKT ++ RF++  F     +TIG+DF I+T++++G+K+KLQIWDT
Sbjct: 4   YKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDT 63

Query: 215 AGQERFRTITTAY 253
           AGQERFR+IT +Y
Sbjct: 64  AGQERFRSITQSY 76



 Score = 72.1 bits (169), Expect = 8e-13
 Identities = 33/87 (37%), Positives = 60/87 (68%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  R +  ++LVYD++ + +F+ + +W+R I+E A++ V K+++GNK D D  R++  + 
Sbjct: 75  SYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTDRD-DREIPTQI 133

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A ++ + F+ETSAK++ NVE  F
Sbjct: 134 GEEFAKQHDMYFLETSAKEAENVERLF 160


>AE014134-1221|AAN10613.1|  223|Drosophila melanogaster CG9100-PC,
           isoform C protein.
          Length = 223

 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 40/73 (54%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  LFK++L+G++GVGKT ++ RF++  F     +TIG+DF I+T++++G+K+KLQIWDT
Sbjct: 4   YKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDT 63

Query: 215 AGQERFRTITTAY 253
           AGQERFR+IT +Y
Sbjct: 64  AGQERFRSITQSY 76



 Score = 72.1 bits (169), Expect = 8e-13
 Identities = 33/87 (37%), Positives = 60/87 (68%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  R +  ++LVYD++ + +F+ + +W+R I+E A++ V K+++GNK D D  R++  + 
Sbjct: 75  SYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTDRD-DREIPTQI 133

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A ++ + F+ETSAK++ NVE  F
Sbjct: 134 GEEFAKQHDMYFLETSAKEAENVERLF 160


>AE014134-1220|AAN10612.1|  223|Drosophila melanogaster CG9100-PB,
           isoform B protein.
          Length = 223

 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 40/73 (54%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  LFK++L+G++GVGKT ++ RF++  F     +TIG+DF I+T++++G+K+KLQIWDT
Sbjct: 4   YKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDT 63

Query: 215 AGQERFRTITTAY 253
           AGQERFR+IT +Y
Sbjct: 64  AGQERFRSITQSY 76



 Score = 72.1 bits (169), Expect = 8e-13
 Identities = 33/87 (37%), Positives = 60/87 (68%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  R +  ++LVYD++ + +F+ + +W+R I+E A++ V K+++GNK D D  R++  + 
Sbjct: 75  SYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTDRD-DREIPTQI 133

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A ++ + F+ETSAK++ NVE  F
Sbjct: 134 GEEFAKQHDMYFLETSAKEAENVERLF 160


>AE014134-1219|AAF52477.1|  223|Drosophila melanogaster CG9100-PA,
           isoform A protein.
          Length = 223

 Score = 94.7 bits (225), Expect = 1e-19
 Identities = 40/73 (54%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  LFK++L+G++GVGKT ++ RF++  F     +TIG+DF I+T++++G+K+KLQIWDT
Sbjct: 4   YKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDT 63

Query: 215 AGQERFRTITTAY 253
           AGQERFR+IT +Y
Sbjct: 64  AGQERFRSITQSY 76



 Score = 72.1 bits (169), Expect = 8e-13
 Identities = 33/87 (37%), Positives = 60/87 (68%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  R +  ++LVYD++ + +F+ + +W+R I+E A++ V K+++GNK D D  R++  + 
Sbjct: 75  SYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTDRD-DREIPTQI 133

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A ++ + F+ETSAK++ NVE  F
Sbjct: 134 GEEFAKQHDMYFLETSAKEAENVERLF 160


>D84348-1|BAA21712.1|  219|Drosophila melanogaster rab-related
           protein 3 protein.
          Length = 219

 Score = 93.1 bits (221), Expect = 4e-19
 Identities = 42/73 (57%), Positives = 56/73 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           +D LFK++LIGD G GKT I+ RF    +     +TIG+DF ++TI ++GK++KLQIWDT
Sbjct: 18  FDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDT 77

Query: 215 AGQERFRTITTAY 253
           AGQERFRTIT +Y
Sbjct: 78  AGQERFRTITQSY 90



 Score = 78.6 bits (185), Expect = 9e-15
 Identities = 38/90 (42%), Positives = 60/90 (66%), Gaps = 3/90 (3%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  R + G+++VYD+T   SF N++ WI  +    +++V  +++GNKCDL+ QR+V  E 
Sbjct: 89  SYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQREVDFEE 148

Query: 427 GEQLAIEY--QIKFV-ETSAKDSLNVEYAF 507
             Q+  +Y  +I FV ETSAK+++NVE AF
Sbjct: 149 ARQMC-QYIPEILFVMETSAKENMNVEDAF 177


>AY071400-1|AAL49022.1|  219|Drosophila melanogaster RE48347p
           protein.
          Length = 219

 Score = 93.1 bits (221), Expect = 4e-19
 Identities = 42/73 (57%), Positives = 56/73 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           +D LFK++LIGD G GKT I+ RF    +     +TIG+DF ++TI ++GK++KLQIWDT
Sbjct: 18  FDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDT 77

Query: 215 AGQERFRTITTAY 253
           AGQERFRTIT +Y
Sbjct: 78  AGQERFRTITQSY 90



 Score = 78.6 bits (185), Expect = 9e-15
 Identities = 38/90 (42%), Positives = 60/90 (66%), Gaps = 3/90 (3%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  R + G+++VYD+T   SF N++ WI  +    +++V  +++GNKCDL+ QR+V  E 
Sbjct: 89  SYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQREVDFEE 148

Query: 427 GEQLAIEY--QIKFV-ETSAKDSLNVEYAF 507
             Q+  +Y  +I FV ETSAK+++NVE AF
Sbjct: 149 ARQMC-QYIPEILFVMETSAKENMNVEDAF 177


>AE014296-1412|AAF50452.1|  219|Drosophila melanogaster CG7062-PA
           protein.
          Length = 219

 Score = 93.1 bits (221), Expect = 4e-19
 Identities = 42/73 (57%), Positives = 56/73 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           +D LFK++LIGD G GKT I+ RF    +     +TIG+DF ++TI ++GK++KLQIWDT
Sbjct: 18  FDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDT 77

Query: 215 AGQERFRTITTAY 253
           AGQERFRTIT +Y
Sbjct: 78  AGQERFRTITQSY 90



 Score = 78.6 bits (185), Expect = 9e-15
 Identities = 38/90 (42%), Positives = 60/90 (66%), Gaps = 3/90 (3%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  R + G+++VYD+T   SF N++ WI  +    +++V  +++GNKCDL+ QR+V  E 
Sbjct: 89  SYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQREVDFEE 148

Query: 427 GEQLAIEY--QIKFV-ETSAKDSLNVEYAF 507
             Q+  +Y  +I FV ETSAK+++NVE AF
Sbjct: 149 ARQMC-QYIPEILFVMETSAKENMNVEDAF 177


>BT024998-1|ABE01228.1|  214|Drosophila melanogaster IP08727p
           protein.
          Length = 214

 Score = 92.3 bits (219), Expect = 7e-19
 Identities = 37/73 (50%), Positives = 56/73 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK+L++GD GVGK+ +L RFS++ F    + T+G+DF++R ++L G+ V LQIWDT
Sbjct: 4   YDYLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDT 63

Query: 215 AGQERFRTITTAY 253
           AG ERF+++  +Y
Sbjct: 64  AGDERFKSLLPSY 76



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 39/89 (43%), Positives = 52/89 (58%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+T+ KSF NI  W++ I   +S  V  M++GNKCD    RQV  E+
Sbjct: 75  SYYRGAHGILLVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLDNRQVRMEQ 134

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
           G   A    + F E SAK   NV   F++
Sbjct: 135 GFNYANHRALGFYEVSAKSGANVNDVFNM 163


>AY752532-1|AAW31988.1|  174|Drosophila melanogaster CG2532 protein.
          Length = 174

 Score = 92.3 bits (219), Expect = 7e-19
 Identities = 37/73 (50%), Positives = 56/73 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK+L++GD GVGK+ +L RFS++ F    + T+G+DF++R ++L G+ V LQIWDT
Sbjct: 4   YDYLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDT 63

Query: 215 AGQERFRTITTAY 253
           AG ERF+++  +Y
Sbjct: 64  AGDERFKSLLPSY 76



 Score = 80.6 bits (190), Expect = 2e-15
 Identities = 39/89 (43%), Positives = 53/89 (59%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+T+ KSF NI  W++ I   +S +V  M++GNKCD    RQV  E+
Sbjct: 75  SYYRGAHGILLVYDITSSKSFRNIDGWLKEIRRMSSENVNVMLVGNKCDDLDNRQVRMEQ 134

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
           G   A    + F E SAK   NV   F++
Sbjct: 135 GFNYANHRALGFYEVSAKSGANVNDVFNM 163


>AY752531-1|AAW31987.1|  174|Drosophila melanogaster CG2532 protein.
          Length = 174

 Score = 92.3 bits (219), Expect = 7e-19
 Identities = 37/73 (50%), Positives = 56/73 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK+L++GD GVGK+ +L RFS++ F    + T+G+DF++R ++L G+ V LQIWDT
Sbjct: 4   YDYLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDT 63

Query: 215 AGQERFRTITTAY 253
           AG ERF+++  +Y
Sbjct: 64  AGDERFKSLLPSY 76



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 39/89 (43%), Positives = 52/89 (58%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+T+ KSF NI  W++ I   +S  V  M++GNKCD    RQV  E+
Sbjct: 75  SYYRGAHGILLVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLDNRQVRMEQ 134

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
           G   A    + F E SAK   NV   F++
Sbjct: 135 GFNYANHRALGFYEVSAKSGANVNDVFNM 163


>AY752530-1|AAW31986.1|  174|Drosophila melanogaster CG2532 protein.
          Length = 174

 Score = 92.3 bits (219), Expect = 7e-19
 Identities = 37/73 (50%), Positives = 56/73 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK+L++GD GVGK+ +L RFS++ F    + T+G+DF++R ++L G+ V LQIWDT
Sbjct: 4   YDYLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDT 63

Query: 215 AGQERFRTITTAY 253
           AG ERF+++  +Y
Sbjct: 64  AGDERFKSLLPSY 76



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 39/89 (43%), Positives = 52/89 (58%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+T+ KSF NI  W++ I   +S  V  M++GNKCD    RQV  E+
Sbjct: 75  SYYRGAHGILLVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLDNRQVRMEQ 134

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
           G   A    + F E SAK   NV   F++
Sbjct: 135 GFNYANHRALGFYEVSAKSGANVNDVFNM 163


>AY752528-1|AAW31984.1|  146|Drosophila melanogaster CG2532 protein.
          Length = 146

 Score = 92.3 bits (219), Expect = 7e-19
 Identities = 37/73 (50%), Positives = 56/73 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK+L++GD GVGK+ +L RFS++ F    + T+G+DF++R ++L G+ V LQIWDT
Sbjct: 4   YDYLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDT 63

Query: 215 AGQERFRTITTAY 253
           AG ERF+++  +Y
Sbjct: 64  AGDERFKSLLPSY 76



 Score = 67.3 bits (157), Expect = 2e-11
 Identities = 30/61 (49%), Positives = 40/61 (65%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+T+ KSF NI  W++ I   +S  V  M++GNKCD    RQV  E+
Sbjct: 75  SYYRGAHGILLVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLDNRQVRMEQ 134

Query: 427 G 429
           G
Sbjct: 135 G 135


>AY752527-1|AAW31983.1|  174|Drosophila melanogaster CG2532 protein.
          Length = 174

 Score = 92.3 bits (219), Expect = 7e-19
 Identities = 37/73 (50%), Positives = 56/73 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK+L++GD GVGK+ +L RFS++ F    + T+G+DF++R ++L G+ V LQIWDT
Sbjct: 4   YDYLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDT 63

Query: 215 AGQERFRTITTAY 253
           AG ERF+++  +Y
Sbjct: 64  AGDERFKSLLPSY 76



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 39/89 (43%), Positives = 52/89 (58%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+T+ KSF NI  W++ I   +S  V  M++GNKCD    RQV  E+
Sbjct: 75  SYYRGAHGILLVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLDNRQVRMEQ 134

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
           G   A    + F E SAK   NV   F++
Sbjct: 135 GFNYANHRALGFYEVSAKSGANVNDVFNM 163


>AY752526-1|AAW31982.1|  174|Drosophila melanogaster CG2532 protein.
          Length = 174

 Score = 92.3 bits (219), Expect = 7e-19
 Identities = 37/73 (50%), Positives = 56/73 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK+L++GD GVGK+ +L RFS++ F    + T+G+DF++R ++L G+ V LQIWDT
Sbjct: 4   YDYLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDT 63

Query: 215 AGQERFRTITTAY 253
           AG ERF+++  +Y
Sbjct: 64  AGDERFKSLLPSY 76



 Score = 80.6 bits (190), Expect = 2e-15
 Identities = 39/89 (43%), Positives = 53/89 (59%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+T+ KSF NI  W++ I   +S +V  M++GNKCD    RQV  E+
Sbjct: 75  SYYRGAHGILLVYDITSSKSFRNIDGWLKEIRRMSSENVNVMLVGNKCDDLDNRQVRMEQ 134

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
           G   A    + F E SAK   NV   F++
Sbjct: 135 GFNYANHRALGFYEVSAKSGANVNDVFNM 163


>AY752525-1|AAW31981.1|  174|Drosophila melanogaster CG2532 protein.
          Length = 174

 Score = 92.3 bits (219), Expect = 7e-19
 Identities = 37/73 (50%), Positives = 56/73 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK+L++GD GVGK+ +L RFS++ F    + T+G+DF++R ++L G+ V LQIWDT
Sbjct: 4   YDYLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDT 63

Query: 215 AGQERFRTITTAY 253
           AG ERF+++  +Y
Sbjct: 64  AGDERFKSLLPSY 76



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 39/89 (43%), Positives = 52/89 (58%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+T+ KSF NI  W++ I   +S  V  M++GNKCD    RQV  E+
Sbjct: 75  SYYRGAHGILLVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLDNRQVRMEQ 134

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
           G   A    + F E SAK   NV   F++
Sbjct: 135 GFNYANHRALGFYEVSAKSGANVNDVFNM 163


>AY752524-1|AAW31980.1|  174|Drosophila melanogaster CG2532 protein.
          Length = 174

 Score = 92.3 bits (219), Expect = 7e-19
 Identities = 37/73 (50%), Positives = 56/73 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK+L++GD GVGK+ +L RFS++ F    + T+G+DF++R ++L G+ V LQIWDT
Sbjct: 4   YDYLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDT 63

Query: 215 AGQERFRTITTAY 253
           AG ERF+++  +Y
Sbjct: 64  AGDERFKSLLPSY 76



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 39/89 (43%), Positives = 52/89 (58%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+T+ KSF NI  W++ I   +S  V  M++GNKCD    RQV  E+
Sbjct: 75  SYYRGAHGILLVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLDNRQVRMEQ 134

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
           G   A    + F E SAK   NV   F++
Sbjct: 135 GFNYANHRALGFYEVSAKSGANVNDVFNM 163


>AE014298-1531|AAN09277.1|  214|Drosophila melanogaster CG32670-PA
           protein.
          Length = 214

 Score = 92.3 bits (219), Expect = 7e-19
 Identities = 37/73 (50%), Positives = 56/73 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK+L++GD GVGK+ +L RFS++ F    + T+G+DF++R ++L G+ V LQIWDT
Sbjct: 4   YDYLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDT 63

Query: 215 AGQERFRTITTAY 253
           AG ERF+++  +Y
Sbjct: 64  AGDERFKSLLPSY 76



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 39/89 (43%), Positives = 52/89 (58%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+T+ KSF NI  W++ I   +S  V  M++GNKCD    RQV  E+
Sbjct: 75  SYYRGAHGILLVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLDNRQVRMEQ 134

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
           G   A    + F E SAK   NV   F++
Sbjct: 135 GFNYANHRALGFYEVSAKSGANVNDVFNM 163


>AE013599-2512|AAS64815.1|  213|Drosophila melanogaster CG4921-PC,
           isoform C protein.
          Length = 213

 Score = 91.9 bits (218), Expect = 9e-19
 Identities = 41/77 (53%), Positives = 55/77 (71%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M++TYD LFK L+IG +G GK+ +L  F E  F      TIG++F  R +++ GK VKLQ
Sbjct: 1   MSETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++T +Y
Sbjct: 61  IWDTAGQERFRSVTRSY 77



 Score = 69.7 bits (163), Expect = 4e-12
 Identities = 35/87 (40%), Positives = 51/87 (58%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD T+  SF  + NW+ +    AS ++  +++GNK DL+  R V+   
Sbjct: 76  SYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVTFLE 135

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
               A E ++ F+ETSAK   NVE AF
Sbjct: 136 ASTFAQENELIFLETSAKTGENVEEAF 162


>AE013599-2511|AAM68480.1|  213|Drosophila melanogaster CG4921-PB,
           isoform B protein.
          Length = 213

 Score = 91.9 bits (218), Expect = 9e-19
 Identities = 41/77 (53%), Positives = 55/77 (71%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M++TYD LFK L+IG +G GK+ +L  F E  F      TIG++F  R +++ GK VKLQ
Sbjct: 1   MSETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++T +Y
Sbjct: 61  IWDTAGQERFRSVTRSY 77



 Score = 69.7 bits (163), Expect = 4e-12
 Identities = 35/87 (40%), Positives = 51/87 (58%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD T+  SF  + NW+ +    AS ++  +++GNK DL+  R V+   
Sbjct: 76  SYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVTFLE 135

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
               A E ++ F+ETSAK   NVE AF
Sbjct: 136 ASTFAQENELIFLETSAKTGENVEEAF 162


>AE013599-2510|AAF57831.1|  213|Drosophila melanogaster CG4921-PA,
           isoform A protein.
          Length = 213

 Score = 91.9 bits (218), Expect = 9e-19
 Identities = 41/77 (53%), Positives = 55/77 (71%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M++TYD LFK L+IG +G GK+ +L  F E  F      TIG++F  R +++ GK VKLQ
Sbjct: 1   MSETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++T +Y
Sbjct: 61  IWDTAGQERFRSVTRSY 77



 Score = 69.7 bits (163), Expect = 4e-12
 Identities = 35/87 (40%), Positives = 51/87 (58%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD T+  SF  + NW+ +    AS ++  +++GNK DL+  R V+   
Sbjct: 76  SYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVTFLE 135

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
               A E ++ F+ETSAK   NVE AF
Sbjct: 136 ASTFAQENELIFLETSAKTGENVEEAF 162


>AB035670-1|BAA88243.1|  213|Drosophila melanogaster Rab4 protein
           protein.
          Length = 213

 Score = 91.9 bits (218), Expect = 9e-19
 Identities = 41/77 (53%), Positives = 55/77 (71%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M++TYD LFK L+IG +G GK+ +L  F E  F      TIG++F  R +++ GK VKLQ
Sbjct: 1   MSETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++T +Y
Sbjct: 61  IWDTAGQERFRSVTRSY 77



 Score = 69.7 bits (163), Expect = 4e-12
 Identities = 35/87 (40%), Positives = 51/87 (58%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD T+  SF  + NW+ +    AS ++  +++GNK DL+  R V+   
Sbjct: 76  SYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVTFLE 135

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
               A E ++ F+ETSAK   NVE AF
Sbjct: 136 ASTFAQENELIFLETSAKTGENVEEAF 162


>D84316-1|BAA21709.1|  215|Drosophila melanogaster rab14 protein.
          Length = 215

 Score = 90.6 bits (215), Expect = 2e-18
 Identities = 39/73 (53%), Positives = 55/73 (75%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y+ +FK ++IGD GVGK+ +L +F+E  F  +   TIG++F  R I++D KK+KLQIWDT
Sbjct: 8   YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQERFR +T +Y
Sbjct: 68  AGQERFRAVTRSY 80



 Score = 66.1 bits (154), Expect = 5e-11
 Identities = 29/87 (33%), Positives = 50/87 (57%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G ++VYD+T   ++ ++ +W+ +     +      ++GNK DL+S R+V+ E 
Sbjct: 79  SYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEE 138

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            ++ A E  + F+E SA    NVE AF
Sbjct: 139 AKEFADENGLMFLEASAMTGQNVEEAF 165


>AY069563-1|AAL39708.1|  215|Drosophila melanogaster LD29476p
           protein.
          Length = 215

 Score = 90.6 bits (215), Expect = 2e-18
 Identities = 39/73 (53%), Positives = 55/73 (75%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y+ +FK ++IGD GVGK+ +L +F+E  F  +   TIG++F  R I++D KK+KLQIWDT
Sbjct: 8   YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQERFR +T +Y
Sbjct: 68  AGQERFRAVTRSY 80



 Score = 65.3 bits (152), Expect = 9e-11
 Identities = 28/84 (33%), Positives = 49/84 (58%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+ G ++VYD+T   ++ ++ +W+ +     +      ++GNK DL+S R+V+ E  ++
Sbjct: 82  RGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKE 141

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A E  + F+E SA    NVE AF
Sbjct: 142 FADENGLMFLEASAMTGQNVEEAF 165


>AE014134-2489|AAF53390.1|  215|Drosophila melanogaster CG4212-PA,
           isoform A protein.
          Length = 215

 Score = 90.6 bits (215), Expect = 2e-18
 Identities = 39/73 (53%), Positives = 55/73 (75%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y+ +FK ++IGD GVGK+ +L +F+E  F  +   TIG++F  R I++D KK+KLQIWDT
Sbjct: 8   YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDT 67

Query: 215 AGQERFRTITTAY 253
           AGQERFR +T +Y
Sbjct: 68  AGQERFRAVTRSY 80



 Score = 66.1 bits (154), Expect = 5e-11
 Identities = 29/87 (33%), Positives = 50/87 (57%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G ++VYD+T   ++ ++ +W+ +     +      ++GNK DL+S R+V+ E 
Sbjct: 79  SYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEE 138

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            ++ A E  + F+E SA    NVE AF
Sbjct: 139 AKEFADENGLMFLEASAMTGQNVEEAF 165


>AE014134-2488|AAO41194.1|  233|Drosophila melanogaster CG4212-PC,
           isoform C protein.
          Length = 233

