SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20004
         (768 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT003574-1|AAO39578.1|  216|Drosophila melanogaster LD40852p pro...   227   1e-59
AY070533-1|AAL48004.1|  216|Drosophila melanogaster GM14354p pro...   227   1e-59
AY061398-1|AAL28946.1|  216|Drosophila melanogaster LD32416p pro...   227   1e-59
AF233584-1|AAF60289.1|  216|Drosophila melanogaster Ran10A protein.   227   1e-59
AE014298-1568|AAN09287.1|  216|Drosophila melanogaster CG1404-PB...   227   1e-59
AE014298-1567|AAF48008.1|  216|Drosophila melanogaster CG1404-PA...   227   1e-59
AF220950-1|AAF30287.1|  216|Drosophila melanogaster GTP-binding ...   219   3e-57
AY070523-1|AAL47994.1|  217|Drosophila melanogaster GH25818p pro...   144   1e-34
AE014296-2503|AAF49642.1|  217|Drosophila melanogaster CG7815-PA...   144   1e-34
AY752534-1|AAW31990.1|  195|Drosophila melanogaster CG2885 protein.    65   1e-10
AY752540-1|AAW31996.1|  195|Drosophila melanogaster CG2885 protein.    64   2e-10
AY752539-1|AAW31995.1|  195|Drosophila melanogaster CG2885 protein.    64   3e-10
AY752542-1|AAW31998.1|  195|Drosophila melanogaster CG2885 protein.    63   4e-10
AY752538-1|AAW31994.1|  195|Drosophila melanogaster CG2885 protein.    63   4e-10
AY752536-1|AAW31992.1|  195|Drosophila melanogaster CG2885 protein.    63   4e-10
AY752535-1|AAW31991.1|  195|Drosophila melanogaster CG2885 protein.    63   4e-10
AE014298-1452|AAF46585.1|  195|Drosophila melanogaster CG2885-PA...    63   4e-10
D84348-1|BAA21712.1|  219|Drosophila melanogaster rab-related pr...    63   5e-10
AY071400-1|AAL49022.1|  219|Drosophila melanogaster RE48347p pro...    63   5e-10
AY061826-1|AAL27637.1|  388|Drosophila melanogaster GH21984p pro...    63   5e-10
AE014296-3519|AAF51708.2|  388|Drosophila melanogaster CG7605-PA...    63   5e-10
AE014296-1412|AAF50452.1|  219|Drosophila melanogaster CG7062-PA...    63   5e-10
AY752537-1|AAW31993.1|  195|Drosophila melanogaster CG2885 protein.    62   6e-10
AY752533-1|AAW31989.1|  195|Drosophila melanogaster CG2885 protein.    62   6e-10
AE014298-1475|AAF46610.2|  197|Drosophila melanogaster CG9807-PA...    62   1e-09
AY113574-1|AAM29579.1|  268|Drosophila melanogaster RH23273p pro...    61   1e-09
AE014298-1530|AAF47981.2|  197|Drosophila melanogaster CG32671-P...    61   1e-09
AE014298-1478|AAN09264.1|  197|Drosophila melanogaster CG32673-P...    61   1e-09
AE014298-1469|AAN09263.1|  197|Drosophila melanogaster CG32678-P...    61   1e-09
AE014297-330|AAF51970.1|  268|Drosophila melanogaster CG2108-PA ...    61   1e-09
AY752541-1|AAW31997.1|  185|Drosophila melanogaster CG2885 protein.    59   6e-09
AY094795-1|AAM11148.1|  201|Drosophila melanogaster LD21953p pro...    57   2e-08
AE014298-2969|AAF45371.1|  201|Drosophila melanogaster CG9575-PA...    57   2e-08
U11824-1|AAA62871.1|  191|Drosophila melanogaster Dcdc42 protein.      57   3e-08
D84312-1|BAA21705.1|  205|Drosophila melanogaster rab1 protein.        57   3e-08