 Score = 90.6 bits (215), Expect = 2e-18
 Identities = 39/73 (53%), Positives = 55/73 (75%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y+ +FK ++IGD GVGK+ +L +F+E  F  +   TIG++F  R I++D KK+KLQIWDT
Sbjct: 26  YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDT 85

Query: 215 AGQERFRTITTAY 253
           AGQERFR +T +Y
Sbjct: 86  AGQERFRAVTRSY 98



 Score = 66.1 bits (154), Expect = 5e-11
 Identities = 29/87 (33%), Positives = 50/87 (57%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G ++VYD+T   ++ ++ +W+ +     +      ++GNK DL+S R+V+ E 
Sbjct: 97  SYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEE 156

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            ++ A E  + F+E SA    NVE AF
Sbjct: 157 AKEFADENGLMFLEASAMTGQNVEEAF 183


>AE014134-2487|AAO41193.1|  239|Drosophila melanogaster CG4212-PB,
           isoform B protein.
          Length = 239

 Score = 90.6 bits (215), Expect = 2e-18
 Identities = 39/73 (53%), Positives = 55/73 (75%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y+ +FK ++IGD GVGK+ +L +F+E  F  +   TIG++F  R I++D KK+KLQIWDT
Sbjct: 32  YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDT 91

Query: 215 AGQERFRTITTAY 253
           AGQERFR +T +Y
Sbjct: 92  AGQERFRAVTRSY 104



 Score = 66.1 bits (154), Expect = 5e-11
 Identities = 29/87 (33%), Positives = 50/87 (57%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G ++VYD+T   ++ ++ +W+ +     +      ++GNK DL+S R+V+ E 
Sbjct: 103 SYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEE 162

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            ++ A E  + F+E SA    NVE AF
Sbjct: 163 AKEFADENGLMFLEASAMTGQNVEEAF 189


>AY752529-1|AAW31985.1|  174|Drosophila melanogaster CG2532 protein.
          Length = 174

 Score = 89.4 bits (212), Expect = 5e-18
 Identities = 36/72 (50%), Positives = 55/72 (76%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTA 217
           D LFK+L++GD GVGK+ +L RFS++ F    + T+G+DF++R ++L G+ V LQIWDTA
Sbjct: 5   DYLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTA 64

Query: 218 GQERFRTITTAY 253
           G ERF+++  +Y
Sbjct: 65  GDERFKSLLPSY 76



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 39/89 (43%), Positives = 52/89 (58%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+T+ KSF NI  W++ I   +S  V  M++GNKCD    RQV  E+
Sbjct: 75  SYYRGAHGILLVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLDNRQVRMEQ 134

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
           G   A    + F E SAK   NV   F++
Sbjct: 135 GFNYANHRALGFYEVSAKSGANVNDVFNM 163


>AY752523-1|AAW31979.1|  174|Drosophila melanogaster CG2532 protein.
          Length = 174

 Score = 89.4 bits (212), Expect = 5e-18
 Identities = 36/72 (50%), Positives = 55/72 (76%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTA 217
           D LFK+L++GD GVGK+ +L RFS++ F    + T+G+DF++R ++L G+ V LQIWDTA
Sbjct: 5   DYLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTA 64

Query: 218 GQERFRTITTAY 253
           G ERF+++  +Y
Sbjct: 65  GDERFKSLLPSY 76



 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 39/89 (43%), Positives = 52/89 (58%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+T+ KSF NI  W++ I   +S  V  M++GNKCD    RQV  E+
Sbjct: 75  SYYRGAHGILLVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLDNRQVRMEQ 134

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
           G   A    + F E SAK   NV   F++
Sbjct: 135 GFNYANHRALGFYEVSAKSGANVNDVFNM 163


>BT003609-1|AAO39612.1|  230|Drosophila melanogaster GH17339p
           protein.
          Length = 230

 Score = 88.6 bits (210), Expect = 8e-18
 Identities = 39/77 (50%), Positives = 59/77 (76%), Gaps = 4/77 (5%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGK----KVKLQ 202
           YD L K L++GDSGVGKT +L+++++  F+  FIST+GIDF+ + +  + +    ++ LQ
Sbjct: 8   YDYLLKFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQ 67

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++TTA+
Sbjct: 68  IWDTAGQERFRSLTTAF 84



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 36/94 (38%), Positives = 56/94 (59%), Gaps = 1/94 (1%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENA-SADVEKMILGNKCDLDSQRQVSKERGE 432
           R +MG +L++D+T+EKSF    NW+  +  +A S D + ++ GNKCDL   R VS+++  
Sbjct: 86  RDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQVA 145

Query: 433 QLAIEYQIKFVETSAKDSLNVEYAFSL*PGTKSE 534
            L   Y++ ++ETSA    NV+ A  L  G   E
Sbjct: 146 ALCRRYRLPYIETSACTGANVKEAVELLVGRVME 179


>AY060977-1|AAL28525.1|  230|Drosophila melanogaster GM10914p
           protein.
          Length = 230

 Score = 88.6 bits (210), Expect = 8e-18
 Identities = 39/77 (50%), Positives = 59/77 (76%), Gaps = 4/77 (5%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGK----KVKLQ 202
           YD L K L++GDSGVGKT +L+++++  F+  FIST+GIDF+ + +  + +    ++ LQ
Sbjct: 8   YDYLLKFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQ 67

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++TTA+
Sbjct: 68  IWDTAGQERFRSLTTAF 84



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 36/94 (38%), Positives = 56/94 (59%), Gaps = 1/94 (1%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENA-SADVEKMILGNKCDLDSQRQVSKERGE 432
           R +MG +L++D+T+EKSF    NW+  +  +A S D + ++ GNKCDL   R VS+++  
Sbjct: 86  RDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQVA 145

Query: 433 QLAIEYQIKFVETSAKDSLNVEYAFSL*PGTKSE 534
            L   Y++ ++ETSA    NV+ A  L  G   E
Sbjct: 146 ALCRRYRLPYIETSACTGANVKEAVELLVGRVME 179


>AE014298-220|AAF45634.2|  230|Drosophila melanogaster CG14791-PC,
           isoform C protein.
          Length = 230

 Score = 88.6 bits (210), Expect = 8e-18
 Identities = 39/77 (50%), Positives = 59/77 (76%), Gaps = 4/77 (5%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGK----KVKLQ 202
           YD L K L++GDSGVGKT +L+++++  F+  FIST+GIDF+ + +  + +    ++ LQ
Sbjct: 8   YDYLLKFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQ 67

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++TTA+
Sbjct: 68  IWDTAGQERFRSLTTAF 84



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 36/94 (38%), Positives = 56/94 (59%), Gaps = 1/94 (1%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENA-SADVEKMILGNKCDLDSQRQVSKERGE 432
           R +MG +L++D+T+EKSF    NW+  +  +A S D + ++ GNKCDL   R VS+++  
Sbjct: 86  RDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQVA 145

Query: 433 QLAIEYQIKFVETSAKDSLNVEYAFSL*PGTKSE 534
            L   Y++ ++ETSA    NV+ A  L  G   E
Sbjct: 146 ALCRRYRLPYIETSACTGANVKEAVELLVGRVME 179


>AB112931-1|BAD07036.1|  230|Drosophila melanogaster Rab27 protein.
          Length = 230

 Score = 88.6 bits (210), Expect = 8e-18
 Identities = 39/77 (50%), Positives = 59/77 (76%), Gaps = 4/77 (5%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGK----KVKLQ 202
           YD L K L++GDSGVGKT +L+++++  F+  FIST+GIDF+ + +  + +    ++ LQ
Sbjct: 8   YDYLLKFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQ 67

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFR++TTA+
Sbjct: 68  IWDTAGQERFRSLTTAF 84



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 36/94 (38%), Positives = 56/94 (59%), Gaps = 1/94 (1%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENA-SADVEKMILGNKCDLDSQRQVSKERGE 432
           R +MG +L++D+T+EKSF    NW+  +  +A S D + ++ GNKCDL   R VS+++  
Sbjct: 86  RDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQVA 145

Query: 433 QLAIEYQIKFVETSAKDSLNVEYAFSL*PGTKSE 534
            L   Y++ ++ETSA    NV+ A  L  G   E
Sbjct: 146 ALCRRYRLPYIETSACTGANVKEAVELLVGRVME 179


>D84313-1|BAA21706.1|  213|Drosophila melanogaster rab2 protein.
          Length = 213

 Score = 88.2 bits (209), Expect = 1e-17
 Identities = 39/74 (52%), Positives = 55/74 (74%)
 Frame = +2

Query: 32  TYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWD 211
           +Y  LFK ++IGD+GVGK+ +L +F++  F      TIG++F  R I +DGK++KLQIWD
Sbjct: 2   SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWD 61

Query: 212 TAGQERFRTITTAY 253
           TAGQE FR+IT +Y
Sbjct: 62  TAGQEAFRSITRSY 75



 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 37/87 (42%), Positives = 62/87 (71%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T  ++F ++  W+ +  +++++++  M++GNK DLDS+R+V KE 
Sbjct: 74  SYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVKKEE 133

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE  A E+ + F+ETSA+ + NVE AF
Sbjct: 134 GEAFAREHGLVFMETSARTAANVEEAF 160


>BT003315-1|AAO25075.1|  213|Drosophila melanogaster GH01619p
           protein.
          Length = 213

 Score = 88.2 bits (209), Expect = 1e-17
 Identities = 39/74 (52%), Positives = 55/74 (74%)
 Frame = +2

Query: 32  TYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWD 211
           +Y  LFK ++IGD+GVGK+ +L +F++  F      TIG++F  R I +DGK++KLQIWD
Sbjct: 2   SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWD 61

Query: 212 TAGQERFRTITTAY 253
           TAGQE FR+IT +Y
Sbjct: 62  TAGQEAFRSITRSY 75



 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 37/87 (42%), Positives = 62/87 (71%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T  ++F ++  W+ +  +++++++  M++GNK DLDS+R+V KE 
Sbjct: 74  SYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVKKEE 133

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE  A E+ + F+ETSA+ + NVE AF
Sbjct: 134 GEAFAREHGLVFMETSARTAANVEEAF 160


>AE013599-209|AAM70817.1|  213|Drosophila melanogaster CG3269-PA
           protein.
          Length = 213

 Score = 88.2 bits (209), Expect = 1e-17
 Identities = 39/74 (52%), Positives = 55/74 (74%)
 Frame = +2

Query: 32  TYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWD 211
           +Y  LFK ++IGD+GVGK+ +L +F++  F      TIG++F  R I +DGK++KLQIWD
Sbjct: 2   SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWD 61

Query: 212 TAGQERFRTITTAY 253
           TAGQE FR+IT +Y
Sbjct: 62  TAGQEAFRSITRSY 75



 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 37/87 (42%), Positives = 62/87 (71%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T  ++F ++  W+ +  +++++++  M++GNK DLDS+R+V KE 
Sbjct: 74  SYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVKKEE 133

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE  A E+ + F+ETSA+ + NVE AF
Sbjct: 134 GEAFAREHGLVFMETSARTAANVEEAF 160


>AB035352-1|BAA87878.1|  213|Drosophila melanogaster Drab2 protein.
          Length = 213

 Score = 88.2 bits (209), Expect = 1e-17
 Identities = 39/74 (52%), Positives = 55/74 (74%)
 Frame = +2

Query: 32  TYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWD 211
           +Y  LFK ++IGD+GVGK+ +L +F++  F      TIG++F  R I +DGK++KLQIWD
Sbjct: 2   SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWD 61

Query: 212 TAGQERFRTITTAY 253
           TAGQE FR+IT +Y
Sbjct: 62  TAGQEAFRSITRSY 75



 Score = 85.8 bits (203), Expect = 6e-17
 Identities = 37/87 (42%), Positives = 61/87 (70%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+T  ++F ++  W+ +  +++++++  M++GNK DLDS+R+V KE 
Sbjct: 74  SYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVKKEE 133

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE  A E  + F+ETSA+ + NVE AF
Sbjct: 134 GEAFARENGLVFMETSARTAANVEEAF 160


>AY061826-1|AAL27637.1|  388|Drosophila melanogaster GH21984p
           protein.
          Length = 388

 Score = 86.2 bits (204), Expect = 4e-17
 Identities = 42/102 (41%), Positives = 64/102 (62%), Gaps = 1/102 (0%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLD-SQRQVSKERGE 432
           R +  ++L+YDVTN+ +++NI+ W+  I E A  DV  +++GNK D   S+RQV +E GE
Sbjct: 262 RDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVKREDGE 321

Query: 433 QLAIEYQIKFVETSAKDSLNVEYAFSL*PGTKSENGKETGSE 558
           +L  E+ + F+ETSAK  LNVE +F+         G E G +
Sbjct: 322 RLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDD 363



 Score = 83.8 bits (198), Expect = 2e-16
 Identities = 43/99 (43%), Positives = 62/99 (62%), Gaps = 1/99 (1%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNI-SFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           K +L+GDSGVGKTS L +++   F + SF +T+GI    + + +DG +VKLQIWDTAGQE
Sbjct: 192 KTILLGDSGVGKTSFLVKYNTGEFRLGSFSATVGIALTNKVVVVDGTRVKLQIWDTAGQE 251

Query: 227 RFRTITTAYSVVLWELCLSTMLRMRRALKTLRIGLGTLK 343
           RFR++T AY      L L   +  +     +R  LG ++
Sbjct: 252 RFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIR 290


>AE014296-3519|AAF51708.2|  388|Drosophila melanogaster CG7605-PA
           protein.
          Length = 388

 Score = 86.2 bits (204), Expect = 4e-17
 Identities = 42/102 (41%), Positives = 64/102 (62%), Gaps = 1/102 (0%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLD-SQRQVSKERGE 432
           R +  ++L+YDVTN+ +++NI+ W+  I E A  DV  +++GNK D   S+RQV +E GE
Sbjct: 262 RDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVKREDGE 321

Query: 433 QLAIEYQIKFVETSAKDSLNVEYAFSL*PGTKSENGKETGSE 558
           +L  E+ + F+ETSAK  LNVE +F+         G E G +
Sbjct: 322 RLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDD 363



 Score = 83.8 bits (198), Expect = 2e-16
 Identities = 43/99 (43%), Positives = 62/99 (62%), Gaps = 1/99 (1%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNI-SFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           K +L+GDSGVGKTS L +++   F + SF +T+GI    + + +DG +VKLQIWDTAGQE
Sbjct: 192 KTILLGDSGVGKTSFLVKYNTGEFRLGSFSATVGIALTNKVVVVDGTRVKLQIWDTAGQE 251

Query: 227 RFRTITTAYSVVLWELCLSTMLRMRRALKTLRIGLGTLK 343
           RFR++T AY      L L   +  +     +R  LG ++
Sbjct: 252 RFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIR 290


>D84314-1|BAA21707.1|  208|Drosophila melanogaster rab6 protein.
          Length = 208

 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 35/69 (50%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + V+LQ+WDTAGQE
Sbjct: 13  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 72

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 73  RFRSLIPSY 81



 Score = 79.4 bits (187), Expect = 5e-15
 Identities = 38/87 (43%), Positives = 52/87 (59%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF     WI ++     +DV  M++GNK DL  +RQVS E 
Sbjct: 80  SYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVSTEE 139

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A E  + F+ETSAK   NV+  F
Sbjct: 140 GERKAKELNVMFIETSAKAGYNVKQLF 166


>AY752542-1|AAW31998.1|  195|Drosophila melanogaster CG2885 protein.
          Length = 195

 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 33/69 (47%), Positives = 53/69 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           +D LFK+L++GDSGVGK+ +L RFS+D F   ++ T+GID K R+++L  + + LQ+WDT
Sbjct: 4   FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDT 63

Query: 215 AGQERFRTI 241
           +G +RF ++
Sbjct: 64  SGDKRFNSL 72



 Score = 71.7 bits (168), Expect = 1e-12
 Identities = 36/85 (42%), Positives = 50/85 (58%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS E+G  
Sbjct: 78  RSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSMEQGFN 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    + F E SAK  +NV   FS
Sbjct: 138 YAHRGALGFEEVSAKSGMNVYDIFS 162


>AY752539-1|AAW31995.1|  195|Drosophila melanogaster CG2885 protein.
          Length = 195

 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 33/69 (47%), Positives = 53/69 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           +D LFK+L++GDSGVGK+ +L RFS+D F   ++ T+GID K R+++L  + + LQ+WDT
Sbjct: 4   FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDT 63

Query: 215 AGQERFRTI 241
           +G +RF ++
Sbjct: 64  SGDKRFNSL 72



 Score = 74.5 bits (175), Expect = 1e-13
 Identities = 37/85 (43%), Positives = 50/85 (58%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNKCD  + RQVS E+G  
Sbjct: 78  RSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKCDDPNHRQVSMEQGFN 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    + F E SAK   NV   FS
Sbjct: 138 YAHRRALGFEEVSAKSGRNVYDIFS 162


>AY752538-1|AAW31994.1|  195|Drosophila melanogaster CG2885 protein.
          Length = 195

 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 33/69 (47%), Positives = 53/69 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           +D LFK+L++GDSGVGK+ +L RFS+D F   ++ T+GID K R+++L  + + LQ+WDT
Sbjct: 4   FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDT 63

Query: 215 AGQERFRTI 241
           +G +RF ++
Sbjct: 64  SGDKRFNSL 72



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 36/85 (42%), Positives = 49/85 (57%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS E+G  
Sbjct: 78  RSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSMEQGFN 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    + F E SAK   NV   FS
Sbjct: 138 YAHRRALGFEEVSAKSGRNVYDIFS 162


>AY752537-1|AAW31993.1|  195|Drosophila melanogaster CG2885 protein.
          Length = 195

 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 33/69 (47%), Positives = 53/69 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           +D LFK+L++GDSGVGK+ +L RFS+D F   ++ T+GID K R+++L  + + LQ+WDT
Sbjct: 4   FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDT 63

Query: 215 AGQERFRTI 241
           +G +RF ++
Sbjct: 64  SGDKRFNSL 72



 Score = 70.9 bits (166), Expect = 2e-12
 Identities = 36/85 (42%), Positives = 50/85 (58%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS E+G  
Sbjct: 78  RSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVSMEQGFN 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    + F E SAK  +NV   FS
Sbjct: 138 YAHRRALGFEEVSAKSGMNVYDIFS 162


>AY752536-1|AAW31992.1|  195|Drosophila melanogaster CG2885 protein.
          Length = 195

 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 33/69 (47%), Positives = 53/69 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           +D LFK+L++GDSGVGK+ +L RFS+D F   ++ T+GID K R+++L  + + LQ+WDT
Sbjct: 4   FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDT 63

Query: 215 AGQERFRTI 241
           +G +RF ++
Sbjct: 64  SGDKRFNSL 72



 Score = 69.7 bits (163), Expect = 4e-12
 Identities = 35/85 (41%), Positives = 49/85 (57%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS  +G  
Sbjct: 78  RSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSMAQGFN 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    + F E SAK  +NV   FS
Sbjct: 138 YAHRRALGFEEVSAKSGMNVYDIFS 162


>AY752535-1|AAW31991.1|  195|Drosophila melanogaster CG2885 protein.
          Length = 195

 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 33/69 (47%), Positives = 53/69 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           +D LFK+L++GDSGVGK+ +L RFS+D F   ++ T+GID K R+++L  + + LQ+WDT
Sbjct: 4   FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDT 63

Query: 215 AGQERFRTI 241
           +G +RF ++
Sbjct: 64  SGDKRFNSL 72



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 36/85 (42%), Positives = 50/85 (58%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS E+G  
Sbjct: 78  RSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSMEQGFN 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    + F E SAK  +NV   FS
Sbjct: 138 YAHCRALGFEEVSAKSGMNVYDIFS 162


>AY752534-1|AAW31990.1|  195|Drosophila melanogaster CG2885 protein.
          Length = 195

 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 33/69 (47%), Positives = 53/69 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           +D LFK+L++GDSGVGK+ +L RFS+D F   ++ T+GID K R+++L  + + LQ+WDT
Sbjct: 4   FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDT 63

Query: 215 AGQERFRTI 241
           +G +RF ++
Sbjct: 64  SGDKRFNSL 72



 Score = 72.5 bits (170), Expect = 6e-13
 Identities = 36/85 (42%), Positives = 50/85 (58%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS E+G  
Sbjct: 78  RSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSMEQGFN 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    + F E SAK  +NV   FS
Sbjct: 138 YAHRQSLCFEEVSAKSGMNVYDIFS 162


>AY752533-1|AAW31989.1|  195|Drosophila melanogaster CG2885 protein.
          Length = 195

 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 33/69 (47%), Positives = 53/69 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           +D LFK+L++GDSGVGK+ +L RFS+D F   ++ T+GID K R+++L  + + LQ+WDT
Sbjct: 4   FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDT 63

Query: 215 AGQERFRTI 241
           +G +RF ++
Sbjct: 64  SGDKRFNSL 72



 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 36/85 (42%), Positives = 50/85 (58%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS E+G  
Sbjct: 78  RSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVIVLLVGNKSDDPNHRQVSMEQGFN 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    + F E SAK  +NV   FS
Sbjct: 138 YAHRGALGFEEVSAKSGMNVYEIFS 162


>AY060261-1|AAL25300.1|  208|Drosophila melanogaster GH09086p
           protein.
          Length = 208

 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 35/69 (50%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + V+LQ+WDTAGQE
Sbjct: 13  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 72

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 73  RFRSLIPSY 81



 Score = 79.4 bits (187), Expect = 5e-15
 Identities = 38/87 (43%), Positives = 52/87 (59%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF     WI ++     +DV  M++GNK DL  +RQVS E 
Sbjct: 80  SYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVSTEE 139

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A E  + F+ETSAK   NV+  F
Sbjct: 140 GERKAKELNVMFIETSAKAGYNVKQLF 166


>AE014298-1452|AAF46585.1|  195|Drosophila melanogaster CG2885-PA
           protein.
          Length = 195

 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 33/69 (47%), Positives = 53/69 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           +D LFK+L++GDSGVGK+ +L RFS+D F   ++ T+GID K R+++L  + + LQ+WDT
Sbjct: 4   FDYLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDT 63

Query: 215 AGQERFRTI 241
           +G +RF ++
Sbjct: 64  SGDKRFNSL 72



 Score = 71.7 bits (168), Expect = 1e-12
 Identities = 36/85 (42%), Positives = 50/85 (58%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS E+G  
Sbjct: 78  RSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSMEQGFN 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    + F E SAK  +NV   FS
Sbjct: 138 YAHRGALGFEEVSAKSGMNVYDIFS 162


>AE014134-2164|AAF53168.1|  208|Drosophila melanogaster CG6601-PA
           protein.
          Length = 208

 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 35/69 (50%), Positives = 54/69 (78%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FKL+ +G+  VGKTS++ RF  D+F+ ++ +TIGIDF  +T+ L+ + V+LQ+WDTAGQE
Sbjct: 13  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 72

Query: 227 RFRTITTAY 253
           RFR++  +Y
Sbjct: 73  RFRSLIPSY 81



 Score = 79.4 bits (187), Expect = 5e-15
 Identities = 38/87 (43%), Positives = 52/87 (59%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S +R S   ++VYD+TN  SF     WI ++     +DV  M++GNK DL  +RQVS E 
Sbjct: 80  SYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVSTEE 139

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
           GE+ A E  + F+ETSAK   NV+  F
Sbjct: 140 GERKAKELNVMFIETSAKAGYNVKQLF 166


>AY752540-1|AAW31996.1|  195|Drosophila melanogaster CG2885 protein.
          Length = 195

 Score = 81.8 bits (193), Expect = 9e-16
 Identities = 32/69 (46%), Positives = 53/69 (76%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           +D LFK++++GDSGVGK+ +L RFS+D F   ++ T+GID K R+++L  + + LQ+WDT
Sbjct: 4   FDYLFKVIVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDT 63

Query: 215 AGQERFRTI 241
           +G +RF ++
Sbjct: 64  SGDKRFNSL 72



 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 36/85 (42%), Positives = 50/85 (58%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS E+G  
Sbjct: 78  RSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHRQVSMEQGFN 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    + F E SAK  +NV   FS
Sbjct: 138 YAHRGALGFEEVSAKSGMNVYDIFS 162


>AL031027-5|CAA19844.2|  236|Drosophila melanogaster EG:80H7.4
           protein.
          Length = 236

 Score = 81.0 bits (191), Expect = 2e-15
 Identities = 35/72 (48%), Positives = 56/72 (77%), Gaps = 4/72 (5%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGK----KVKLQIWDTA 217
           + L++GDSGVGKT +L+++++  F+  FIST+GIDF+ + +  + +    ++ LQIWDTA
Sbjct: 19  QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTA 78

Query: 218 GQERFRTITTAY 253
           GQERFR++TTA+
Sbjct: 79  GQERFRSLTTAF 90



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 36/94 (38%), Positives = 56/94 (59%), Gaps = 1/94 (1%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENA-SADVEKMILGNKCDLDSQRQVSKERGE 432
           R +MG +L++D+T+EKSF    NW+  +  +A S D + ++ GNKCDL   R VS+++  
Sbjct: 92  RDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQVA 151

Query: 433 QLAIEYQIKFVETSAKDSLNVEYAFSL*PGTKSE 534
            L   Y++ ++ETSA    NV+ A  L  G   E
Sbjct: 152 ALCRRYRLPYIETSACTGANVKEAVELLVGRVME 185


>AE014298-219|AAF45635.1|  236|Drosophila melanogaster CG14791-PB,
           isoform B protein.
          Length = 236

 Score = 81.0 bits (191), Expect = 2e-15
 Identities = 35/72 (48%), Positives = 56/72 (77%), Gaps = 4/72 (5%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGK----KVKLQIWDTA 217
           + L++GDSGVGKT +L+++++  F+  FIST+GIDF+ + +  + +    ++ LQIWDTA
Sbjct: 19  QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTA 78

Query: 218 GQERFRTITTAY 253
           GQERFR++TTA+
Sbjct: 79  GQERFRSLTTAF 90



 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 36/94 (38%), Positives = 56/94 (59%), Gaps = 1/94 (1%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENA-SADVEKMILGNKCDLDSQRQVSKERGE 432
           R +MG +L++D+T+EKSF    NW+  +  +A S D + ++ GNKCDL   R VS+++  
Sbjct: 92  RDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQVA 151

Query: 433 QLAIEYQIKFVETSAKDSLNVEYAFSL*PGTKSE 534
            L   Y++ ++ETSA    NV+ A  L  G   E
Sbjct: 152 ALCRRYRLPYIETSACTGANVKEAVELLVGRVME 185


>AY071340-1|AAL48962.1|  218|Drosophila melanogaster RE37651p
           protein.
          Length = 218

 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 38/74 (51%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL-DGKKVKLQIWD 211
           ++  F+L+LIGDS VGK+S+L  F++  F      T+G+DF  R I++ DG ++KLQ+WD
Sbjct: 6   FEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWD 65

Query: 212 TAGQERFRTITTAY 253
           TAGQERFR+IT +Y
Sbjct: 66  TAGQERFRSITKSY 79



 Score = 62.1 bits (144), Expect = 8e-10
 Identities = 37/96 (38%), Positives = 57/96 (59%), Gaps = 7/96 (7%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWI----RNIEENASADVEKMILGNKCDL---DSQ 405
           S  R S+G++LVYD++N  SFE+I  W+    R+IE + S      ++G K DL      
Sbjct: 78  SYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRSVFA---LVGCKLDLINAGGH 134

Query: 406 RQVSKERGEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
           R+V+ E  ++ A ++ + FVETSA+   NVE AF +
Sbjct: 135 REVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRM 170


>AE014298-1056|AAF46271.1|  218|Drosophila melanogaster CG12156-PA
           protein.
          Length = 218

 Score = 80.2 bits (189), Expect = 3e-15
 Identities = 38/74 (51%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL-DGKKVKLQIWD 211
           ++  F+L+LIGDS VGK+S+L  F++  F      T+G+DF  R I++ DG ++KLQ+WD
Sbjct: 6   FEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWD 65

Query: 212 TAGQERFRTITTAY 253
           TAGQERFR+IT +Y
Sbjct: 66  TAGQERFRSITKSY 79



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 33/93 (35%), Positives = 53/93 (56%), Gaps = 4/93 (4%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKM-ILGNKCDL---DSQRQV 414
           S  R S+G++LVYD++N  SFE+I  W+   + +         ++G K DL      R+V
Sbjct: 78  SYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINAGGHREV 137

Query: 415 SKERGEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
           + E  ++ A ++ + FVETSA+   NVE AF +
Sbjct: 138 TTEEAQKFAKQHGLHFVETSARSGANVEEAFRM 170


>D84317-1|BAA21710.1|  197|Drosophila melanogaster rab-related
           protein 4 protein.
          Length = 197

 Score = 78.6 bits (185), Expect = 9e-15
 Identities = 35/72 (48%), Positives = 53/72 (73%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTA 217
           D   KLL+IG+SGVGK+S++ RF E+ F+ +   TIG+DFK + + +DG   K+ +WDTA
Sbjct: 3   DRAIKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTA 62

Query: 218 GQERFRTITTAY 253
           G ERFR++T ++
Sbjct: 63  GAERFRSLTASF 74



 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 25/79 (31%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEE-NASADVEKMILGNKCDLDSQRQVSKE 423
           S  R ++G +LVYD+T+  S   ++ W+  ++  + + ++  +++GNK  +D +R V +E
Sbjct: 73  SFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNK--IDEERVVDRE 130

Query: 424 RGEQLAIEYQIKFVETSAK 480
            G + A +++  F+ETSAK
Sbjct: 131 EGRKFARKHRALFIETSAK 149


>AY075329-1|AAL68196.1|  197|Drosophila melanogaster GH11193p
           protein.
          Length = 197

 Score = 78.2 bits (184), Expect = 1e-14
 Identities = 35/72 (48%), Positives = 53/72 (73%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTA 217
           D   KLL+IG+SGVGK+S++ RF E+ F+ +   TIG+DFK + + +DG   K+ +WDTA
Sbjct: 3   DRAIKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTA 62

Query: 218 GQERFRTITTAY 253
           G ERFR++T ++
Sbjct: 63  GAERFRSLTPSF 74



 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 25/79 (31%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEE-NASADVEKMILGNKCDLDSQRQVSKE 423
           S  R ++G +LVYD+T+  S   ++ W+  ++  + + ++  +++GNK  +D +R V +E
Sbjct: 73  SFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNK--IDEERVVDRE 130

Query: 424 RGEQLAIEYQIKFVETSAK 480
            G + A +++  F+ETSAK
Sbjct: 131 EGRKFARKHRALFIETSAK 149


>AE014298-769|AAF46057.1|  197|Drosophila melanogaster CG3129-PA
           protein.
          Length = 197

 Score = 78.2 bits (184), Expect = 1e-14
 Identities = 35/72 (48%), Positives = 53/72 (73%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTA 217
           D   KLL+IG+SGVGK+S++ RF E+ F+ +   TIG+DFK + + +DG   K+ +WDTA
Sbjct: 3   DRAIKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTA 62

Query: 218 GQERFRTITTAY 253
           G ERFR++T ++
Sbjct: 63  GAERFRSLTPSF 74



 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 25/79 (31%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEE-NASADVEKMILGNKCDLDSQRQVSKE 423
           S  R ++G +LVYD+T+  S   ++ W+  ++  + + ++  +++GNK  +D +R V +E
Sbjct: 73  SFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNK--IDEERVVDRE 130

Query: 424 RGEQLAIEYQIKFVETSAK 480
            G + A +++  F+ETSAK
Sbjct: 131 EGRKFARKHRALFIETSAK 149


>AY061365-1|AAL28913.1|  147|Drosophila melanogaster LD28840p
           protein.
          Length = 147

 Score = 76.2 bits (179), Expect = 5e-14
 Identities = 35/84 (41%), Positives = 56/84 (66%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+ G+++VYDVTN +SF N++ W+  I+ N    V+K+++GNK D   ++ V  E  ++
Sbjct: 25  RGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDV-VKKVLVGNKNDDPDRKVVITEDAQR 83

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  I+  ETSAKD++NVE  F
Sbjct: 84  FAKQMDIELFETSAKDNINVENMF 107



 Score = 46.0 bits (104), Expect = 6e-05
 Identities = 19/22 (86%), Positives = 21/22 (95%)
 Frame = +2

Query: 188 KVKLQIWDTAGQERFRTITTAY 253
           +VKLQIWDTAGQERFRTIT+ Y
Sbjct: 2   RVKLQIWDTAGQERFRTITSTY 23


>AY119634-1|AAM50288.1|  222|Drosophila melanogaster RE42508p
           protein.
          Length = 222

 Score = 75.8 bits (178), Expect = 6e-14
 Identities = 34/86 (39%), Positives = 54/86 (62%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RGS G +LVYD+T+  SF+ +K+W+R + +    ++  +I+GNK DL+ QR V+ +   Q
Sbjct: 85  RGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVTHDEALQ 144

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFSL 513
            A     ++VETSAK++  V   F L
Sbjct: 145 YARTVGAQYVETSAKENEGVAELFEL 170



 Score = 72.1 bits (169), Expect = 8e-13
 Identities = 33/70 (47%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL-DGKKVKLQIWDTAGQ 223
           FK +L+G+  VGKTS++ R+ ED FN   +ST+   F  R + L DG++ +L IWDTAGQ
Sbjct: 14  FKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQ 73

Query: 224 ERFRTITTAY 253
           ERF  +   Y
Sbjct: 74  ERFHALGPIY 83


>AY061218-1|AAL28766.1|  252|Drosophila melanogaster LD16331p
           protein.
          Length = 252

 Score = 75.8 bits (178), Expect = 6e-14
 Identities = 40/78 (51%), Positives = 50/78 (64%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M K YD L K+LL+GDS VGK  IL    + +    F S  G  +K  TI L+GK+VKLQ
Sbjct: 1   MTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCS--GNAYKTTTILLEGKRVKLQ 58

Query: 203 IWDTAGQERFRTITTAYS 256
           +WDT+GQ RF TI  +YS
Sbjct: 59  LWDTSGQGRFCTIIRSYS 76



 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 30/87 (34%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+TN+ SF+ I  W++ ++E+A   + K+++GN+  L  +RQV+ ++
Sbjct: 74  SYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHAPG-IPKVLVGNRLHLAFKRQVAAKQ 132

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            E  A    +   E S   + N+  +F
Sbjct: 133 AETYASRNNMSCFEISPLCNFNIRESF 159


>AE014298-3236|EAA46056.1|  189|Drosophila melanogaster CG17515-PA,
           isoform A protein.
          Length = 189

 Score = 75.8 bits (178), Expect = 6e-14
 Identities = 34/86 (39%), Positives = 54/86 (62%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RGS G +LVYD+T+  SF+ +K+W+R + +    ++  +I+GNK DL+ QR V+ +   Q
Sbjct: 52  RGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVTHDEALQ 111

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFSL 513
            A     ++VETSAK++  V   F L
Sbjct: 112 YARTVGAQYVETSAKENEGVAELFEL 137



 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 23/49 (46%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
 Frame = +2

Query: 110 EDAFNISFISTIGIDFKIRTIDL-DGKKVKLQIWDTAGQERFRTITTAY 253
           ED FN   +ST+   F  R + L DG++ +L IWDTAGQERF  +   Y
Sbjct: 2   EDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERFHALGPIY 50


>AE014298-3235|EAA46055.2|  273|Drosophila melanogaster CG17515-PB,
           isoform B protein.
          Length = 273

 Score = 75.8 bits (178), Expect = 6e-14
 Identities = 34/86 (39%), Positives = 54/86 (62%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RGS G +LVYD+T+  SF+ +K+W+R + +    ++  +I+GNK DL+ QR V+ +   Q
Sbjct: 136 RGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVTHDEALQ 195

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFSL 513
            A     ++VETSAK++  V   F L
Sbjct: 196 YARTVGAQYVETSAKENEGVAELFEL 221



 Score = 72.1 bits (169), Expect = 8e-13
 Identities = 33/70 (47%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL-DGKKVKLQIWDTAGQ 223
           FK +L+G+  VGKTS++ R+ ED FN   +ST+   F  R + L DG++ +L IWDTAGQ
Sbjct: 65  FKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQ 124

Query: 224 ERFRTITTAY 253
           ERF  +   Y
Sbjct: 125 ERFHALGPIY 134


>AE014298-1768|AAF48164.2|  255|Drosophila melanogaster CG1900-PA,
           isoform A protein.
          Length = 255

 Score = 75.8 bits (178), Expect = 6e-14
 Identities = 40/78 (51%), Positives = 50/78 (64%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M K YD L K+LL+GDS VGK  IL    + +    F S  G  +K  TI L+GK+VKLQ
Sbjct: 4   MTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCS--GNAYKTTTILLEGKRVKLQ 61

Query: 203 IWDTAGQERFRTITTAYS 256
           +WDT+GQ RF TI  +YS
Sbjct: 62  LWDTSGQGRFCTIIRSYS 79



 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 30/87 (34%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+TN+ SF+ I  W++ ++E+A   + K+++GN+  L  +RQV+ ++
Sbjct: 77  SYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHAPG-IPKVLVGNRLHLAFKRQVAAKQ 135

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            E  A    +   E S   + N+  +F
Sbjct: 136 AETYASRNNMSCFEISPLCNFNIRESF 162


>AY113574-1|AAM29579.1|  268|Drosophila melanogaster RH23273p
           protein.
          Length = 268

 Score = 75.4 bits (177), Expect = 8e-14
 Identities = 31/68 (45%), Positives = 49/68 (72%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K++++G+ GVGK+S++ R+ +  F   +  TIG+DF  R I++DG+ V++ +WDTAGQE 
Sbjct: 39  KVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDTAGQEE 98

Query: 230 FRTITTAY 253
           F  IT AY
Sbjct: 99  FDCITKAY 106



 Score = 55.6 bits (128), Expect = 7e-08
 Identities = 29/84 (34%), Positives = 46/84 (54%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   +LV+  T+  SF+ IK+W R + EN   ++  +I+ NK DL  Q  V+ +  E 
Sbjct: 108 RGAQASVLVFSTTDRASFDAIKDWKRKV-ENECNEIPTVIVQNKIDLIEQAVVTADEVET 166

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA     + + TS K+ +NV   F
Sbjct: 167 LAKLLNCRLIRTSVKEDINVASVF 190


>AE014297-330|AAF51970.1|  268|Drosophila melanogaster CG2108-PA
           protein.
          Length = 268

 Score = 75.4 bits (177), Expect = 8e-14
 Identities = 31/68 (45%), Positives = 49/68 (72%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K++++G+ GVGK+S++ R+ +  F   +  TIG+DF  R I++DG+ V++ +WDTAGQE 
Sbjct: 39  KVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDTAGQEE 98

Query: 230 FRTITTAY 253
           F  IT AY
Sbjct: 99  FDCITKAY 106



 Score = 55.6 bits (128), Expect = 7e-08
 Identities = 29/84 (34%), Positives = 46/84 (54%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   +LV+  T+  SF+ IK+W R + EN   ++  +I+ NK DL  Q  V+ +  E 
Sbjct: 108 RGAQASVLVFSTTDRASFDAIKDWKRKV-ENECNEIPTVIVQNKIDLIEQAVVTADEVET 166

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA     + + TS K+ +NV   F
Sbjct: 167 LAKLLNCRLIRTSVKEDINVASVF 190


>BT023374-1|AAY55790.1|  358|Drosophila melanogaster IP10363p
           protein.
          Length = 358

 Score = 74.9 bits (176), Expect = 1e-13
 Identities = 32/68 (47%), Positives = 46/68 (67%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K++ +GD  VGKT+I+ RF  D F  ++ +TIG+DF++    + G    L++WDTAGQER
Sbjct: 147 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQER 206

Query: 230 FRTITTAY 253
           FR I  AY
Sbjct: 207 FRCIAGAY 214



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 27/87 (31%), Positives = 44/87 (50%), Gaps = 3/87 (3%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRN-IEENASADVEKMILGNKCDLDSQRQ-VSKERG 429
           R +  I++ YD++ + S E+ K W+ + +  NAS      ++G K DL S+ + V  ER 
Sbjct: 216 RNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLLSKEEFVRMERL 275

Query: 430 EQL-AIEYQIKFVETSAKDSLNVEYAF 507
             L A E Q ++   SA+    V   F
Sbjct: 276 AGLAAAELQAEYWSVSARSGFKVTELF 302


>BT023330-1|AAY55746.1|  191|Drosophila melanogaster IP10163p
           protein.
          Length = 191

 Score = 74.9 bits (176), Expect = 1e-13
 Identities = 32/68 (47%), Positives = 46/68 (67%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K++ +GD  VGKT+I+ RF  D F  ++ +TIG+DF++    + G    L++WDTAGQER
Sbjct: 64  KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQER 123

Query: 230 FRTITTAY 253
           FR I  AY
Sbjct: 124 FRCIAGAY 131



 Score = 31.5 bits (68), Expect = 1.3
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRN-IEENASADVEKMILGNKCDL 396
           R +  I++ YD++ + S E+ K W+ + +  NAS      ++G K DL
Sbjct: 133 RNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADL 180


>BT023274-1|AAY55690.1|  205|Drosophila melanogaster IP10063p
           protein.
          Length = 205

 Score = 74.9 bits (176), Expect = 1e-13
 Identities = 32/68 (47%), Positives = 46/68 (67%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K++ +GD  VGKT+I+ RF  D F  ++ +TIG+DF++    + G    L++WDTAGQER
Sbjct: 78  KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQER 137

Query: 230 FRTITTAY 253
           FR I  AY
Sbjct: 138 FRCIAGAY 145



 Score = 31.5 bits (68), Expect = 1.3
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRN-IEENASADVEKMILGNKCDL 396
           R +  I++ YD++ + S E+ K W+ + +  NAS      ++G K DL
Sbjct: 147 RNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADL 194


>AY071139-1|AAL48761.1|  256|Drosophila melanogaster RE17845p
           protein.
          Length = 256

 Score = 74.9 bits (176), Expect = 1e-13
 Identities = 32/70 (45%), Positives = 50/70 (71%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GD GVGK+++L RF  + +  +   TIG++F  + I +DG++  LQIWDTAGQ
Sbjct: 12  LLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQ 71

Query: 224 ERFRTITTAY 253
           ERFR + T +
Sbjct: 72  ERFRALRTPF 81


>AE014296-330|AAF47546.1|  305|Drosophila melanogaster CG7980-PA
           protein.
          Length = 305

 Score = 74.9 bits (176), Expect = 1e-13
 Identities = 32/68 (47%), Positives = 46/68 (67%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K++ +GD  VGKT+I+ RF  D F  ++ +TIG+DF++    + G    L++WDTAGQER
Sbjct: 66  KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQER 125

Query: 230 FRTITTAY 253
           FR I  AY
Sbjct: 126 FRCIAGAY 133



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 27/87 (31%), Positives = 44/87 (50%), Gaps = 3/87 (3%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRN-IEENASADVEKMILGNKCDLDSQRQ-VSKERG 429
           R +  I++ YD++ + S E+ K W+ + +  NAS      ++G K DL S+ + V  ER 
Sbjct: 135 RNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLLSKEEFVRMERL 194

Query: 430 EQL-AIEYQIKFVETSAKDSLNVEYAF 507
             L A E Q ++   SA+    V   F
Sbjct: 195 AGLAAAELQAEYWSVSARSGFKVTELF 221


>AE014134-3093|AAF53798.1|  256|Drosophila melanogaster CG9994-PA
           protein.
          Length = 256

 Score = 74.9 bits (176), Expect = 1e-13
 Identities = 32/70 (45%), Positives = 50/70 (71%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GD GVGK+++L RF  + +  +   TIG++F  + I +DG++  LQIWDTAGQ
Sbjct: 12  LLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQ 71

Query: 224 ERFRTITTAY 253
           ERFR + T +
Sbjct: 72  ERFRALRTPF 81


>AY121695-1|AAM52022.1|  101|Drosophila melanogaster RE66843p
           protein.
          Length = 101