AY119570-1|AAM50224.1|  191|Drosophila melanogaster HL08128p pro...    57   3e-08
AF153428-1|AAD43792.1|  191|Drosophila melanogaster CDC42 protei...    57   3e-08
AF153427-1|AAD43791.1|  191|Drosophila melanogaster CDC42 protei...    57   3e-08
AF153425-1|AAD43789.1|  191|Drosophila melanogaster CDC42 protei...    57   3e-08
AF153423-1|AAD43787.1|  191|Drosophila melanogaster CDC42 protei...    57   3e-08
AE014298-2918|AAN09512.1|  191|Drosophila melanogaster CG12530-P...    57   3e-08
AE014298-2917|AAF49007.1|  191|Drosophila melanogaster CG12530-P...    57   3e-08
AE014297-2966|AAN13857.1|  146|Drosophila melanogaster CG3320-PB...    57   3e-08
AE014297-2965|AAF55873.1|  205|Drosophila melanogaster CG3320-PA...    57   3e-08
AF153429-1|AAD43793.1|  191|Drosophila melanogaster CDC42 protei...    55   9e-08
BT001448-1|AAN71203.1|  306|Drosophila melanogaster GH26660p pro...    55   1e-07
AY069328-1|AAL39473.1|  388|Drosophila melanogaster LD04613p pro...    55   1e-07
AE013599-820|AAF58970.1|  686|Drosophila melanogaster CG8024-PB,...    55   1e-07
AE013599-819|AAG22295.2|  385|Drosophila melanogaster CG8024-PA,...    55   1e-07
AE013599-818|AAM68818.1|  388|Drosophila melanogaster CG8024-PE,...    55   1e-07
AE013599-817|AAM68817.1|  388|Drosophila melanogaster CG8024-PC,...    55   1e-07
AE013599-816|AAM68816.2|  222|Drosophila melanogaster CG8024-PD,...    55   1e-07
AB035646-1|BAA88238.1|  231|Drosophila melanogaster Rab-related ...    55   1e-07
AF153426-1|AAD43790.1|  191|Drosophila melanogaster CDC42 protei...    54   2e-07
AF153424-1|AAD43788.1|  191|Drosophila melanogaster CDC42 protei...    54   2e-07
D84315-1|BAA21708.1|  214|Drosophila melanogaster rab11 protein.       54   3e-07
BT024998-1|ABE01228.1|  214|Drosophila melanogaster IP08727p pro...    54   3e-07
BT023110-1|AAY55526.1|  410|Drosophila melanogaster IP08719p pro...    54   3e-07
BT023070-1|AAY55486.1|  433|Drosophila melanogaster IP08619p pro...    54   3e-07
BT003196-1|AAO24951.1|  222|Drosophila melanogaster RE56408p pro...    54   3e-07
AY752532-1|AAW31988.1|  174|Drosophila melanogaster CG2532 protein.    54   3e-07
AY752531-1|AAW31987.1|  174|Drosophila melanogaster CG2532 protein.    54   3e-07
AY752530-1|AAW31986.1|  174|Drosophila melanogaster CG2532 protein.    54   3e-07
AY752529-1|AAW31985.1|  174|Drosophila melanogaster CG2532 protein.    54   3e-07
AY752528-1|AAW31984.1|  146|Drosophila melanogaster CG2532 protein.    54   3e-07
AY752527-1|AAW31983.1|  174|Drosophila melanogaster CG2532 protein.    54   3e-07
AY752526-1|AAW31982.1|  174|Drosophila melanogaster CG2532 protein.    54   3e-07
AY752525-1|AAW31981.1|  174|Drosophila melanogaster CG2532 protein.    54   3e-07
AY752524-1|AAW31980.1|  174|Drosophila melanogaster CG2532 protein.    54   3e-07
AY752523-1|AAW31979.1|  174|Drosophila melanogaster CG2532 protein.    54   3e-07
AY113404-1|AAM29409.1|  214|Drosophila melanogaster RE11886p pro...    54   3e-07
AY070528-1|AAL47999.1|  214|Drosophila melanogaster GM06568p pro...    54   3e-07