 Score = 74.1 bits (174), Expect = 2e-13
 Identities = 33/47 (70%), Positives = 41/47 (87%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTID 175
           YD LFKLLLIGDSGVGK+ +L RF++D +  S+ISTIG+DFKIRTI+
Sbjct: 8   YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIN 54


>AY752541-1|AAW31997.1|  185|Drosophila melanogaster CG2885 protein.
          Length = 185

 Score = 73.3 bits (172), Expect = 3e-13
 Identities = 29/62 (46%), Positives = 47/62 (75%)
 Frame = +2

Query: 56  LLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQERFR 235
           L++GDSGVGK+ +L RFS+D F   ++ T+GID K R+++L  + + LQ+WDT+G +RF 
Sbjct: 1   LVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKRFN 60

Query: 236 TI 241
           ++
Sbjct: 61  SL 62



 Score = 71.7 bits (168), Expect = 1e-12
 Identities = 36/85 (42%), Positives = 50/85 (58%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS E+G  
Sbjct: 68  RSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSMEQGFN 127

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    + F E SAK  +NV   FS
Sbjct: 128 YAHRGALGFEEVSAKSGMNVYDIFS 152


>AY081181-1|AAN85553.1|  219|Drosophila melanogaster Rab5 protein.
          Length = 219

 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 33/71 (46%), Positives = 48/71 (67%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +TI ++   VK +IWDTAG
Sbjct: 28  CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAG 87

Query: 221 QERFRTITTAY 253
           QER+ ++   Y
Sbjct: 88  QERYHSLAPMY 98



 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 31/84 (36%), Positives = 50/84 (59%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+ N+ SF+  K W++ + + AS ++   + GNK DL + R V  +  +Q
Sbjct: 100 RGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQ 159

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A E  + F+ETSAK  +NV   F
Sbjct: 160 YAEENGLLFMETSAKTGMNVNDIF 183


>AY081180-1|AAN85552.1|  219|Drosophila melanogaster Rab5 protein.
          Length = 219

 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 33/71 (46%), Positives = 48/71 (67%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +TI ++   VK +IWDTAG
Sbjct: 28  CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAG 87

Query: 221 QERFRTITTAY 253
           QER+ ++   Y
Sbjct: 88  QERYHSLAPMY 98



 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 31/84 (36%), Positives = 50/84 (59%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+ N+ SF+  K W++ + + AS ++   + GNK DL + R V  +  +Q
Sbjct: 100 RGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQ 159

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A E  + F+ETSAK  +NV   F
Sbjct: 160 YAEENGLLFMETSAKTGMNVNDIF 183


>AY060343-1|AAL25382.1|  219|Drosophila melanogaster GH24702p
           protein.
          Length = 219

 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 33/71 (46%), Positives = 48/71 (67%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +TI ++   VK +IWDTAG
Sbjct: 28  CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAG 87

Query: 221 QERFRTITTAY 253
           QER+ ++   Y
Sbjct: 88  QERYHSLAPMY 98



 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 31/84 (36%), Positives = 50/84 (59%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+ N+ SF+  K W++ + + AS ++   + GNK DL + R V  +  +Q
Sbjct: 100 RGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQ 159

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A E  + F+ETSAK  +NV   F
Sbjct: 160 YAEENGLLFMETSAKTGMNVNDIF 183


>AE014134-396|AAN10426.1|  219|Drosophila melanogaster CG3664-PF,
           isoform F protein.
          Length = 219

 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 33/71 (46%), Positives = 48/71 (67%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +TI ++   VK +IWDTAG
Sbjct: 28  CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAG 87

Query: 221 QERFRTITTAY 253
           QER+ ++   Y
Sbjct: 88  QERYHSLAPMY 98



 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 31/84 (36%), Positives = 50/84 (59%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+ N+ SF+  K W++ + + AS ++   + GNK DL + R V  +  +Q
Sbjct: 100 RGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQ 159

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A E  + F+ETSAK  +NV   F
Sbjct: 160 YAEENGLLFMETSAKTGMNVNDIF 183


>AE014134-395|AAN10425.1|  219|Drosophila melanogaster CG3664-PE,
           isoform E protein.
          Length = 219

 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 33/71 (46%), Positives = 48/71 (67%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +TI ++   VK +IWDTAG
Sbjct: 28  CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAG 87

Query: 221 QERFRTITTAY 253
           QER+ ++   Y
Sbjct: 88  QERYHSLAPMY 98



 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 31/84 (36%), Positives = 50/84 (59%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+ N+ SF+  K W++ + + AS ++   + GNK DL + R V  +  +Q
Sbjct: 100 RGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQ 159

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A E  + F+ETSAK  +NV   F
Sbjct: 160 YAEENGLLFMETSAKTGMNVNDIF 183


>AE014134-394|AAN10424.1|  219|Drosophila melanogaster CG3664-PD,
           isoform D protein.
          Length = 219

 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 33/71 (46%), Positives = 48/71 (67%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +TI ++   VK +IWDTAG
Sbjct: 28  CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAG 87

Query: 221 QERFRTITTAY 253
           QER+ ++   Y
Sbjct: 88  QERYHSLAPMY 98



 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 31/84 (36%), Positives = 50/84 (59%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+ N+ SF+  K W++ + + AS ++   + GNK DL + R V  +  +Q
Sbjct: 100 RGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQ 159

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A E  + F+ETSAK  +NV   F
Sbjct: 160 YAEENGLLFMETSAKTGMNVNDIF 183


>AE014134-393|AAN10423.1|  219|Drosophila melanogaster CG3664-PC,
           isoform C protein.
          Length = 219

 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 33/71 (46%), Positives = 48/71 (67%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +TI ++   VK +IWDTAG
Sbjct: 28  CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAG 87

Query: 221 QERFRTITTAY 253
           QER+ ++   Y
Sbjct: 88  QERYHSLAPMY 98



 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 31/84 (36%), Positives = 50/84 (59%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+ N+ SF+  K W++ + + AS ++   + GNK DL + R V  +  +Q
Sbjct: 100 RGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQ 159

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A E  + F+ETSAK  +NV   F
Sbjct: 160 YAEENGLLFMETSAKTGMNVNDIF 183


>AE014134-392|AAN10422.1|  219|Drosophila melanogaster CG3664-PB,
           isoform B protein.
          Length = 219

 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 33/71 (46%), Positives = 48/71 (67%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +TI ++   VK +IWDTAG
Sbjct: 28  CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAG 87

Query: 221 QERFRTITTAY 253
           QER+ ++   Y
Sbjct: 88  QERYHSLAPMY 98



 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 31/84 (36%), Positives = 50/84 (59%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+ N+ SF+  K W++ + + AS ++   + GNK DL + R V  +  +Q
Sbjct: 100 RGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQ 159

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A E  + F+ETSAK  +NV   F
Sbjct: 160 YAEENGLLFMETSAKTGMNVNDIF 183


>AE014134-391|AAF51265.1|  219|Drosophila melanogaster CG3664-PA,
           isoform A protein.
          Length = 219

 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 33/71 (46%), Positives = 48/71 (67%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +TI ++   VK +IWDTAG
Sbjct: 28  CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAG 87

Query: 221 QERFRTITTAY 253
           QER+ ++   Y
Sbjct: 88  QERYHSLAPMY 98



 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 31/84 (36%), Positives = 50/84 (59%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+ N+ SF+  K W++ + + AS ++   + GNK DL + R V  +  +Q
Sbjct: 100 RGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQ 159

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A E  + F+ETSAK  +NV   F
Sbjct: 160 YAEENGLLFMETSAKTGMNVNDIF 183


>AB035671-1|BAA88244.1|  219|Drosophila melanogaster Rab5 protein
           protein.
          Length = 219

 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 33/71 (46%), Positives = 48/71 (67%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +TI ++   VK +IWDTAG
Sbjct: 28  CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAG 87

Query: 221 QERFRTITTAY 253
           QER+ ++   Y
Sbjct: 88  QERYHSLAPMY 98



 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 31/84 (36%), Positives = 50/84 (59%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+ N+ SF+  K W++ + + AS ++   + GNK DL + R V  +  +Q
Sbjct: 100 RGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQ 159

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A E  + F+ETSAK  +NV   F
Sbjct: 160 YAEENGLLFMETSAKTGMNVNDIF 183


>AB035353-1|BAA87879.1|  219|Drosophila melanogaster Drab5 protein.
          Length = 219

 Score = 71.3 bits (167), Expect = 1e-12
 Identities = 33/71 (46%), Positives = 48/71 (67%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +TI ++   VK +IWDTAG
Sbjct: 28  CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAG 87

Query: 221 QERFRTITTAY 253
           QER+ ++   Y
Sbjct: 88  QERYHSLAPMY 98



 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 31/84 (36%), Positives = 50/84 (59%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+ N+ SF+  K W++ + + AS ++   + GNK DL + R V  +  +Q
Sbjct: 100 RGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQ 159

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A E  + F+ETSAK  +NV   F
Sbjct: 160 YAEENGLLFMETSAKTGMNVNDIF 183


>BT001448-1|AAN71203.1|  306|Drosophila melanogaster GH26660p
           protein.
          Length = 306

 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 1/71 (1%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKK-VKLQIWDTAG 220
           L+K+L+IG+ G GKTS + R+    F+ ++ +TIG+DF ++ +  D    V+LQ+WD AG
Sbjct: 103 LYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAG 162

Query: 221 QERFRTITTAY 253
           QERF  +T  Y
Sbjct: 163 QERFGNMTRVY 173


>AY069328-1|AAL39473.1|  388|Drosophila melanogaster LD04613p
           protein.
          Length = 388

 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 1/71 (1%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKK-VKLQIWDTAG 220
           L+K+L+IG+ G GKTS + R+    F+ ++ +TIG+DF ++ +  D    V+LQ+WD AG
Sbjct: 185 LYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAG 244

Query: 221 QERFRTITTAY 253
           QERF  +T  Y
Sbjct: 245 QERFGNMTRVY 255


>AE013599-820|AAF58970.1|  686|Drosophila melanogaster CG8024-PB,
           isoform B protein.
          Length = 686

 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 1/71 (1%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKK-VKLQIWDTAG 220
           L+K+L+IG+ G GKTS + R+    F+ ++ +TIG+DF ++ +  D    V+LQ+WD AG
Sbjct: 483 LYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAG 542

Query: 221 QERFRTITTAY 253
           QERF  +T  Y
Sbjct: 543 QERFGNMTRVY 553


>AE013599-819|AAG22295.2|  385|Drosophila melanogaster CG8024-PA,
           isoform A protein.
          Length = 385

 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 1/71 (1%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKK-VKLQIWDTAG 220
           L+K+L+IG+ G GKTS + R+    F+ ++ +TIG+DF ++ +  D    V+LQ+WD AG
Sbjct: 182 LYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAG 241

Query: 221 QERFRTITTAY 253
           QERF  +T  Y
Sbjct: 242 QERFGNMTRVY 252


>AE013599-818|AAM68818.1|  388|Drosophila melanogaster CG8024-PE,
           isoform E protein.
          Length = 388

 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 1/71 (1%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKK-VKLQIWDTAG 220
           L+K+L+IG+ G GKTS + R+    F+ ++ +TIG+DF ++ +  D    V+LQ+WD AG
Sbjct: 185 LYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAG 244

Query: 221 QERFRTITTAY 253
           QERF  +T  Y
Sbjct: 245 QERFGNMTRVY 255


>AE013599-817|AAM68817.1|  388|Drosophila melanogaster CG8024-PC,
           isoform C protein.
          Length = 388

 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 1/71 (1%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKK-VKLQIWDTAG 220
           L+K+L+IG+ G GKTS + R+    F+ ++ +TIG+DF ++ +  D    V+LQ+WD AG
Sbjct: 185 LYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAG 244

Query: 221 QERFRTITTAY 253
           QERF  +T  Y
Sbjct: 245 QERFGNMTRVY 255


>AE013599-816|AAM68816.2|  222|Drosophila melanogaster CG8024-PD,
           isoform D protein.
          Length = 222

 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 1/71 (1%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKK-VKLQIWDTAG 220
           L+K+L+IG+ G GKTS + R+    F+ ++ +TIG+DF ++ +  D    V+LQ+WD AG
Sbjct: 19  LYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAG 78

Query: 221 QERFRTITTAY 253
           QERF  +T  Y
Sbjct: 79  QERFGNMTRVY 89


>AB035646-1|BAA88238.1|  231|Drosophila melanogaster Rab-related
           protein 1 protein.
          Length = 231

 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 1/71 (1%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKK-VKLQIWDTAG 220
           L+K+L+IG+ G GKTS + R+    F+ ++ +TIG+DF ++ +  D    V+LQ+WD AG
Sbjct: 28  LYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAG 87

Query: 221 QERFRTITTAY 253
           QERF  +T  Y
Sbjct: 88  QERFGNMTRVY 98


>BT003196-1|AAO24951.1|  222|Drosophila melanogaster RE56408p
           protein.
          Length = 222

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 31/71 (43%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKK-VKLQIWDTAG 220
           L+K+L+IG  G GKTS + R+    F+ ++ +TIG+DF ++ +  D    V+LQ+WD AG
Sbjct: 19  LYKILVIGGLGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAG 78

Query: 221 QERFRTITTAY 253
           QERF  +T  Y
Sbjct: 79  QERFGNMTRVY 89


>AY060236-1|AAL25275.1|  207|Drosophila melanogaster GH03685p
           protein.
          Length = 207

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/70 (41%), Positives = 50/70 (71%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GDS VGKTS++ ++    F+  + +TIG DF  + + ++ + V +QIWDTAGQ
Sbjct: 8   LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67

Query: 224 ERFRTITTAY 253
           ERF+++  A+
Sbjct: 68  ERFQSLGVAF 77



 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +LVYDVT   SF+N+ +W       AS  D +    ++LGNK DLD+ RQVS  
Sbjct: 79  RGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVSTR 137

Query: 424 RGEQLA-IEYQIKFVETSAKDSLNVEYAFSL 513
           R +Q    +  I + ETSAK+ +NVE AF +
Sbjct: 138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQV 168


>AM294833-1|CAL26819.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/70 (41%), Positives = 50/70 (71%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GDS VGKTS++ ++    F+  + +TIG DF  + + ++ + V +QIWDTAGQ
Sbjct: 8   LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67

Query: 224 ERFRTITTAY 253
           ERF+++  A+
Sbjct: 68  ERFQSLGVAF 77



 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +LVYDVT   SF+N+ +W       AS  D +    ++LGNK DLD+ RQVS  
Sbjct: 79  RGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVSTR 137

Query: 424 RGEQLA-IEYQIKFVETSAKDSLNVEYAFSL 513
           R +Q    +  I + ETSAK+ +NVE AF +
Sbjct: 138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQV 168


>AM294832-1|CAL26818.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/70 (41%), Positives = 50/70 (71%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GDS VGKTS++ ++    F+  + +TIG DF  + + ++ + V +QIWDTAGQ
Sbjct: 8   LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67

Query: 224 ERFRTITTAY 253
           ERF+++  A+
Sbjct: 68  ERFQSLGVAF 77



 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +LVYDVT   SF+N+ +W       AS  D +    ++LGNK DLD+ RQVS  
Sbjct: 79  RGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVSTR 137

Query: 424 RGEQLA-IEYQIKFVETSAKDSLNVEYAFSL 513
           R +Q    +  I + ETSAK+ +NVE AF +
Sbjct: 138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQV 168


>AM294831-1|CAL26817.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/70 (41%), Positives = 50/70 (71%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GDS VGKTS++ ++    F+  + +TIG DF  + + ++ + V +QIWDTAGQ
Sbjct: 8   LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67

Query: 224 ERFRTITTAY 253
           ERF+++  A+
Sbjct: 68  ERFQSLGVAF 77



 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +LVYDVT   SF+N+ +W       AS  D +    ++LGNK DLD+ RQVS  
Sbjct: 79  RGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVSTR 137

Query: 424 RGEQLA-IEYQIKFVETSAKDSLNVEYAFSL 513
           R +Q    +  I + ETSAK+ +NVE AF +
Sbjct: 138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQV 168


>AM294830-1|CAL26816.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/70 (41%), Positives = 50/70 (71%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GDS VGKTS++ ++    F+  + +TIG DF  + + ++ + V +QIWDTAGQ
Sbjct: 8   LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67

Query: 224 ERFRTITTAY 253
           ERF+++  A+
Sbjct: 68  ERFQSLGVAF 77



 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +LVYDVT   SF+N+ +W       AS  D +    ++LGNK DLD+ RQVS  
Sbjct: 79  RGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVSTR 137

Query: 424 RGEQLA-IEYQIKFVETSAKDSLNVEYAFSL 513
           R +Q    +  I + ETSAK+ +NVE AF +
Sbjct: 138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQV 168


>AM294829-1|CAL26815.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/70 (41%), Positives = 50/70 (71%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GDS VGKTS++ ++    F+  + +TIG DF  + + ++ + V +QIWDTAGQ
Sbjct: 8   LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67

Query: 224 ERFRTITTAY 253
           ERF+++  A+
Sbjct: 68  ERFQSLGVAF 77



 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +LVYDVT   SF+N+ +W       AS  D +    ++LGNK DLD+ RQVS  
Sbjct: 79  RGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVSTR 137

Query: 424 RGEQLA-IEYQIKFVETSAKDSLNVEYAFSL 513
           R +Q    +  I + ETSAK+ +NVE AF +
Sbjct: 138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQV 168


>AM294828-1|CAL26814.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/70 (41%), Positives = 50/70 (71%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GDS VGKTS++ ++    F+  + +TIG DF  + + ++ + V +QIWDTAGQ
Sbjct: 8   LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67

Query: 224 ERFRTITTAY 253
           ERF+++  A+
Sbjct: 68  ERFQSLGVAF 77



 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +LVYDVT   SF+N+ +W       AS  D +    ++LGNK DLD+ RQVS  
Sbjct: 79  RGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVSTR 137

Query: 424 RGEQLA-IEYQIKFVETSAKDSLNVEYAFSL 513
           R +Q    +  I + ETSAK+ +NVE AF +
Sbjct: 138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQV 168


>AM294827-1|CAL26813.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/70 (41%), Positives = 50/70 (71%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GDS VGKTS++ ++    F+  + +TIG DF  + + ++ + V +QIWDTAGQ
Sbjct: 8   LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67

Query: 224 ERFRTITTAY 253
           ERF+++  A+
Sbjct: 68  ERFQSLGVAF 77



 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +LVYDVT   SF+N+ +W       AS  D +    ++LGNK DLD+ RQVS  
Sbjct: 79  RGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVSTR 137

Query: 424 RGEQLA-IEYQIKFVETSAKDSLNVEYAFSL 513
           R +Q    +  I + ETSAK+ +NVE AF +
Sbjct: 138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQV 168


>AM294826-1|CAL26812.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/70 (41%), Positives = 50/70 (71%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GDS VGKTS++ ++    F+  + +TIG DF  + + ++ + V +QIWDTAGQ
Sbjct: 8   LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67

Query: 224 ERFRTITTAY 253
           ERF+++  A+
Sbjct: 68  ERFQSLGVAF 77



 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +LVYDVT   SF+N+ +W       AS  D +    ++LGNK DLD+ RQVS  
Sbjct: 79  RGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVSTR 137

Query: 424 RGEQLA-IEYQIKFVETSAKDSLNVEYAFSL 513
           R +Q    +  I + ETSAK+ +NVE AF +
Sbjct: 138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQV 168


>AM294825-1|CAL26811.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/70 (41%), Positives = 50/70 (71%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GDS VGKTS++ ++    F+  + +TIG DF  + + ++ + V +QIWDTAGQ
Sbjct: 8   LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67

Query: 224 ERFRTITTAY 253
           ERF+++  A+
Sbjct: 68  ERFQSLGVAF 77



 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +LVYDVT   SF+N+ +W       AS  D +    ++LGNK DLD+ RQVS  
Sbjct: 79  RGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVSTR 137

Query: 424 RGEQLA-IEYQIKFVETSAKDSLNVEYAFSL 513
           R +Q    +  I + ETSAK+ +NVE AF +
Sbjct: 138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQV 168


>AM294824-1|CAL26810.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/70 (41%), Positives = 50/70 (71%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GDS VGKTS++ ++    F+  + +TIG DF  + + ++ + V +QIWDTAGQ
Sbjct: 8   LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67

Query: 224 ERFRTITTAY 253
           ERF+++  A+
Sbjct: 68  ERFQSLGVAF 77



 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +LVYDVT   SF+N+ +W       AS  D +    ++LGNK DLD+ RQVS  
Sbjct: 79  RGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVSTR 137

Query: 424 RGEQLA-IEYQIKFVETSAKDSLNVEYAFSL 513
           R +Q    +  I + ETSAK+ +NVE AF +
Sbjct: 138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQV 168


>AM294823-1|CAL26809.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/70 (41%), Positives = 50/70 (71%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GDS VGKTS++ ++    F+  + +TIG DF  + + ++ + V +QIWDTAGQ
Sbjct: 8   LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67

Query: 224 ERFRTITTAY 253
           ERF+++  A+
Sbjct: 68  ERFQSLGVAF 77



 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +LVYDVT   SF+N+ +W       AS  D +    ++LGNK DLD+ RQVS  
Sbjct: 79  RGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVSTR 137

Query: 424 RGEQLA-IEYQIKFVETSAKDSLNVEYAFSL 513
           R +Q    +  I + ETSAK+ +NVE AF +
Sbjct: 138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQV 168


>AF263363-1|AAF73041.1|  207|Drosophila melanogaster small ras-like
           GTPase RAB7 protein.
          Length = 207

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/70 (41%), Positives = 50/70 (71%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GDS VGKTS++ ++    F+  + +TIG DF  + + ++ + V +QIWDTAGQ
Sbjct: 8   LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67

Query: 224 ERFRTITTAY 253
           ERF+++  A+
Sbjct: 68  ERFQSLGVAF 77



 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +LVYDVT   SF+N+ +W       AS  D +    ++LGNK DLD+ RQVS  
Sbjct: 79  RGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVSTR 137

Query: 424 RGEQLA-IEYQIKFVETSAKDSLNVEYAFSL 513
           R +Q    +  I + ETSAK+ +NVE AF +
Sbjct: 138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQV 168


>AF079459-1|AAC32270.1|  207|Drosophila melanogaster small ras-like
           GTPase protein.
          Length = 207

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/70 (41%), Positives = 50/70 (71%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GDS VGKTS++ ++    F+  + +TIG DF  + + ++ + V +QIWDTAGQ
Sbjct: 8   LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67

Query: 224 ERFRTITTAY 253
           ERF+++  A+
Sbjct: 68  ERFQSLGVAF 77



 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +LVYDVT   SF+N+ +W       AS  D +    ++LGNK DLD+ RQVS  
Sbjct: 79  RGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVSTR 137

Query: 424 RGEQLA-IEYQIKFVETSAKDSLNVEYAFSL 513
           R +Q    +  I + ETSAK+ +NVE AF +
Sbjct: 138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQV 168


>AE014297-3431|AAF56218.1|  207|Drosophila melanogaster CG5915-PA
           protein.
          Length = 207

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/70 (41%), Positives = 50/70 (71%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GDS VGKTS++ ++    F+  + +TIG DF  + + ++ + V +QIWDTAGQ
Sbjct: 8   LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67

Query: 224 ERFRTITTAY 253
           ERF+++  A+
Sbjct: 68  ERFQSLGVAF 77



 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +LVYDVT   SF+N+ +W       AS  D +    ++LGNK DLD+ RQVS  
Sbjct: 79  RGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVSTR 137

Query: 424 RGEQLA-IEYQIKFVETSAKDSLNVEYAFSL 513
           R +Q    +  I + ETSAK+ +NVE AF +
Sbjct: 138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQV 168


>AB035672-1|BAA88245.1|  207|Drosophila melanogaster Rab7 protein
           protein.
          Length = 207

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 29/70 (41%), Positives = 50/70 (71%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++GDS VGKTS++ ++    F+  + +TIG DF  + + ++ + V +QIWDTAGQ
Sbjct: 8   LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67

Query: 224 ERFRTITTAY 253
           ERF+++  A+
Sbjct: 68  ERFQSLGVAF 77



 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 39/91 (42%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +LVYDVT   SF+N+ +W       AS  D +    ++LGNK DLD+ RQVS  
Sbjct: 79  RGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVSTR 137

Query: 424 RGEQLA-IEYQIKFVETSAKDSLNVEYAFSL 513
           R +Q    +  I + ETSAK+ +NVE AF +
Sbjct: 138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQV 168


>AE014298-1530|AAF47981.2|  197|Drosophila melanogaster CG32671-PA
           protein.
          Length = 197

 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 36/85 (42%), Positives = 48/85 (56%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS  +G  
Sbjct: 80  RSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHRQVSMAQGFN 139

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    I F E SAK   NV   FS
Sbjct: 140 YAHRQSICFEEVSAKSGRNVYDIFS 164



 Score = 64.9 bits (151), Expect = 1e-10
 Identities = 29/71 (40%), Positives = 48/71 (67%), Gaps = 2/71 (2%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKV--KLQIW 208
           YD  FK++++GDSGVGKT +L RFS++ F     ST+G+D +  +++    ++   LQ+W
Sbjct: 4   YDNPFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGRMLQVW 63

Query: 209 DTAGQERFRTI 241
           DT+  ERF+ +
Sbjct: 64  DTSDDERFKLL 74


>AE014298-1475|AAF46610.2|  197|Drosophila melanogaster CG9807-PA
           protein.
          Length = 197

 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 36/85 (42%), Positives = 48/85 (56%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS  +G  
Sbjct: 80  RSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHRQVSMAQGFN 139

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    I F E SAK   NV   FS
Sbjct: 140 YAHRQSICFEEVSAKSGRNVYDIFS 164



 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 28/71 (39%), Positives = 47/71 (66%), Gaps = 2/71 (2%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKV--KLQIW 208
           YD  FK++++GDSGVGKT +L RFS++ F      T+G+D +  +++    ++   LQ+W
Sbjct: 4   YDNPFKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGRMLQVW 63

Query: 209 DTAGQERFRTI 241
           DT+  ERF+ +
Sbjct: 64  DTSDDERFKLL 74


>BT015987-1|AAV36872.1|  265|Drosophila melanogaster RE54550p
           protein.
          Length = 265

 Score = 68.5 bits (160), Expect = 9e-12
 Identities = 39/86 (45%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIG--------IDFKIRTIDL 178
           M K YD L K+LL+GDS VGK  IL    + +    F S           + +K  TI L
Sbjct: 4   MTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTTTILL 63

Query: 179 DGKKVKLQIWDTAGQERFRTITTAYS 256
           +GK+VKLQ+WDT+GQ RF TI  +YS
Sbjct: 64  EGKRVKLQLWDTSGQGRFCTIIRSYS 89



 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 30/87 (34%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+TN+ SF+ I  W++ ++E+A   + K+++GN+  L  +RQV+ ++
Sbjct: 87  SYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHAPG-IPKVLVGNRLHLAFKRQVAAKQ 145

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            E  A    +   E S   + N+  +F
Sbjct: 146 AETYASRNNMSCFEISPLCNFNIRESF 172


>AE014298-1769|AAN09309.1|  265|Drosophila melanogaster CG1900-PB,
           isoform B protein.
          Length = 265

 Score = 68.5 bits (160), Expect = 9e-12
 Identities = 39/86 (45%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIG--------IDFKIRTIDL 178
           M K YD L K+LL+GDS VGK  IL    + +    F S           + +K  TI L
Sbjct: 4   MTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTTTILL 63

Query: 179 DGKKVKLQIWDTAGQERFRTITTAYS 256
           +GK+VKLQ+WDT+GQ RF TI  +YS
Sbjct: 64  EGKRVKLQLWDTSGQGRFCTIIRSYS 89



 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 30/87 (34%), Positives = 53/87 (60%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ GI+LVYD+TN+ SF+ I  W++ ++E+A   + K+++GN+  L  +RQV+ ++
Sbjct: 87  SYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHAPG-IPKVLVGNRLHLAFKRQVAAKQ 145

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
            E  A    +   E S   + N+  +F
Sbjct: 146 AETYASRNNMSCFEISPLCNFNIRESF 172


>AY752522-1|AAW31978.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 36/85 (42%), Positives = 48/85 (56%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS  +G  
Sbjct: 43  RSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVSMAQGFN 102

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    I F E SAK   NV   FS
Sbjct: 103 YAHRQSICFEEVSAKSGRNVYDIFS 127



 Score = 28.7 bits (61), Expect = 9.2
 Identities = 12/41 (29%), Positives = 25/41 (60%), Gaps = 2/41 (4%)
 Frame = +2

Query: 137 STIGIDFKIRTIDLDGKKV--KLQIWDTAGQERFRTITTAY 253
           ST+G+D +  +++    ++   LQ+WDT+  ERF+ +   +
Sbjct: 1   STVGMDRRECSVEFADWRMGRMLQVWDTSDDERFKLLKATH 41


>AY752521-1|AAW31977.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 36/85 (42%), Positives = 48/85 (56%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS  +G  
Sbjct: 43  RSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVSMAQGFN 102

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    I F E SAK   NV   FS
Sbjct: 103 YAHRQSICFEEVSAKSGRNVYDIFS 127



 Score = 28.7 bits (61), Expect = 9.2
 Identities = 12/41 (29%), Positives = 25/41 (60%), Gaps = 2/41 (4%)
 Frame = +2

Query: 137 STIGIDFKIRTIDLDGKKV--KLQIWDTAGQERFRTITTAY 253
           ST+G+D +  +++    ++   LQ+WDT+  ERF+ +   +
Sbjct: 1   STVGMDRRECSVEFADWRMGRMLQVWDTSDDERFKLLKATH 41


>AY752520-1|AAW31976.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 36/85 (42%), Positives = 48/85 (56%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS  +G  
Sbjct: 43  RSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVSMAQGFN 102

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    I F E SAK   NV   FS
Sbjct: 103 YAHRQSICFEEVSAKSGRNVYDIFS 127



 Score = 28.7 bits (61), Expect = 9.2
 Identities = 12/41 (29%), Positives = 25/41 (60%), Gaps = 2/41 (4%)
 Frame = +2

Query: 137 STIGIDFKIRTIDLDGKKV--KLQIWDTAGQERFRTITTAY 253
           ST+G+D +  +++    ++   LQ+WDT+  ERF+ +   +
Sbjct: 1   STVGMDRRECSVEFADWRMGRMLQVWDTSDDERFKLLKATH 41


>AY752519-1|AAW31975.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 36/85 (42%), Positives = 48/85 (56%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS  +G  
Sbjct: 43  RSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVSMAQGFN 102

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    I F E SAK   NV   FS
Sbjct: 103 YAHRQSICFEEVSAKSGRNVYDIFS 127



 Score = 28.7 bits (61), Expect = 9.2
 Identities = 12/41 (29%), Positives = 25/41 (60%), Gaps = 2/41 (4%)
 Frame = +2

Query: 137 STIGIDFKIRTIDLDGKKV--KLQIWDTAGQERFRTITTAY 253
           ST+G+D +  +++    ++   LQ+WDT+  ERF+ +   +
Sbjct: 1   STVGMDRRECSVEFADWRMGRMLQVWDTSDDERFKLLKATH 41


>AY752518-1|AAW31974.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 36/85 (42%), Positives = 48/85 (56%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS  +G  
Sbjct: 43  RSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVSMAQGFN 102

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    I F E SAK   NV   FS
Sbjct: 103 YAHRQSICFEEVSAKSGRNVYDIFS 127



 Score = 28.7 bits (61), Expect = 9.2
 Identities = 12/41 (29%), Positives = 25/41 (60%), Gaps = 2/41 (4%)
 Frame = +2

Query: 137 STIGIDFKIRTIDLDGKKV--KLQIWDTAGQERFRTITTAY 253
           ST+G+D +  +++    ++   LQ+WDT+  ERF+ +   +
Sbjct: 1   STVGMDRRECSVEFADWRMGRMLQVWDTSDDERFKLLKATH 41


>AY752517-1|AAW31973.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 36/85 (42%), Positives = 48/85 (56%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS  +G  
Sbjct: 43  RSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVSMAQGFN 102

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    I F E SAK   NV   FS
Sbjct: 103 YAHRQSICFEEVSAKSGRNVYDIFS 127



 Score = 28.7 bits (61), Expect = 9.2
 Identities = 12/41 (29%), Positives = 25/41 (60%), Gaps = 2/41 (4%)
 Frame = +2

Query: 137 STIGIDFKIRTIDLDGKKV--KLQIWDTAGQERFRTITTAY 253
           ST+G+D +  +++    ++   LQ+WDT+  ERF+ +   +
Sbjct: 1   STVGMDRRECSVEFADWRMGRMLQVWDTSDDERFKLLKATH 41


>AY752516-1|AAW31972.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 36/85 (42%), Positives = 48/85 (56%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS  +G  
Sbjct: 43  RSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVSMAQGFN 102

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    I F E SAK   NV   FS
Sbjct: 103 YAHRQSICFEEVSAKSGRNVYDIFS 127



 Score = 28.7 bits (61), Expect = 9.2
 Identities = 12/41 (29%), Positives = 25/41 (60%), Gaps = 2/41 (4%)
 Frame = +2

Query: 137 STIGIDFKIRTIDLDGKKV--KLQIWDTAGQERFRTITTAY 253
           ST+G+D +  +++    ++   LQ+WDT+  ERF+ +   +
Sbjct: 1   STVGMDRRECSVEFADWRMGRMLQVWDTSDDERFKLLKATH 41


>AY752515-1|AAW31971.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 36/85 (42%), Positives = 48/85 (56%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS  +G  
Sbjct: 43  RSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVSMAQGFN 102

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    I F E SAK   NV   FS
Sbjct: 103 YAHRQSICFEEVSAKSGRNVYDIFS 127


>AY752514-1|AAW31970.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 36/85 (42%), Positives = 48/85 (56%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS  +G  
Sbjct: 43  RSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVSMAQGFN 102

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    I F E SAK   NV   FS
Sbjct: 103 YAHRQSICFEEVSAKSGRNVYDIFS 127



 Score = 28.7 bits (61), Expect = 9.2
 Identities = 12/41 (29%), Positives = 25/41 (60%), Gaps = 2/41 (4%)
 Frame = +2

Query: 137 STIGIDFKIRTIDLDGKKV--KLQIWDTAGQERFRTITTAY 253
           ST+G+D +  +++    ++   LQ+WDT+  ERF+ +   +
Sbjct: 1   STVGMDRRECSVEFADWRMGRMLQVWDTSDDERFKLLKATH 41


>AY752513-1|AAW31969.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 36/85 (42%), Positives = 48/85 (56%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS  +G  
Sbjct: 43  RSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVSMAQGFN 102

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    I F E SAK   NV   FS
Sbjct: 103 YAHRQSICFEEVSAKSGRNVYDIFS 127



 Score = 28.7 bits (61), Expect = 9.2
 Identities = 12/41 (29%), Positives = 25/41 (60%), Gaps = 2/41 (4%)
 Frame = +2

Query: 137 STIGIDFKIRTIDLDGKKV--KLQIWDTAGQERFRTITTAY 253
           ST+G+D +  +++    ++   LQ+WDT+  ERF+ +   +
Sbjct: 1   STVGMDRRECSVEFADWRMGRMLQVWDTSDDERFKLLKATH 41


>AE014298-1478|AAN09264.1|  197|Drosophila melanogaster CG32673-PA
           protein.
          Length = 197

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 36/85 (42%), Positives = 48/85 (56%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS  +G  
Sbjct: 80  RSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVSMAQGFN 139

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    I F E SAK   NV   FS
Sbjct: 140 YAHRQSICFEEVSAKSGRNVYDIFS 164



 Score = 64.5 bits (150), Expect = 2e-10
 Identities = 29/75 (38%), Positives = 49/75 (65%), Gaps = 2/75 (2%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKV--KLQIW 208
           YD  FK++++GDSGVGKT +L RFS++ F     ST+G+D +  +++    ++   LQ+W
Sbjct: 4   YDNPFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMDRRECSVEFADWRMGRMLQVW 63

Query: 209 DTAGQERFRTITTAY 253
           DT+  ERF+ +   +
Sbjct: 64  DTSDDERFKLLKATH 78


>AE014298-1469|AAN09263.1|  197|Drosophila melanogaster CG32678-PA
           protein.
          Length = 197

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 36/85 (42%), Positives = 48/85 (56%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+LVYD+T+ KSF+NI  W++ I       V  +++GNK D  + RQVS  +G  
Sbjct: 80  RSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVSMAQGFN 139

Query: 436 LAIEYQIKFVETSAKDSLNVEYAFS 510
            A    I F E SAK   NV   FS
Sbjct: 140 YAHRQSICFEEVSAKSGRNVYDIFS 164



 Score = 65.7 bits (153), Expect = 7e-11
 Identities = 30/71 (42%), Positives = 48/71 (67%), Gaps = 2/71 (2%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKV--KLQIW 208
           YD  FK++L+GDSGVGKT +L RFS++ F     ST+G+D +  +++    ++   LQ+W
Sbjct: 4   YDNPFKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGRMLQVW 63

Query: 209 DTAGQERFRTI 241
           DT+  ERF+ +
Sbjct: 64  DTSDDERFKLL 74


>M80535-1|AAA28845.1|  184|Drosophila melanogaster GTP-binding
           protein protein.
          Length = 184

 Score = 66.1 bits (154), Expect = 5e-11
 Identities = 31/86 (36%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNI-EENASADVEKMILGNKCDLDSQRQVSKERG 429
           ++   G +LVY +T + +F ++++    I     + DV  +++GNKCDL+ +R V KE G
Sbjct: 72  MKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELG 131

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
           + LA ++   F+ETSAK  +NV   F
Sbjct: 132 KNLATQFNCAFMETSAKAKVNVNDIF 157



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 21/69 (30%), Positives = 43/69 (62%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           +K++++G  GVGK+++  +F +  F   +  TI   ++ + +++DG++  L+I DTAG E
Sbjct: 4   YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYR-KQVEVDGQQCMLEILDTAGTE 62

Query: 227 RFRTITTAY 253
           +F  +   Y
Sbjct: 63  QFTAMRDLY 71


>DQ138746-1|ABA86352.1|  171|Drosophila melanogaster CG1956 protein.
          Length = 171

 Score = 66.1 bits (154), Expect = 5e-11
 Identities = 31/86 (36%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNI-EENASADVEKMILGNKCDLDSQRQVSKERG 429
           ++   G +LVY +T + +F ++++    I     + DV  +++GNKCDL+ +R V KE G
Sbjct: 65  MKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELG 124

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
           + LA ++   F+ETSAK  +NV   F
Sbjct: 125 KNLATQFNCAFMETSAKAKVNVNDIF 150



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 20/65 (30%), Positives = 39/65 (60%)
 Frame = +2

Query: 59  LIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQERFRT 238
           ++G  GVGK+++  +F +  F   +  TI   ++ + +++DG++  L+I DTAG E+F  
Sbjct: 1   VLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYR-KQVEVDGQQCMLEILDTAGTEQFTA 59

Query: 239 ITTAY 253
           +   Y
Sbjct: 60  MRDLY 64


>AY121688-1|AAM52015.1|  184|Drosophila melanogaster RE42418p
           protein.
          Length = 184

 Score = 66.1 bits (154), Expect = 5e-11
 Identities = 31/86 (36%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNI-EENASADVEKMILGNKCDLDSQRQVSKERG 429
           ++   G +LVY +T + +F ++++    I     + DV  +++GNKCDL+ +R V KE G
Sbjct: 72  MKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELG 131

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
           + LA ++   F+ETSAK  +NV   F
Sbjct: 132 KNLATQFNCAFMETSAKAKVNVNDIF 157



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 21/69 (30%), Positives = 43/69 (62%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           +K++++G  GVGK+++  +F +  F   +  TI   ++ + +++DG++  L+I DTAG E
Sbjct: 4   YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYR-KQVEVDGQQCMLEILDTAGTE 62

Query: 227 RFRTITTAY 253
           +F  +   Y
Sbjct: 63  QFTAMRDLY 71


>AF186654-1|AAF15520.1|  184|Drosophila melanogaster roughened
           protein.
          Length = 184

 Score = 66.1 bits (154), Expect = 5e-11
 Identities = 31/86 (36%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNI-EENASADVEKMILGNKCDLDSQRQVSKERG 429
           ++   G +LVY +T + +F ++++    I     + DV  +++GNKCDL+ +R V KE G
Sbjct: 72  MKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELG 131

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
           + LA ++   F+ETSAK  +NV   F
Sbjct: 132 KNLATQFNCAFMETSAKAKVNVNDIF 157



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 21/69 (30%), Positives = 43/69 (62%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           +K++++G  GVGK+++  +F +  F   +  TI   ++ + +++DG++  L+I DTAG E
Sbjct: 4   YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYR-KQVEVDGQQCMLEILDTAGTE 62

Query: 227 RFRTITTAY 253
           +F  +   Y
Sbjct: 63  QFTAMRDLY 71


>AE014296-375|AAF47583.1|  184|Drosophila melanogaster CG1956-PA
           protein.
          Length = 184

 Score = 66.1 bits (154), Expect = 5e-11
 Identities = 31/86 (36%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNI-EENASADVEKMILGNKCDLDSQRQVSKERG 429
           ++   G +LVY +T + +F ++++    I     + DV  +++GNKCDL+ +R V KE G
Sbjct: 72  MKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELG 131

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
           + LA ++   F+ETSAK  +NV   F
Sbjct: 132 KNLATQFNCAFMETSAKAKVNVNDIF 157



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 21/69 (30%), Positives = 43/69 (62%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           +K++++G  GVGK+++  +F +  F   +  TI   ++ + +++DG++  L+I DTAG E
Sbjct: 4   YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYR-KQVEVDGQQCMLEILDTAGTE 62

Query: 227 RFRTITTAY 253
           +F  +   Y
Sbjct: 63  QFTAMRDLY 71


>AY122200-1|AAM52712.1|  261|Drosophila melanogaster LD47384p
           protein.
          Length = 261

 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 2/70 (2%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNI--SFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           K+L++G  GVGKT ++ R+ ++  +   S + TI + F    I LD  K+KLQIWDTAGQ
Sbjct: 7   KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQ 66

Query: 224 ERFRTITTAY 253
           ER+R +   Y
Sbjct: 67  ERYRAVAPMY 76



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 27/84 (32%), Positives = 44/84 (52%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R +   +LV+D+T  K+F  IK+WI+ +  N    +   ++GNK D+ +QR VS+E    
Sbjct: 78  RNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSREEAFV 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A      + ETS +    +E  F
Sbjct: 138 FATSIGATYFETSTETDQGLEQVF 161


>AF209706-1|AAF21440.1|  261|Drosophila melanogaster Rab-related
           GTP-binding proteinChrowded protein.
          Length = 261

 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 2/70 (2%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNI--SFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           K+L++G  GVGKT ++ R+ ++  +   S + TI + F    I LD  K+KLQIWDTAGQ
Sbjct: 7   KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQ 66

Query: 224 ERFRTITTAY 253
           ER+R +   Y
Sbjct: 67  ERYRAVAPMY 76



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 27/84 (32%), Positives = 44/84 (52%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R +   +LV+D+T  K+F  IK+WI+ +  N    +   ++GNK D+ +QR VS+E    
Sbjct: 78  RNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSREEAFV 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A      + ETS +    +E  F
Sbjct: 138 FATSIGATYFETSTETDQGLEQVF 161


>AE013599-3617|AAF47018.1|  261|Drosophila melanogaster CG3870-PA
           protein.
          Length = 261

 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 2/70 (2%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNI--SFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           K+L++G  GVGKT ++ R+ ++  +   S + TI + F    I LD  K+KLQIWDTAGQ
Sbjct: 7   KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQ 66

Query: 224 ERFRTITTAY 253
           ER+R +   Y
Sbjct: 67  ERYRAVAPMY 76



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 27/84 (32%), Positives = 44/84 (52%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R +   +LV+D+T  K+F  IK+WI+ +  N    +   ++GNK D+ +QR VS+E    
Sbjct: 78  RNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSREEAFV 137

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A      + ETS +    +E  F
Sbjct: 138 FATSIGATYFETSTETDQGLEQVF 161