AE014298-1531|AAN09277.1|  214|Drosophila melanogaster CG32670-P...    54   3e-07
AE014297-2931|AAN13849.1|  214|Drosophila melanogaster CG5771-PB...    54   3e-07
AE014297-2930|AAF55850.1|  214|Drosophila melanogaster CG5771-PA...    54   3e-07
AB035354-1|BAA87880.1|  214|Drosophila melanogaster Drab11 protein.    54   3e-07
BT001785-1|AAN71540.1|  214|Drosophila melanogaster RH21315p pro...    53   4e-07
AY071080-1|AAL48702.1|  223|Drosophila melanogaster RE14786p pro...    53   4e-07
AE014134-1221|AAN10613.1|  223|Drosophila melanogaster CG9100-PC...    53   4e-07
AE014134-1220|AAN10612.1|  223|Drosophila melanogaster CG9100-PB...    53   4e-07
AE014134-1219|AAF52477.1|  223|Drosophila melanogaster CG9100-PA...    53   4e-07
D84347-1|BAA21711.1|  207|Drosophila melanogaster rab8 protein.        53   5e-07
AY069671-1|AAL39816.1|  207|Drosophila melanogaster LD44762p pro...    53   5e-07
AY060425-1|AAL25464.1|  204|Drosophila melanogaster LD39986p pro...    53   5e-07
AE014298-3000|AAF50924.1|  204|Drosophila melanogaster CG17060-P...    53   5e-07
AE014296-3237|AAF49101.1|  207|Drosophila melanogaster CG8287-PA...    53   5e-07
AB112933-1|BAD07038.1|  207|Drosophila melanogaster Rab8 protein.      53   5e-07
AB006189-1|BAA21744.1|  204|Drosophila melanogaster Rab10 protein.     53   5e-07
M64621-1|AAA28843.1|  220|Drosophila melanogaster rab3 protein.        52   7e-07
AY060449-1|AAL25488.1|  220|Drosophila melanogaster LP05860p pro...    52   7e-07
AE013599-1159|AAF58762.1|  220|Drosophila melanogaster CG7576-PA...    52   7e-07
AB112932-1|BAD07037.1|  220|Drosophila melanogaster Rab3 protein.      52   7e-07
Z35643-1|CAA84710.1|  192|Drosophila melanogaster RacB protein.        51   2e-06
L38310-1|AAA67041.1|  192|Drosophila melanogaster Rac2 protein.        51   2e-06
D84314-1|BAA21707.1|  208|Drosophila melanogaster rab6 protein.        51   2e-06
AY118845-1|AAM50705.1|  192|Drosophila melanogaster GM13874p pro...    51   2e-06
AY060261-1|AAL25300.1|  208|Drosophila melanogaster GH09086p pro...    51   2e-06
AE014296-1260|AAF50559.1|  192|Drosophila melanogaster CG8556-PA...    51   2e-06
AE014134-2164|AAF53168.1|  208|Drosophila melanogaster CG6601-PA...    51   2e-06
Z35642-1|CAA84709.1|  192|Drosophila melanogaster RacA protein.        51   2e-06
U11823-1|AAA62870.1|  192|Drosophila melanogaster Drac1 protein.       51   2e-06
L38309-1|AAA67040.1|  192|Drosophila melanogaster Rac1 protein.        51   2e-06
AY060408-1|AAL25447.1|  192|Drosophila melanogaster LD34217p pro...    51   2e-06
AE014296-217|AAF47469.1|  192|Drosophila melanogaster CG2248-PA ...    51   2e-06
BT003609-1|AAO39612.1|  230|Drosophila melanogaster GH17339p pro...    50   4e-06
AY060977-1|AAL28525.1|  230|Drosophila melanogaster GM10914p pro...    50   4e-06
AE014298-220|AAF45634.2|  230|Drosophila melanogaster CG14791-PC...    50   4e-06
AB112931-1|BAD07036.1|  230|Drosophila melanogaster Rab27 protein.     50   4e-06
AY113279-1|AAM29284.1|  195|Drosophila melanogaster AT17867p pro...    50   5e-06