>AY071647-1|AAL49269.1|  213|Drosophila melanogaster RE70650p
           protein.
          Length = 213

 Score = 62.5 bits (145), Expect = 6e-10
 Identities = 29/70 (41%), Positives = 47/70 (67%), Gaps = 2/70 (2%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAF--NISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           K++L GD GVGK+S+  RF+ + F  +    ST+G+D   R   ++ K++KLQ+WDT G 
Sbjct: 10  KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGM 69

Query: 224 ERFRTITTAY 253
           ER  ++T++Y
Sbjct: 70  ERVASVTSSY 79


>AE014296-128|AAF47406.1|  213|Drosophila melanogaster CG12015-PA
           protein.
          Length = 213

 Score = 62.5 bits (145), Expect = 6e-10
 Identities = 29/70 (41%), Positives = 47/70 (67%), Gaps = 2/70 (2%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAF--NISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           K++L GD GVGK+S+  RF+ + F  +    ST+G+D   R   ++ K++KLQ+WDT G 
Sbjct: 10  KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGM 69

Query: 224 ERFRTITTAY 253
           ER  ++T++Y
Sbjct: 70  ERVASVTSSY 79


>M16429-1|AAA28847.1|  189|Drosophila melanogaster protein (
           D.melanogaster Dmras85Dgene, exon 3. ).
          Length = 189

 Score = 60.9 bits (141), Expect = 2e-09
 Identities = 34/86 (39%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKERG 429
           +R   G +LV+ V + KSFE+I  +   I+    A+   M+L GNKCDL S   V+ E+ 
Sbjct: 72  MRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLASWN-VNNEQA 130

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
            ++A +Y I ++ETSAK  + V+ AF
Sbjct: 131 REVAKQYGIPYIETSAKTRMGVDDAF 156



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 21/69 (30%), Positives = 40/69 (57%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           +KL+++G  GVGK+++  +  ++ F   +  TI   ++ + + +DG+   L I DTAGQE
Sbjct: 4   YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVV-IDGETCLLDILDTAGQE 62

Query: 227 RFRTITTAY 253
            +  +   Y
Sbjct: 63  EYSAMRDQY 71


>AY094888-1|AAM11241.1|  189|Drosophila melanogaster RE53955p
           protein.
          Length = 189

 Score = 60.9 bits (141), Expect = 2e-09
 Identities = 34/86 (39%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKERG 429
           +R   G +LV+ V + KSFE+I  +   I+    A+   M+L GNKCDL S   V+ E+ 
Sbjct: 72  MRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLASWN-VNNEQA 130

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
            ++A +Y I ++ETSAK  + V+ AF
Sbjct: 131 REVAKQYGIPYIETSAKTRMGVDDAF 156



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 21/69 (30%), Positives = 40/69 (57%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           +KL+++G  GVGK+++  +  ++ F   +  TI   ++ + + +DG+   L I DTAGQE
Sbjct: 4   YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVV-IDGETCLLDILDTAGQE 62

Query: 227 RFRTITTAY 253
            +  +   Y
Sbjct: 63  EYSAMRDQY 71


>AY089541-1|AAL90279.1|  189|Drosophila melanogaster LD17536p
           protein.
          Length = 189

 Score = 60.9 bits (141), Expect = 2e-09
 Identities = 34/86 (39%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKERG 429
           +R   G +LV+ V + KSFE+I  +   I+    A+   M+L GNKCDL S   V+ E+ 
Sbjct: 72  MRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLASWN-VNNEQA 130

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
            ++A +Y I ++ETSAK  + V+ AF
Sbjct: 131 REVAKQYGIPYIETSAKTRMGVDDAF 156



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 21/69 (30%), Positives = 40/69 (57%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           +KL+++G  GVGK+++  +  ++ F   +  TI   ++ + + +DG+   L I DTAGQE
Sbjct: 4   YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVV-IDGETCLLDILDTAGQE 62

Query: 227 RFRTITTAY 253
            +  +   Y
Sbjct: 63  EYSAMRDQY 71


>AF186648-1|AAF15514.1|  189|Drosophila melanogaster Ras1 protein.
          Length = 189

 Score = 60.9 bits (141), Expect = 2e-09
 Identities = 34/86 (39%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKERG 429
           +R   G +LV+ V + KSFE+I  +   I+    A+   M+L GNKCDL S   V+ E+ 
Sbjct: 72  MRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLASWN-VNNEQA 130

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
            ++A +Y I ++ETSAK  + V+ AF
Sbjct: 131 REVAKQYGIPYIETSAKTRMGVDDAF 156



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 21/69 (30%), Positives = 40/69 (57%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           +KL+++G  GVGK+++  +  ++ F   +  TI   ++ + + +DG+   L I DTAGQE
Sbjct: 4   YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVV-IDGETCLLDILDTAGQE 62

Query: 227 RFRTITTAY 253
            +  +   Y
Sbjct: 63  EYSAMRDQY 71


>AE014297-953|AAF54388.1|  189|Drosophila melanogaster CG9375-PA
           protein.
          Length = 189

 Score = 60.9 bits (141), Expect = 2e-09
 Identities = 34/86 (39%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKERG 429
           +R   G +LV+ V + KSFE+I  +   I+    A+   M+L GNKCDL S   V+ E+ 
Sbjct: 72  MRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDLASWN-VNNEQA 130

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
            ++A +Y I ++ETSAK  + V+ AF
Sbjct: 131 REVAKQYGIPYIETSAKTRMGVDDAF 156



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 21/69 (30%), Positives = 40/69 (57%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           +KL+++G  GVGK+++  +  ++ F   +  TI   ++ + + +DG+   L I DTAGQE
Sbjct: 4   YKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVV-IDGETCLLDILDTAGQE 62

Query: 227 RFRTITTAY 253
            +  +   Y
Sbjct: 63  EYSAMRDQY 71


>K01960-1|AAA28846.1|  189|Drosophila melanogaster protein (
           D.melanogaster chromosome3 locus 85D Dras1 gene,
           complete. ).
          Length = 189

 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 33/86 (38%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKERG 429
           +R   G +LV+ + + KSFE+I  +   I+    A+   M+L GNKCDL S   V+ E+ 
Sbjct: 72  MRTGEGFLLVFAINSAKSFEDIGTYREQIKHVKDAEEVPMVLAGNKCDLASWN-VNNEQA 130

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
            ++A +Y I ++ETSAK  + V+ AF
Sbjct: 131 REVAKQYGIPYIETSAKTRMGVDDAF 156



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 21/69 (30%), Positives = 39/69 (56%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           +KL+++G  GVGK+++  +  ++ F   +  TI   ++ +   +DG+   L I DTAGQE
Sbjct: 4   YKLVVVGPGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQRF-IDGETCLLDILDTAGQE 62

Query: 227 RFRTITTAY 253
            +  +   Y
Sbjct: 63  EYSAMRDQY 71


>BT029985-1|ABM92859.1|  207|Drosophila melanogaster RE30129p
           protein.
          Length = 207

 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 33/94 (35%), Positives = 55/94 (58%), Gaps = 1/94 (1%)
 Frame = +1

Query: 214 CWSREIPYNNNS-ILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKC 390
           C   E  Y N + +++ + G++LVY +T+ KSF    N+IR  + +  +D    +  NK 
Sbjct: 71  CPKAEDEYPNAAELVQWADGLLLVYSITDRKSF----NYIRRAKSDLQSDTPVQLCANKV 126

Query: 391 DLDSQRQVSKERGEQLAIEYQIKFVETSAKDSLN 492
           D+   RQVS++ GE LA +++ KF E SA D ++
Sbjct: 127 DMVHLRQVSRDEGEILAKDFECKFSEVSAADHVD 160


>AE014296-1145|AAF50649.2|  207|Drosophila melanogaster CG8519-PA
           protein.
          Length = 207

 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 33/94 (35%), Positives = 55/94 (58%), Gaps = 1/94 (1%)
 Frame = +1

Query: 214 CWSREIPYNNNS-ILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKC 390
           C   E  Y N + +++ + G++LVY +T+ KSF    N+IR  + +  +D    +  NK 
Sbjct: 71  CPKAEDEYPNAAELVQWADGLLLVYSITDRKSF----NYIRRAKSDLQSDTPVQLCANKV 126

Query: 391 DLDSQRQVSKERGEQLAIEYQIKFVETSAKDSLN 492
           D+   RQVS++ GE LA +++ KF E SA D ++
Sbjct: 127 DMVHLRQVSRDEGEILAKDFECKFSEVSAADHVD 160


>L38311-1|AAA67042.1|  192|Drosophila melanogaster Rho1 protein.
          Length = 192

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 26/61 (42%), Positives = 43/61 (70%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           KL+++GD   GKT +L  FS+D F   ++ T+  ++ +  I++DGK+V+L +WDTAGQE 
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY-VADIEVDGKQVELALWDTAGQED 65

Query: 230 F 232
           +
Sbjct: 66  Y 66


>BT012453-1|AAS93724.1|  182|Drosophila melanogaster RE63021p
           protein.
          Length = 182

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 31/89 (34%), Positives = 53/89 (59%), Gaps = 3/89 (3%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENI---KNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           ++   G +++Y +TN ++F++I   KN I  ++ +  A +  +++ NK DLD QR+VS  
Sbjct: 72  IKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPI--LLVANKFDLDCQREVSTA 129

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAFS 510
            G  LA  +   F+E SAKD +NV   F+
Sbjct: 130 EGNALAQLWDCPFIEASAKDRINVNEVFA 158



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 24/69 (34%), Positives = 40/69 (57%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FK++++G  GVGK+++  +F    F   +  TI  DF  + I++D     L+I DTAG E
Sbjct: 4   FKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIE-DFYRKEIEVDSSPCVLEILDTAGTE 62

Query: 227 RFRTITTAY 253
           +F ++   Y
Sbjct: 63  QFASMRDLY 71


>BT010085-1|AAQ22554.1|  192|Drosophila melanogaster LD03419p
           protein.
          Length = 192

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 26/61 (42%), Positives = 43/61 (70%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           KL+++GD   GKT +L  FS+D F   ++ T+  ++ +  I++DGK+V+L +WDTAGQE 
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY-VADIEVDGKQVELALWDTAGQED 65

Query: 230 F 232
           +
Sbjct: 66  Y 66


>AY119536-1|AAM50190.1|  192|Drosophila melanogaster GH20776p
           protein.
          Length = 192

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 26/61 (42%), Positives = 43/61 (70%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           KL+++GD   GKT +L  FS+D F   ++ T+  ++ +  I++DGK+V+L +WDTAGQE 
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY-VADIEVDGKQVELALWDTAGQED 65

Query: 230 F 232
           +
Sbjct: 66  Y 66


>AF177874-1|AAF01186.1|  192|Drosophila melanogaster small GTPase
           RHO1 protein.
          Length = 192

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 26/61 (42%), Positives = 43/61 (70%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           KL+++GD   GKT +L  FS+D F   ++ T+  ++ +  I++DGK+V+L +WDTAGQE 
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY-VADIEVDGKQVELALWDTAGQED 65

Query: 230 F 232
           +
Sbjct: 66  Y 66


>AF177873-1|AAF01185.1|  192|Drosophila melanogaster small GTPase
           RHO1 protein.
          Length = 192

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 26/61 (42%), Positives = 43/61 (70%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           KL+++GD   GKT +L  FS+D F   ++ T+  ++ +  I++DGK+V+L +WDTAGQE 
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY-VADIEVDGKQVELALWDTAGQED 65

Query: 230 F 232
           +
Sbjct: 66  Y 66


>AF177872-1|AAF01184.1|  192|Drosophila melanogaster small GTPase
           RHO1 protein.
          Length = 192

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 26/61 (42%), Positives = 43/61 (70%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           KL+++GD   GKT +L  FS+D F   ++ T+  ++ +  I++DGK+V+L +WDTAGQE 
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY-VADIEVDGKQVELALWDTAGQED 65

Query: 230 F 232
           +
Sbjct: 66  Y 66


>AF177871-1|AAF01183.1|  192|Drosophila melanogaster small GTPase
           RHO1 protein.
          Length = 192

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 26/61 (42%), Positives = 43/61 (70%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           KL+++GD   GKT +L  FS+D F   ++ T+  ++ +  I++DGK+V+L +WDTAGQE 
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY-VADIEVDGKQVELALWDTAGQED 65

Query: 230 F 232
           +
Sbjct: 66  Y 66


>AF111427-1|AAC98693.1|  182|Drosophila melanogaster Ras-related
           protein 2-like protein protein.
          Length = 182

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 31/89 (34%), Positives = 53/89 (59%), Gaps = 3/89 (3%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENI---KNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           ++   G +++Y +TN ++F++I   KN I  ++ +  A +  +++ NK DLD QR+VS  
Sbjct: 72  IKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPI--LLVANKFDLDCQREVSTA 129

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAFS 510
            G  LA  +   F+E SAKD +NV   F+
Sbjct: 130 EGNALAQLWDCPFIEASAKDRINVNEVFA 158



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 24/69 (34%), Positives = 40/69 (57%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FK++++G  GVGK+++  +F    F   +  TI  DF  + I++D     L+I DTAG E
Sbjct: 4   FKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIE-DFYRKEIEVDSSPCVLEILDTAGTE 62

Query: 227 RFRTITTAY 253
           +F ++   Y
Sbjct: 63  QFASMRDLY 71


>AE013599-3799|AAF47155.1|  182|Drosophila melanogaster CG3204-PA,
           isoform A protein.
          Length = 182

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 31/89 (34%), Positives = 53/89 (59%), Gaps = 3/89 (3%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENI---KNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           ++   G +++Y +TN ++F++I   KN I  ++ +  A +  +++ NK DLD QR+VS  
Sbjct: 72  IKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPI--LLVANKFDLDCQREVSTA 129

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAFS 510
            G  LA  +   F+E SAKD +NV   F+
Sbjct: 130 EGNALAQLWDCPFIEASAKDRINVNEVFA 158



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 24/69 (34%), Positives = 40/69 (57%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FK++++G  GVGK+++  +F    F   +  TI  DF  + I++D     L+I DTAG E
Sbjct: 4   FKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIE-DFYRKEIEVDSSPCVLEILDTAGTE 62

Query: 227 RFRTITTAY 253
           +F ++   Y
Sbjct: 63  QFASMRDLY 71


>AE013599-2180|AAS64844.1|  192|Drosophila melanogaster CG8416-PG,
           isoform G protein.
          Length = 192

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 26/61 (42%), Positives = 43/61 (70%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           KL+++GD   GKT +L  FS+D F   ++ T+  ++ +  I++DGK+V+L +WDTAGQE 
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY-VADIEVDGKQVELALWDTAGQED 65

Query: 230 F 232
           +
Sbjct: 66  Y 66


>AE013599-2179|AAS64843.1|  192|Drosophila melanogaster CG8416-PF,
           isoform F protein.
          Length = 192

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 26/61 (42%), Positives = 43/61 (70%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           KL+++GD   GKT +L  FS+D F   ++ T+  ++ +  I++DGK+V+L +WDTAGQE 
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY-VADIEVDGKQVELALWDTAGQED 65

Query: 230 F 232
           +
Sbjct: 66  Y 66


>AE013599-2178|AAS64842.1|  192|Drosophila melanogaster CG8416-PE,
           isoform E protein.
          Length = 192

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 26/61 (42%), Positives = 43/61 (70%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           KL+++GD   GKT +L  FS+D F   ++ T+  ++ +  I++DGK+V+L +WDTAGQE 
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY-VADIEVDGKQVELALWDTAGQED 65

Query: 230 F 232
           +
Sbjct: 66  Y 66


>AE013599-2177|AAM70946.1|  192|Drosophila melanogaster CG8416-PD,
           isoform D protein.
          Length = 192

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 26/61 (42%), Positives = 43/61 (70%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           KL+++GD   GKT +L  FS+D F   ++ T+  ++ +  I++DGK+V+L +WDTAGQE 
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY-VADIEVDGKQVELALWDTAGQED 65

Query: 230 F 232
           +
Sbjct: 66  Y 66


>AE013599-2176|AAM70945.1|  192|Drosophila melanogaster CG8416-PC,
           isoform C protein.
          Length = 192

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 26/61 (42%), Positives = 43/61 (70%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           KL+++GD   GKT +L  FS+D F   ++ T+  ++ +  I++DGK+V+L +WDTAGQE 
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY-VADIEVDGKQVELALWDTAGQED 65

Query: 230 F 232
           +
Sbjct: 66  Y 66


>AE013599-2175|AAF58066.1|  192|Drosophila melanogaster CG8416-PB,
           isoform B protein.
          Length = 192

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 26/61 (42%), Positives = 43/61 (70%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           KL+++GD   GKT +L  FS+D F   ++ T+  ++ +  I++DGK+V+L +WDTAGQE 
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY-VADIEVDGKQVELALWDTAGQED 65

Query: 230 F 232
           +
Sbjct: 66  Y 66


>AE013599-2174|AAM70944.1|  192|Drosophila melanogaster CG8416-PA,
           isoform A protein.
          Length = 192

 Score = 59.7 bits (138), Expect = 4e-09
 Identities = 26/61 (42%), Positives = 43/61 (70%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           KL+++GD   GKT +L  FS+D F   ++ T+  ++ +  I++DGK+V+L +WDTAGQE 
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY-VADIEVDGKQVELALWDTAGQED 65

Query: 230 F 232
           +
Sbjct: 66  Y 66


>AY070523-1|AAL47994.1|  217|Drosophila melanogaster GH25818p
           protein.
          Length = 217

 Score = 59.3 bits (137), Expect = 6e-09
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           +FKL+LIGD G GKT+++ R     F + + +T+G++ +    + +    ++ +WDTAGQ
Sbjct: 10  IFKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWDTAGQ 69

Query: 224 ERFRTITTAYSV 259
           ER+  +   Y V
Sbjct: 70  ERYGGLRDGYFV 81



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 21/78 (26%), Positives = 42/78 (53%)
 Frame = +1

Query: 274 MLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQLAIEYQ 453
           ++++DV +  ++ N+K W R++      ++  +I GNK D+    + + ++G     +  
Sbjct: 87  IIMFDVASSNTYNNVKRWHRDL-VRVCGNIPIVICGNKVDI--MHKKTWKKGVDFDRKTN 143

Query: 454 IKFVETSAKDSLNVEYAF 507
           I  +E SAK + NVE  F
Sbjct: 144 IYLIEMSAKSNYNVEKPF 161


>AE014296-2503|AAF49642.1|  217|Drosophila melanogaster CG7815-PA
           protein.
          Length = 217

 Score = 59.3 bits (137), Expect = 6e-09
 Identities = 25/72 (34%), Positives = 44/72 (61%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           +FKL+LIGD G GKT+++ R     F + + +T+G++ +    + +    ++ +WDTAGQ
Sbjct: 10  IFKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWDTAGQ 69

Query: 224 ERFRTITTAYSV 259
           ER+  +   Y V
Sbjct: 70  ERYGGLRDGYFV 81



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 21/78 (26%), Positives = 42/78 (53%)
 Frame = +1

Query: 274 MLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQLAIEYQ 453
           ++++DV +  ++ N+K W R++      ++  +I GNK D+    + + ++G     +  
Sbjct: 87  IIMFDVASSNTYNNVKRWHRDL-VRVCGNIPIVICGNKVDI--MHKKTWKKGVDFDRKTN 143

Query: 454 IKFVETSAKDSLNVEYAF 507
           I  +E SAK + NVE  F
Sbjct: 144 IYLIEMSAKSNYNVEKPF 161


>U15967-3|AAB60243.1|  192|Drosophila melanogaster small GTP binding
           protein protein.
          Length = 192

 Score = 57.6 bits (133), Expect = 2e-08
 Identities = 31/86 (36%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKERG 429
           +R   G +LV+ + +  SF+ I  + R I      D   M++ GNKCDL  Q+QVS E  
Sbjct: 74  MRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEEA 133

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
           +  +    I ++E SAK  +NV+ AF
Sbjct: 134 QNTSRNLMIPYIECSAKLRVNVDQAF 159



 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 25/69 (36%), Positives = 38/69 (55%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           +KL+++G  GVGK++I  +F +  F   +  TI  D   +  ++D    KL I DTAGQE
Sbjct: 6   YKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIE-DSYTKQCNIDDVPAKLDILDTAGQE 64

Query: 227 RFRTITTAY 253
            F  +   Y
Sbjct: 65  EFSAMREQY 73


>M16431-1|AAA28849.1|  195|Drosophila melanogaster protein (
           D.melanogaster (Dmras64B)Dras2 gene, exon 3. ).
          Length = 195

 Score = 57.6 bits (133), Expect = 2e-08
 Identities = 31/86 (36%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKERG 429
           +R   G +LV+ + +  SF+ I  + R I      D   M++ GNKCDL  Q+QVS E  
Sbjct: 77  MRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEEA 136

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
           +  +    I ++E SAK  +NV+ AF
Sbjct: 137 QNTSRNLMIPYIECSAKLRVNVDQAF 162



 Score = 39.5 bits (88), Expect = 0.005
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDF--KIRTIDLDGKKVKLQIWDTAG 220
           +KL+++G  GVGK++I  +F +  F   +  TI   +  +    D+    +   + DTAG
Sbjct: 6   YKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDIHNNLIFYLVLDTAG 65

Query: 221 QERFRTITTAY 253
           QE F  +   Y
Sbjct: 66  QEEFSAMREQY 76


>M10804-1|AAA99202.1|  195|Drosophila melanogaster ras protein
           protein.
          Length = 195

 Score = 57.6 bits (133), Expect = 2e-08
 Identities = 31/86 (36%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKERG 429
           +R   G +LV+ + +  SF+ I  + R I      D   M++ GNKCDL  Q+QVS E  
Sbjct: 77  MRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEEA 136

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
           +  +    I ++E SAK  +NV+ AF
Sbjct: 137 QNTSRNLMIPYIECSAKLRVNVDQAF 162



 Score = 39.5 bits (88), Expect = 0.005
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDF--KIRTIDLDGKKVKLQIWDTAG 220
           +KL+++G  GVGK++I  +F +  F   +  TI   +  +    D+    +   + DTAG
Sbjct: 6   YKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDIHNNLIFYLVLDTAG 65

Query: 221 QERFRTITTAY 253
           QE F  +   Y
Sbjct: 66  QEEFSAMREQY 76


>AY119135-1|AAM50995.1|  192|Drosophila melanogaster RE36103p
           protein.
          Length = 192

 Score = 57.6 bits (133), Expect = 2e-08
 Identities = 31/86 (36%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKERG 429
           +R   G +LV+ + +  SF+ I  + R I      D   M++ GNKCDL  Q+QVS E  
Sbjct: 74  MRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEEA 133

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
           +  +    I ++E SAK  +NV+ AF
Sbjct: 134 QNTSRNLMIPYIECSAKLRVNVDQAF 159



 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 25/69 (36%), Positives = 38/69 (55%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           +KL+++G  GVGK++I  +F +  F   +  TI  D   +  ++D    KL I DTAGQE
Sbjct: 6   YKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIE-DSYTKQCNIDDVPAKLDILDTAGQE 64

Query: 227 RFRTITTAY 253
            F  +   Y
Sbjct: 65  EFSAMREQY 73


>AF186651-1|AAF15517.1|  165|Drosophila melanogaster TC21
           ras-related protein.
          Length = 165

 Score = 57.6 bits (133), Expect = 2e-08
 Identities = 31/86 (36%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKERG 429
           +R   G +LV+ + +  SF+ I  + R I      D   M++ GNKCDL  Q+QVS E  
Sbjct: 47  MRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEEA 106

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
           +  +    I ++E SAK  +NV+ AF
Sbjct: 107 QNTSRNLMIPYIECSAKLRVNVDQAF 132


>AE014296-774|AAF47845.2|  192|Drosophila melanogaster CG1167-PA
           protein.
          Length = 192

 Score = 57.6 bits (133), Expect = 2e-08
 Identities = 31/86 (36%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKERG 429
           +R   G +LV+ + +  SF+ I  + R I      D   M++ GNKCDL  Q+QVS E  
Sbjct: 74  MRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEEA 133

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
           +  +    I ++E SAK  +NV+ AF
Sbjct: 134 QNTSRNLMIPYIECSAKLRVNVDQAF 159



 Score = 47.6 bits (108), Expect = 2e-05
 Identities = 25/69 (36%), Positives = 38/69 (55%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           +KL+++G  GVGK++I  +F +  F   +  TI  D   +  ++D    KL I DTAGQE
Sbjct: 6   YKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIE-DSYTKQCNIDDVPAKLDILDTAGQE 64

Query: 227 RFRTITTAY 253
            F  +   Y
Sbjct: 65  EFSAMREQY 73


>AY094697-1|AAM11050.1|  182|Drosophila melanogaster GH10361p
           protein.
          Length = 182

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 30/77 (38%), Positives = 50/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query: 268 GIMLVYDVTNEKSFENIKN-WIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQLAI 444
           G +LVY +T++KSFE +K  + + ++      V  +++GNK DL  +R VS E G++LA 
Sbjct: 79  GYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGKKLAE 138

Query: 445 EYQIKFVETSAKDSLNV 495
            ++  F+ETSAK + +V
Sbjct: 139 SWRAAFLETSAKQNESV 155



 Score = 34.3 bits (75), Expect = 0.18
 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 1/92 (1%)
 Frame = +2

Query: 53  LLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDF-KIRTIDLDGKKVKLQIWDTAGQER 229
           + ++G   VGK+S+  +F E  F  S+  TI   F KI  +      VKL   DTAGQ+ 
Sbjct: 8   IAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLI--DTAGQDE 65

Query: 230 FRTITTAYSVVLWELCLSTMLRMRRALKTLRI 325
           +      YS+      L   +  +++ + ++I
Sbjct: 66  YSIFPVQYSMDYHGYVLVYSITSQKSFEVVKI 97


>AE014297-281|AAF52005.3|  182|Drosophila melanogaster CG1081-PB,
           isoform B protein.
          Length = 182

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 30/77 (38%), Positives = 50/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query: 268 GIMLVYDVTNEKSFENIKN-WIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQLAI 444
           G +LVY +T++KSFE +K  + + ++      V  +++GNK DL  +R VS E G++LA 
Sbjct: 79  GYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGKKLAE 138

Query: 445 EYQIKFVETSAKDSLNV 495
            ++  F+ETSAK + +V
Sbjct: 139 SWRAAFLETSAKQNESV 155



 Score = 34.3 bits (75), Expect = 0.18
 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 1/92 (1%)
 Frame = +2

Query: 53  LLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDF-KIRTIDLDGKKVKLQIWDTAGQER 229
           + ++G   VGK+S+  +F E  F  S+  TI   F KI  +      VKL   DTAGQ+ 
Sbjct: 8   IAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLI--DTAGQDE 65

Query: 230 FRTITTAYSVVLWELCLSTMLRMRRALKTLRI 325
           +      YS+      L   +  +++ + ++I
Sbjct: 66  YSIFPVQYSMDYHGYVLVYSITSQKSFEVVKI 97


>AE014297-280|AAF52004.3|  182|Drosophila melanogaster CG1081-PA,
           isoform A protein.
          Length = 182

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 30/77 (38%), Positives = 50/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query: 268 GIMLVYDVTNEKSFENIKN-WIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQLAI 444
           G +LVY +T++KSFE +K  + + ++      V  +++GNK DL  +R VS E G++LA 
Sbjct: 79  GYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGKKLAE 138

Query: 445 EYQIKFVETSAKDSLNV 495
            ++  F+ETSAK + +V
Sbjct: 139 SWRAAFLETSAKQNESV 155



 Score = 34.3 bits (75), Expect = 0.18
 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 1/92 (1%)
 Frame = +2

Query: 53  LLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDF-KIRTIDLDGKKVKLQIWDTAGQER 229
           + ++G   VGK+S+  +F E  F  S+  TI   F KI  +      VKL   DTAGQ+ 
Sbjct: 8   IAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLI--DTAGQDE 65

Query: 230 FRTITTAYSVVLWELCLSTMLRMRRALKTLRI 325
           +      YS+      L   +  +++ + ++I
Sbjct: 66  YSIFPVQYSMDYHGYVLVYSITSQKSFEVVKI 97


>K01962-1|AAA28848.1|  187|Drosophila melanogaster protein (
           D.melanogaster chromosome3 locus 64B Dras2 gene, exon 2
           and flanks. ).
          Length = 187

 Score = 56.4 bits (130), Expect = 4e-08
 Identities = 31/86 (36%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKERG 429
           +R   G +LV+ + +  SF+ I  + R I      D   M++ GNKCDL  Q+QVS E  
Sbjct: 69  MRSGEGFLLVFALNDHFSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEEA 128

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
           +  +    I ++E SAK  +NV+ AF
Sbjct: 129 QNTSRNLMIPYIECSAKLRVNVDQAF 154


>BT003574-1|AAO39578.1|  216|Drosophila melanogaster LD40852p
           protein.
          Length = 216

 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 22/71 (30%), Positives = 39/71 (54%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FK +L+GD G GKT+ + R     F   +++T+G++        +   ++  +WDTAGQE
Sbjct: 11  FKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTAGQE 70

Query: 227 RFRTITTAYSV 259
           +F  +   Y +
Sbjct: 71  KFGGLRDGYYI 81



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 20/78 (25%), Positives = 44/78 (56%)
 Frame = +1

Query: 274 MLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQLAIEYQ 453
           ++++DVT+  +++N+ NW R++      ++  ++ GNK D+   R+V K +      +  
Sbjct: 87  VIMFDVTSRVTYKNVPNWHRDL-VRVCENIPIVLCGNKVDI-KDRKV-KAKSIVFHRKKN 143

Query: 454 IKFVETSAKDSLNVEYAF 507
           +++ + SAK + N E  F
Sbjct: 144 LQYYDISAKSNYNFEKPF 161


>AY070533-1|AAL48004.1|  216|Drosophila melanogaster GM14354p
           protein.
          Length = 216

 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 22/71 (30%), Positives = 39/71 (54%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FK +L+GD G GKT+ + R     F   +++T+G++        +   ++  +WDTAGQE
Sbjct: 11  FKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTAGQE 70

Query: 227 RFRTITTAYSV 259
           +F  +   Y +
Sbjct: 71  KFGGLRDGYYI 81



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 20/78 (25%), Positives = 44/78 (56%)
 Frame = +1

Query: 274 MLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQLAIEYQ 453
           ++++DVT+  +++N+ NW R++      ++  ++ GNK D+   R+V K +      +  
Sbjct: 87  VIMFDVTSRVTYKNVPNWHRDL-VRVCENIPIVLCGNKVDI-KDRKV-KAKSIVFHRKKN 143

Query: 454 IKFVETSAKDSLNVEYAF 507
           +++ + SAK + N E  F
Sbjct: 144 LQYYDISAKSNYNFEKPF 161


>AY061398-1|AAL28946.1|  216|Drosophila melanogaster LD32416p
           protein.
          Length = 216

 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 22/71 (30%), Positives = 39/71 (54%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FK +L+GD G GKT+ + R     F   +++T+G++        +   ++  +WDTAGQE
Sbjct: 11  FKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTAGQE 70

Query: 227 RFRTITTAYSV 259
           +F  +   Y +
Sbjct: 71  KFGGLRDGYYI 81



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 20/78 (25%), Positives = 44/78 (56%)
 Frame = +1

Query: 274 MLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQLAIEYQ 453
           ++++DVT+  +++N+ NW R++      ++  ++ GNK D+   R+V K +      +  
Sbjct: 87  VIMFDVTSRVTYKNVPNWHRDL-VRVCENIPIVLCGNKVDI-KDRKV-KAKSIVFHRKKN 143

Query: 454 IKFVETSAKDSLNVEYAF 507
           +++ + SAK + N E  F
Sbjct: 144 LQYYDISAKSNYNFEKPF 161


>AF233584-1|AAF60289.1|  216|Drosophila melanogaster Ran10A protein.
          Length = 216

 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 22/71 (30%), Positives = 39/71 (54%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FK +L+GD G GKT+ + R     F   +++T+G++        +   ++  +WDTAGQE
Sbjct: 11  FKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTAGQE 70

Query: 227 RFRTITTAYSV 259
           +F  +   Y +
Sbjct: 71  KFGGLRDGYYI 81



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 20/78 (25%), Positives = 44/78 (56%)
 Frame = +1

Query: 274 MLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQLAIEYQ 453
           ++++DVT+  +++N+ NW R++      ++  ++ GNK D+   R+V K +      +  
Sbjct: 87  VIMFDVTSRVTYKNVPNWHRDL-VRVCENIPIVLCGNKVDI-KDRKV-KAKSIVFHRKKN 143

Query: 454 IKFVETSAKDSLNVEYAF 507
           +++ + SAK + N E  F
Sbjct: 144 LQYYDISAKSNYNFEKPF 161


>AF220950-1|AAF30287.1|  216|Drosophila melanogaster GTP-binding
           nuclear protein RAN protein.
          Length = 216

 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 22/71 (30%), Positives = 39/71 (54%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FK +L+GD G GKT+ + R     F   +++T+G++        +   ++  +WDTAGQE
Sbjct: 11  FKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTAGQE 70

Query: 227 RFRTITTAYSV 259
           +F  +   Y +
Sbjct: 71  KFGGLRDGYYI 81


>AE014298-1568|AAN09287.1|  216|Drosophila melanogaster CG1404-PB,
           isoform B protein.
          Length = 216

 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 22/71 (30%), Positives = 39/71 (54%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FK +L+GD G GKT+ + R     F   +++T+G++        +   ++  +WDTAGQE
Sbjct: 11  FKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTAGQE 70

Query: 227 RFRTITTAYSV 259
           +F  +   Y +
Sbjct: 71  KFGGLRDGYYI 81



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 20/78 (25%), Positives = 44/78 (56%)
 Frame = +1

Query: 274 MLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQLAIEYQ 453
           ++++DVT+  +++N+ NW R++      ++  ++ GNK D+   R+V K +      +  
Sbjct: 87  VIMFDVTSRVTYKNVPNWHRDL-VRVCENIPIVLCGNKVDI-KDRKV-KAKSIVFHRKKN 143

Query: 454 IKFVETSAKDSLNVEYAF 507
           +++ + SAK + N E  F
Sbjct: 144 LQYYDISAKSNYNFEKPF 161


>AE014298-1567|AAF48008.1|  216|Drosophila melanogaster CG1404-PA,
           isoform A protein.
          Length = 216

 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 22/71 (30%), Positives = 39/71 (54%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FK +L+GD G GKT+ + R     F   +++T+G++        +   ++  +WDTAGQE
Sbjct: 11  FKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTAGQE 70

Query: 227 RFRTITTAYSV 259
           +F  +   Y +
Sbjct: 71  KFGGLRDGYYI 81



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 20/78 (25%), Positives = 44/78 (56%)
 Frame = +1

Query: 274 MLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQLAIEYQ 453
           ++++DVT+  +++N+ NW R++      ++  ++ GNK D+   R+V K +      +  
Sbjct: 87  VIMFDVTSRVTYKNVPNWHRDL-VRVCENIPIVLCGNKVDI-KDRKV-KAKSIVFHRKKN 143

Query: 454 IKFVETSAKDSLNVEYAF 507
           +++ + SAK + N E  F
Sbjct: 144 LQYYDISAKSNYNFEKPF 161


>X02200-1|CAA26131.1|  182|Drosophila melanogaster protein (
           Drosophila Dras3 gene. ).
          Length = 182

 Score = 54.4 bits (125), Expect = 2e-07
 Identities = 24/50 (48%), Positives = 34/50 (68%)
 Frame = +1

Query: 358 DVEKMILGNKCDLDSQRQVSKERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
           DV  +++GNKCDL+ +R V KE G+ LA ++   F+ETSAK  +NV   F
Sbjct: 107 DVPMVLVGNKCDLEEERVVGKELGKNLATQFNCAFMETSAKAKVNVNDIF 156



 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 25/92 (27%), Positives = 49/92 (53%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           +K++++G  GVGK+++  +F +  F   +  TI   ++ + + ++ ++  L+I +TAG E
Sbjct: 4   YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYR-KQVKVNERQCMLEIVNTAGTE 62

Query: 227 RFRTITTAYSVVLWELCLSTMLRMRRALKTLR 322
           +F  +   Y     + C ST  R  R L   R
Sbjct: 63  QFTAMRNLYMKNGSDSCWSTRSRRNRRLTICR 94


>Y07564-1|CAA68849.1|  264|Drosophila melanogaster RIC (Ras which
           interacts withCalmodulin) protein.
          Length = 264

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNIEE-NASADVEKMILGNKCDLDSQRQVSKERG 429
           +R   G ++ Y VT+  SF+    + + I     S D+  +++ NK DL+SQR+V+ E G
Sbjct: 128 MRCGEGFIICYSVTDRHSFQEASEYRKLITRVRLSEDIPLVLIANKVDLESQRRVTTEEG 187

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
             LA ++   F ETSA     ++ AF
Sbjct: 188 RNLANQFGCPFFETSAALRHYIDEAF 213



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 21/70 (30%), Positives = 39/70 (55%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           ++K++++GD GVGK+++  +F   +F      TI   ++ + + +D +   L I DTAGQ
Sbjct: 59  VYKIVILGDGGVGKSAVTLQFVSHSFLDYHDPTIEDSYQQQAV-IDNEAALLDILDTAGQ 117

Query: 224 ERFRTITTAY 253
             F  +   Y
Sbjct: 118 VEFTAMRDQY 127


>BT024201-1|ABC86263.1|  283|Drosophila melanogaster RE46661p
           protein.
          Length = 283

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 34/91 (37%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEK---MILGNKCDLDSQ-RQV 414
           SI +G    +LVY V +++S E ++     I+E   AD+     M++GNKCD  ++ R+V
Sbjct: 86  SISKGH-AFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCDETAELREV 144

Query: 415 SKERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
           S+  G+  A  + I F+ETSAK + NV   F
Sbjct: 145 SQAEGQAQATTWSISFMETSAKTNHNVTELF 175


>AE014297-1044|AAF54453.1|  233|Drosophila melanogaster CG8500-PA
           protein.
          Length = 233

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 34/91 (37%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEK---MILGNKCDLDSQ-RQV 414
           SI +G    +LVY V +++S E ++     I+E   AD+     M++GNKCD  ++ R+V
Sbjct: 86  SISKGH-AFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCDETAELREV 144

Query: 415 SKERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
           S+  G+  A  + I F+ETSAK + NV   F
Sbjct: 145 SQAEGQAQATTWSISFMETSAKTNHNVTELF 175


>AE013599-2181|AAF58065.1|  264|Drosophila melanogaster CG8418-PA
           protein.
          Length = 264

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNIEE-NASADVEKMILGNKCDLDSQRQVSKERG 429
           +R   G ++ Y VT+  SF+    + + I     S D+  +++ NK DL+SQR+V+ E G
Sbjct: 128 MRCGEGFIICYSVTDRHSFQEASEYRKLITRVRLSEDIPLVLIANKVDLESQRRVTTEEG 187

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
             LA ++   F ETSA     ++ AF
Sbjct: 188 RNLANQFGCPFFETSAALRHYIDEAF 213



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 21/70 (30%), Positives = 39/70 (55%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           ++K++++GD GVGK+++  +F   +F      TI   ++ + + +D +   L I DTAGQ
Sbjct: 59  VYKIVILGDGGVGKSAVTLQFVSHSFLDYHDPTIEDSYQQQAV-IDNEAALLDILDTAGQ 117

Query: 224 ERFRTITTAY 253
             F  +   Y
Sbjct: 118 VEFTAMRDQY 127


>U23800-1|AAC34902.1|  201|Drosophila melanogaster ral protein.
          Length = 201

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 25/89 (28%), Positives = 49/89 (55%), Gaps = 1/89 (1%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNI-EENASADVEKMILGNKCDLDSQRQVSK 420
           ++  R   G + V+ +T+++SF+  + +   I        +  +++GNKCDL+ +R+V  
Sbjct: 77  DNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPL 136

Query: 421 ERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
              +  A ++ + +VETSAK   NV+  F
Sbjct: 137 SECQLRAQQWAVPYVETSAKTRENVDKVF 165



 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 24/70 (34%), Positives = 42/70 (60%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++G  GVGK+++  +F  D F   +  T    ++ + + LDG++V++ I DTAGQ
Sbjct: 11  LHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVV-LDGEEVQIDILDTAGQ 69

Query: 224 ERFRTITTAY 253
           E +  I   Y
Sbjct: 70  EDYAAIRDNY 79


>AY118912-1|AAM50772.1|  201|Drosophila melanogaster LD21679p
           protein.
          Length = 201

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 25/89 (28%), Positives = 49/89 (55%), Gaps = 1/89 (1%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNI-EENASADVEKMILGNKCDLDSQRQVSK 420
           ++  R   G + V+ +T+++SF+  + +   I        +  +++GNKCDL+ +R+V  
Sbjct: 77  DNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPL 136

Query: 421 ERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
              +  A ++ + +VETSAK   NV+  F
Sbjct: 137 SECQLRAQQWAVPYVETSAKTRENVDKVF 165



 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 24/70 (34%), Positives = 42/70 (60%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++G  GVGK+++  +F  D F   +  T    ++ + + LDG++V++ I DTAGQ
Sbjct: 11  LHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVV-LDGEEVQIDILDTAGQ 69

Query: 224 ERFRTITTAY 253
           E +  I   Y
Sbjct: 70  EDYAAIRDNY 79


>AY024366-1|AAK00587.1|  197|Drosophila melanogaster RAL2 protein.
          Length = 197

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 25/89 (28%), Positives = 49/89 (55%), Gaps = 1/89 (1%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNI-EENASADVEKMILGNKCDLDSQRQVSK 420
           ++  R   G + V+ +T+++SF+  + +   I        +  +++GNKCDL+ +R+V  
Sbjct: 77  DNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPL 136

Query: 421 ERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
              +  A ++ + +VETSAK   NV+  F
Sbjct: 137 SECQLRAQQWAVPYVETSAKTRENVDKVF 165



 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 24/70 (34%), Positives = 42/70 (60%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++G  GVGK+++  +F  D F   +  T    ++ + + LDG++V++ I DTAGQ
Sbjct: 11  LHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVV-LDGEEVQIDILDTAGQ 69

Query: 224 ERFRTITTAY 253
           E +  I   Y
Sbjct: 70  EDYAAIRDNY 79


>AE014298-551|AAF45890.1|  201|Drosophila melanogaster CG2849-PC,
           isoform C protein.
          Length = 201

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 25/89 (28%), Positives = 49/89 (55%), Gaps = 1/89 (1%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNI-EENASADVEKMILGNKCDLDSQRQVSK 420
           ++  R   G + V+ +T+++SF+  + +   I        +  +++GNKCDL+ +R+V  
Sbjct: 77  DNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPL 136

Query: 421 ERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
              +  A ++ + +VETSAK   NV+  F
Sbjct: 137 SECQLRAQQWAVPYVETSAKTRENVDKVF 165



 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 24/70 (34%), Positives = 42/70 (60%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++G  GVGK+++  +F  D F   +  T    ++ + + LDG++V++ I DTAGQ
Sbjct: 11  LHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVV-LDGEEVQIDILDTAGQ 69

Query: 224 ERFRTITTAY 253
           E +  I   Y
Sbjct: 70  EDYAAIRDNY 79


>AE014298-550|AAF45889.1|  201|Drosophila melanogaster CG2849-PA,
           isoform A protein.
          Length = 201

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 25/89 (28%), Positives = 49/89 (55%), Gaps = 1/89 (1%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNI-EENASADVEKMILGNKCDLDSQRQVSK 420
           ++  R   G + V+ +T+++SF+  + +   I        +  +++GNKCDL+ +R+V  
Sbjct: 77  DNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPL 136

Query: 421 ERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
              +  A ++ + +VETSAK   NV+  F
Sbjct: 137 SECQLRAQQWAVPYVETSAKTRENVDKVF 165



 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 24/70 (34%), Positives = 42/70 (60%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++G  GVGK+++  +F  D F   +  T    ++ + + LDG++V++ I DTAGQ
Sbjct: 11  LHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVV-LDGEEVQIDILDTAGQ 69