AY060236-1|AAL25275.1|  207|Drosophila melanogaster GH03685p pro...    50   5e-06
AM294833-1|CAL26819.1|  207|Drosophila melanogaster CG5915 protein.    50   5e-06
AM294832-1|CAL26818.1|  207|Drosophila melanogaster CG5915 protein.    50   5e-06
AM294831-1|CAL26817.1|  207|Drosophila melanogaster CG5915 protein.    50   5e-06
AM294830-1|CAL26816.1|  207|Drosophila melanogaster CG5915 protein.    50   5e-06
AM294829-1|CAL26815.1|  207|Drosophila melanogaster CG5915 protein.    50   5e-06
AM294828-1|CAL26814.1|  207|Drosophila melanogaster CG5915 protein.    50   5e-06
AM294827-1|CAL26813.1|  207|Drosophila melanogaster CG5915 protein.    50   5e-06
AM294826-1|CAL26812.1|  207|Drosophila melanogaster CG5915 protein.    50   5e-06
AM294825-1|CAL26811.1|  207|Drosophila melanogaster CG5915 protein.    50   5e-06
AM294824-1|CAL26810.1|  207|Drosophila melanogaster CG5915 protein.    50   5e-06
AM294823-1|CAL26809.1|  207|Drosophila melanogaster CG5915 protein.    50   5e-06
AJ413188-1|CAC88352.1|  195|Drosophila melanogaster small GTPase...    50   5e-06
AF263363-1|AAF73041.1|  207|Drosophila melanogaster small ras-li...    50   5e-06
AF238044-1|AAF44665.1|  195|Drosophila melanogaster Mig-2-like G...    50   5e-06
AF079459-1|AAC32270.1|  207|Drosophila melanogaster small ras-li...    50   5e-06
AE014297-4152|AAN14120.1|  195|Drosophila melanogaster CG5588-PC...    50   5e-06
AE014297-4151|AAF56727.1|  195|Drosophila melanogaster CG5588-PB...    50   5e-06
AE014297-4150|AAF56728.1|  195|Drosophila melanogaster CG5588-PA...    50   5e-06
AE014297-3431|AAF56218.1|  207|Drosophila melanogaster CG5915-PA...    50   5e-06
AB035672-1|BAA88245.1|  207|Drosophila melanogaster Rab7 protein...    50   5e-06
AY119634-1|AAM50288.1|  222|Drosophila melanogaster RE42508p pro...    49   6e-06
AE014298-3235|EAA46055.2|  273|Drosophila melanogaster CG17515-P...    49   6e-06
AL031027-5|CAA19844.2|  236|Drosophila melanogaster EG:80H7.4 pr...    49   8e-06
AE014298-219|AAF45635.1|  236|Drosophila melanogaster CG14791-PB...    49   8e-06
AE014297-3639|AAF56345.2|  213|Drosophila melanogaster CG31118-P...    49   8e-06
L38311-1|AAA67042.1|  192|Drosophila melanogaster Rho1 protein.        47   3e-05
BT010085-1|AAQ22554.1|  192|Drosophila melanogaster LD03419p pro...    47   3e-05
AY119536-1|AAM50190.1|  192|Drosophila melanogaster GH20776p pro...    47   3e-05
AF177874-1|AAF01186.1|  192|Drosophila melanogaster small GTPase...    47   3e-05
AF177873-1|AAF01185.1|  192|Drosophila melanogaster small GTPase...    47   3e-05
AF177872-1|AAF01184.1|  192|Drosophila melanogaster small GTPase...    47   3e-05
AF177871-1|AAF01183.1|  192|Drosophila melanogaster small GTPase...    47   3e-05
AE013599-2180|AAS64844.1|  192|Drosophila melanogaster CG8416-PG...    47   3e-05
AE013599-2179|AAS64843.1|  192|Drosophila melanogaster CG8416-PF...    47   3e-05
AE013599-2178|AAS64842.1|  192|Drosophila melanogaster CG8416-PE...    47   3e-05
AE013599-2177|AAM70946.1|  192|Drosophila melanogaster CG8416-PD...    47   3e-05
AE013599-2176|AAM70945