Query: 224 ERFRTITTAY 253
           E +  I   Y
Sbjct: 70  EDYAAIRDNY 79


>AE014298-549|AAN09102.1|  197|Drosophila melanogaster CG2849-PB,
           isoform B protein.
          Length = 197

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 25/89 (28%), Positives = 49/89 (55%), Gaps = 1/89 (1%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNI-EENASADVEKMILGNKCDLDSQRQVSK 420
           ++  R   G + V+ +T+++SF+  + +   I        +  +++GNKCDL+ +R+V  
Sbjct: 77  DNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPL 136

Query: 421 ERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
              +  A ++ + +VETSAK   NV+  F
Sbjct: 137 SECQLRAQQWAVPYVETSAKTRENVDKVF 165



 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 24/70 (34%), Positives = 42/70 (60%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           L K++++G  GVGK+++  +F  D F   +  T    ++ + + LDG++V++ I DTAGQ
Sbjct: 11  LHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVV-LDGEEVQIDILDTAGQ 69

Query: 224 ERFRTITTAY 253
           E +  I   Y
Sbjct: 70  EDYAAIRDNY 79


>Z35643-1|CAA84710.1|  192|Drosophila melanogaster RacB protein.
          Length = 192

 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 23/61 (37%), Positives = 37/61 (60%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ +AF   +I T+  D     + +D K + L +WDTAGQE 
Sbjct: 5   KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTV-FDNYSANVMVDAKPINLGLWDTAGQED 63

Query: 230 F 232
           +
Sbjct: 64  Y 64


>Z35642-1|CAA84709.1|  192|Drosophila melanogaster RacA protein.
          Length = 192

 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 23/61 (37%), Positives = 37/61 (60%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ +AF   +I T+  D     + +D K + L +WDTAGQE 
Sbjct: 5   KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTV-FDNYSANVMVDAKPINLGLWDTAGQED 63

Query: 230 F 232
           +
Sbjct: 64  Y 64


>U11823-1|AAA62870.1|  192|Drosophila melanogaster Drac1 protein.
          Length = 192

 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 23/61 (37%), Positives = 37/61 (60%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ +AF   +I T+  D     + +D K + L +WDTAGQE 
Sbjct: 5   KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTV-FDNYSANVMVDAKPINLGLWDTAGQED 63

Query: 230 F 232
           +
Sbjct: 64  Y 64


>L38310-1|AAA67041.1|  192|Drosophila melanogaster Rac2 protein.
          Length = 192

 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 23/61 (37%), Positives = 37/61 (60%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ +AF   +I T+  D     + +D K + L +WDTAGQE 
Sbjct: 5   KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTV-FDNYSANVMVDAKPINLGLWDTAGQED 63

Query: 230 F 232
           +
Sbjct: 64  Y 64


>L38309-1|AAA67040.1|  192|Drosophila melanogaster Rac1 protein.
          Length = 192

 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 23/61 (37%), Positives = 37/61 (60%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ +AF   +I T+  D     + +D K + L +WDTAGQE 
Sbjct: 5   KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTV-FDNYSANVMVDAKPINLGLWDTAGQED 63

Query: 230 F 232
           +
Sbjct: 64  Y 64


>AY118845-1|AAM50705.1|  192|Drosophila melanogaster GM13874p
           protein.
          Length = 192

 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 23/61 (37%), Positives = 37/61 (60%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ +AF   +I T+  D     + +D K + L +WDTAGQE 
Sbjct: 5   KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTV-FDNYSANVMVDAKPINLGLWDTAGQED 63

Query: 230 F 232
           +
Sbjct: 64  Y 64


>AY060408-1|AAL25447.1|  192|Drosophila melanogaster LD34217p
           protein.
          Length = 192

 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 23/61 (37%), Positives = 37/61 (60%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ +AF   +I T+  D     + +D K + L +WDTAGQE 
Sbjct: 5   KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTV-FDNYSANVMVDAKPINLGLWDTAGQED 63

Query: 230 F 232
           +
Sbjct: 64  Y 64


>AE014296-1260|AAF50559.1|  192|Drosophila melanogaster CG8556-PA
           protein.
          Length = 192

 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 23/61 (37%), Positives = 37/61 (60%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ +AF   +I T+  D     + +D K + L +WDTAGQE 
Sbjct: 5   KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTV-FDNYSANVMVDAKPINLGLWDTAGQED 63

Query: 230 F 232
           +
Sbjct: 64  Y 64


>AE014296-217|AAF47469.1|  192|Drosophila melanogaster CG2248-PA
           protein.
          Length = 192

 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 23/61 (37%), Positives = 37/61 (60%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ +AF   +I T+  D     + +D K + L +WDTAGQE 
Sbjct: 5   KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTV-FDNYSANVMVDAKPINLGLWDTAGQED 63

Query: 230 F 232
           +
Sbjct: 64  Y 64


>AY118519-1|AAM49888.1|  104|Drosophila melanogaster LD16736p
           protein.
          Length = 104

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 21/47 (44%), Positives = 31/47 (65%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKI 163
           M++TYD LFK L+IG +G GK+ +L  F E  F      TIG++F++
Sbjct: 1   MSETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFRL 47


>BT011477-1|AAR99135.1|  740|Drosophila melanogaster RE10036p
           protein.
          Length = 740

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = +1

Query: 268 GIMLVYDVTNEKSFENIKNWIRNI-EENASADVEKMILGNKCDLDSQRQVSKERGEQLAI 444
           G ++V+ V +  SF   +  I  + +EN + D   +++GNK DL   R ++ + G+ LA 
Sbjct: 602 GCVVVFSVVDRSSFRVAEEIINYLWQENYTKDKAVILVGNKADLARARLITSQEGKALAA 661

Query: 445 EYQIKFVETSAKDSLNVE 498
               KF+ETS+    NV+
Sbjct: 662 SRDAKFIETSSGIQHNVD 679



 Score = 31.5 bits (68), Expect = 1.3
 Identities = 10/44 (22%), Positives = 31/44 (70%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL 178
           ++++++GD+GVGKT+++ +F    +  ++ +++  +F  +T+ +
Sbjct: 527 YRVVMLGDAGVGKTALVNQFMTSEYMHTYDASLDDEFGEKTVSV 570


>AE013599-2719|AAM68464.1|  210|Drosophila melanogaster CG15069-PB,
           isoform B protein.
          Length = 210

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = +1

Query: 268 GIMLVYDVTNEKSFENIKNWIRNI-EENASADVEKMILGNKCDLDSQRQVSKERGEQLAI 444
           G ++V+ V +  SF   +  I  + +EN + D   +++GNK DL   R ++ + G+ LA 
Sbjct: 72  GCVVVFSVVDRSSFRVAEEIINYLWQENYTKDKAVILVGNKADLARARLITSQEGKALAA 131

Query: 445 EYQIKFVETSAKDSLNVE 498
               KF+ETS+    NV+
Sbjct: 132 SRDAKFIETSSGIQHNVD 149



 Score = 28.7 bits (61), Expect = 9.2
 Identities = 10/40 (25%), Positives = 27/40 (67%)
 Frame = +2

Query: 59  LIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL 178
           ++GD+GVGKT+++ +F    +  ++ +++  +F  +T+ +
Sbjct: 1   MLGDAGVGKTALVNQFMTSEYMHTYDASLDDEFGEKTVSV 40


>AE013599-2718|AAF57675.3|  740|Drosophila melanogaster CG15069-PA,
           isoform A protein.
          Length = 740

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = +1

Query: 268 GIMLVYDVTNEKSFENIKNWIRNI-EENASADVEKMILGNKCDLDSQRQVSKERGEQLAI 444
           G ++V+ V +  SF   +  I  + +EN + D   +++GNK DL   R ++ + G+ LA 
Sbjct: 602 GCVVVFSVVDRSSFRVAEEIINYLWQENYTKDKAVILVGNKADLARARLITSQEGKALAA 661

Query: 445 EYQIKFVETSAKDSLNVE 498
               KF+ETS+    NV+
Sbjct: 662 SRDAKFIETSSGIQHNVD 679



 Score = 31.5 bits (68), Expect = 1.3
 Identities = 10/44 (22%), Positives = 31/44 (70%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL 178
           ++++++GD+GVGKT+++ +F    +  ++ +++  +F  +T+ +
Sbjct: 527 YRVVMLGDAGVGKTALVNQFMTSEYMHTYDASLDDEFGEKTVSV 570


>U50314-1|AAB05666.1|  190|Drosophila melanogaster RhoL protein.
          Length = 190

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 22/64 (34%), Positives = 36/64 (56%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+ ++GD  VGKT +L  ++ + F   +I T+  D     I +D +   L +WDTAGQE 
Sbjct: 13  KITIVGDGMVGKTCMLITYTRNEFPEEYIPTV-FDNHACNIAVDDRDYNLTLWDTAGQED 71

Query: 230 FRTI 241
           +  +
Sbjct: 72  YERL 75



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 27/83 (32%), Positives = 48/83 (57%), Gaps = 5/83 (6%)
 Frame = +1

Query: 274 MLVYDVTNEKSFENIKN-WIRNIEENASADVEKMILGNKCDL---DSQRQVSKERGEQLA 441
           +L Y +++  SFEN+K+ W   I  + SA V  +++G K DL   +S++ V+ + G+++ 
Sbjct: 87  LLCYSISSRTSFENVKSKWWPEI-RHFSAHVPVVLVGTKLDLRIPNSEKFVTTQEGKKMR 145

Query: 442 IE-YQIKFVETSAKDSLNVEYAF 507
            E +    VE SAK   N++  F
Sbjct: 146 KEIHAFNLVECSAKKKQNLQQVF 168


>AY069811-1|AAL39956.1|  190|Drosophila melanogaster SD05212p
           protein.
          Length = 190

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 22/64 (34%), Positives = 36/64 (56%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+ ++GD  VGKT +L  ++ + F   +I T+  D     I +D +   L +WDTAGQE 
Sbjct: 13  KITIVGDGMVGKTCMLITYTRNEFPEEYIPTV-FDNHACNIAVDDRDYNLTLWDTAGQED 71

Query: 230 FRTI 241
           +  +
Sbjct: 72  YERL 75



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 27/83 (32%), Positives = 48/83 (57%), Gaps = 5/83 (6%)
 Frame = +1

Query: 274 MLVYDVTNEKSFENIKN-WIRNIEENASADVEKMILGNKCDL---DSQRQVSKERGEQLA 441
           +L Y +++  SFEN+K+ W   I  + SA V  +++G K DL   +S++ V+ + G+++ 
Sbjct: 87  LLCYSISSRTSFENVKSKWWPEI-RHFSAHVPVVLVGTKLDLRIPNSEKFVTTQEGKKMR 145

Query: 442 IE-YQIKFVETSAKDSLNVEYAF 507
            E +    VE SAK   N++  F
Sbjct: 146 KEIHAFNLVECSAKKKQNLQQVF 168


>AE014297-950|AAF54385.1|  190|Drosophila melanogaster CG9366-PA
           protein.
          Length = 190

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 22/64 (34%), Positives = 36/64 (56%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+ ++GD  VGKT +L  ++ + F   +I T+  D     I +D +   L +WDTAGQE 
Sbjct: 13  KITIVGDGMVGKTCMLITYTRNEFPEEYIPTV-FDNHACNIAVDDRDYNLTLWDTAGQED 71

Query: 230 FRTI 241
           +  +
Sbjct: 72  YERL 75



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 27/83 (32%), Positives = 48/83 (57%), Gaps = 5/83 (6%)
 Frame = +1

Query: 274 MLVYDVTNEKSFENIKN-WIRNIEENASADVEKMILGNKCDL---DSQRQVSKERGEQLA 441
           +L Y +++  SFEN+K+ W   I  + SA V  +++G K DL   +S++ V+ + G+++ 
Sbjct: 87  LLCYSISSRTSFENVKSKWWPEI-RHFSAHVPVVLVGTKLDLRIPNSEKFVTTQEGKKMR 145

Query: 442 IE-YQIKFVETSAKDSLNVEYAF 507
            E +    VE SAK   N++  F
Sbjct: 146 KEIHAFNLVECSAKKKQNLQQVF 168


>AB035355-1|BAA87881.1|  190|Drosophila melanogaster Drac3 protein.
          Length = 190

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 22/64 (34%), Positives = 36/64 (56%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+ ++GD  VGKT +L  ++ + F   +I T+  D     I +D +   L +WDTAGQE 
Sbjct: 13  KITIVGDGMVGKTCMLITYTRNEFPEEYIPTV-FDNHACNIAVDDRDYNLTLWDTAGQED 71

Query: 230 FRTI 241
           +  +
Sbjct: 72  YERL 75



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 27/83 (32%), Positives = 47/83 (56%), Gaps = 5/83 (6%)
 Frame = +1

Query: 274 MLVYDVTNEKSFENIKN-WIRNIEENASADVEKMILGNKCDL---DSQRQVSKERGEQLA 441
           +L Y +++  SFEN+K+ W   I  + SA V  +++G K DL    S++ V+ + G+++ 
Sbjct: 87  LLCYSISSRTSFENVKSKWWPEI-RHFSAHVPVVLVGTKLDLRIPSSEKFVTTQEGKKMR 145

Query: 442 IE-YQIKFVETSAKDSLNVEYAF 507
            E +    VE SAK   N++  F
Sbjct: 146 KEIHAFNLVECSAKKKQNLQQVF 168


>AY113279-1|AAM29284.1|  195|Drosophila melanogaster AT17867p
           protein.
          Length = 195

 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 22/61 (36%), Positives = 36/61 (59%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ D F   ++ T+  D     + +D  +V L +WDTAGQE 
Sbjct: 8   KCVVVGDGTVGKTCMLISYTTDCFPGEYVPTV-FDNYSAPMQVDTIQVSLGLWDTAGQED 66

Query: 230 F 232
           +
Sbjct: 67  Y 67


>AJ413188-1|CAC88352.1|  195|Drosophila melanogaster small GTPase
           protein.
          Length = 195

 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 22/61 (36%), Positives = 36/61 (59%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ D F   ++ T+  D     + +D  +V L +WDTAGQE 
Sbjct: 8   KCVVVGDGTVGKTCMLISYTTDCFPGEYVPTV-FDNYSAPMQVDTIQVSLGLWDTAGQED 66

Query: 230 F 232
           +
Sbjct: 67  Y 67


>AF238044-1|AAF44665.1|  195|Drosophila melanogaster Mig-2-like
           GTPase Mtl protein.
          Length = 195

 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 22/61 (36%), Positives = 36/61 (59%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ D F   ++ T+  D     + +D  +V L +WDTAGQE 
Sbjct: 8   KCVVVGDGTVGKTCMLISYTTDCFPGEYVPTV-FDNYSAPMQVDTIQVSLGLWDTAGQED 66

Query: 230 F 232
           +
Sbjct: 67  Y 67


>AE014297-4152|AAN14120.1|  195|Drosophila melanogaster CG5588-PC,
           isoform C protein.
          Length = 195

 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 22/61 (36%), Positives = 36/61 (59%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ D F   ++ T+  D     + +D  +V L +WDTAGQE 
Sbjct: 8   KCVVVGDGTVGKTCMLISYTTDCFPGEYVPTV-FDNYSAPMQVDTIQVSLGLWDTAGQED 66

Query: 230 F 232
           +
Sbjct: 67  Y 67


>AE014297-4151|AAF56727.1|  195|Drosophila melanogaster CG5588-PB,
           isoform B protein.
          Length = 195

 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 22/61 (36%), Positives = 36/61 (59%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ D F   ++ T+  D     + +D  +V L +WDTAGQE 
Sbjct: 8   KCVVVGDGTVGKTCMLISYTTDCFPGEYVPTV-FDNYSAPMQVDTIQVSLGLWDTAGQED 66

Query: 230 F 232
           +
Sbjct: 67  Y 67


>AE014297-4150|AAF56728.1|  195|Drosophila melanogaster CG5588-PA,
           isoform A protein.
          Length = 195

 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 22/61 (36%), Positives = 36/61 (59%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ D F   ++ T+  D     + +D  +V L +WDTAGQE 
Sbjct: 8   KCVVVGDGTVGKTCMLISYTTDCFPGEYVPTV-FDNYSAPMQVDTIQVSLGLWDTAGQED 66

Query: 230 F 232
           +
Sbjct: 67  Y 67


>AY118407-1|AAM48436.1|  282|Drosophila melanogaster RE62293p
           protein.
          Length = 282

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 1/72 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNIEE-NASADVEKMILGNKCDLDSQRQVSKERG 429
           +R   G ++ Y VT+  SF+    + + I     S D+  +++ NK DL+SQR+V+ E G
Sbjct: 128 MRCGEGFIICYSVTDRHSFQEASEYRKLITRVRLSEDIPLVLIANKVDLESQRRVTTEEG 187

Query: 430 EQLAIEYQIKFV 465
             L+     +F+
Sbjct: 188 RNLSTSSAARFL 199



 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 21/70 (30%), Positives = 39/70 (55%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           ++K++++GD GVGK+++  +F   +F      TI   ++ + + +D +   L I DTAGQ
Sbjct: 59  VYKIVILGDGGVGKSAVTLQFVSHSFLDYHDPTIEDSYQRQAV-IDNEAALLDILDTAGQ 117

Query: 224 ERFRTITTAY 253
             F  +   Y
Sbjct: 118 VEFTAMRDQY 127


>AL050231-7|CAB43324.1|  306|Drosophila melanogaster EG:BACR37P7.8
           protein.
          Length = 306

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 6/102 (5%)
 Frame = +1

Query: 220 SREIPYNNNSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEE-NASADVEKMILGNKCDL 396
           S E P      +  +   +LVYDVT+  +FE ++     I E  A+  V  +++GNK DL
Sbjct: 105 SYEFPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAVPIVVVGNKIDL 164

Query: 397 ----DSQRQVSKERGEQ-LAIEYQIKFVETSAKDSLNVEYAF 507
               +++R+V     E  + ++++  FVE SA  + N+   F
Sbjct: 165 LADGETEREVEYATTESVVTVDWENGFVEASASSNENITQVF 206



 Score = 35.9 bits (79), Expect = 0.060
 Identities = 20/61 (32%), Positives = 33/61 (54%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K++++G + VGKTSI+ +F  + F+  +  TI  +       + G  + L I DTAG   
Sbjct: 49  KIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIE-EMHQGNFSIAGVSLTLDILDTAGSYE 107

Query: 230 F 232
           F
Sbjct: 108 F 108


>AF153428-1|AAD43792.1|  191|Drosophila melanogaster CDC42 protein
           protein.
          Length = 191

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 19/64 (29%), Positives = 39/64 (60%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ + F   ++ T+  ++ + T+ + G+   L ++DTAGQE 
Sbjct: 5   KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAV-TVMIGGEPYTLGLFDTAGQED 63

Query: 230 FRTI 241
           +  +
Sbjct: 64  YNRL 67


>AE014298-18|AAF45493.2|  306|Drosophila melanogaster CG13375-PA
           protein.
          Length = 306

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 6/102 (5%)
 Frame = +1

Query: 220 SREIPYNNNSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEE-NASADVEKMILGNKCDL 396
           S E P      +  +   +LVYDVT+  +FE ++     I E  A+  V  +++GNK DL
Sbjct: 105 SYEFPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAVPIVVVGNKIDL 164

Query: 397 ----DSQRQVSKERGEQ-LAIEYQIKFVETSAKDSLNVEYAF 507
               +++R+V     E  + ++++  FVE SA  + N+   F
Sbjct: 165 LADGETEREVEYATTESVVTVDWENGFVEASASSNENITQVF 206



 Score = 35.9 bits (79), Expect = 0.060
 Identities = 20/61 (32%), Positives = 33/61 (54%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K++++G + VGKTSI+ +F  + F+  +  TI  +       + G  + L I DTAG   
Sbjct: 49  KIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIE-EMHQGNFSIAGVSLTLDILDTAGSYE 107

Query: 230 F 232
           F
Sbjct: 108 F 108


>U11824-1|AAA62871.1|  191|Drosophila melanogaster Dcdc42 protein.
          Length = 191

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/61 (31%), Positives = 38/61 (62%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ + F   ++ T+  ++ + T+ + G+   L ++DTAGQE 
Sbjct: 5   KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAV-TVMIGGEPYTLGLFDTAGQED 63

Query: 230 F 232
           +
Sbjct: 64  Y 64


>AY119570-1|AAM50224.1|  191|Drosophila melanogaster HL08128p
           protein.
          Length = 191

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/61 (31%), Positives = 38/61 (62%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ + F   ++ T+  ++ + T+ + G+   L ++DTAGQE 
Sbjct: 5   KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAV-TVMIGGEPYTLGLFDTAGQED 63

Query: 230 F 232
           +
Sbjct: 64  Y 64


>AF153429-1|AAD43793.1|  191|Drosophila melanogaster CDC42 protein
           protein.
          Length = 191

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/61 (31%), Positives = 38/61 (62%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ + F   ++ T+  ++ + T+ + G+   L ++DTAGQE 
Sbjct: 5   KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAV-TVMIGGEPYTLGLFDTAGQED 63

Query: 230 F 232
           +
Sbjct: 64  Y 64


>AF153427-1|AAD43791.1|  191|Drosophila melanogaster CDC42 protein
           protein.
          Length = 191

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/61 (31%), Positives = 38/61 (62%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ + F   ++ T+  ++ + T+ + G+   L ++DTAGQE 
Sbjct: 5   KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAV-TVMIGGEPYTLGLFDTAGQED 63

Query: 230 F 232
           +
Sbjct: 64  Y 64


>AF153426-1|AAD43790.1|  191|Drosophila melanogaster CDC42 protein
           protein.
          Length = 191

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/61 (31%), Positives = 38/61 (62%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ + F   ++ T+  ++ + T+ + G+   L ++DTAGQE 
Sbjct: 5   KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAV-TVMIGGEPYTLGLFDTAGQED 63

Query: 230 F 232
           +
Sbjct: 64  Y 64


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 34,328,693
Number of Sequences: 53049
Number of extensions: 729932
Number of successful extensions: 3019
Number of sequences better than 10.0: 326
Number of HSP's better than 10.0 without gapping: 2501
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2840
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3499501170
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -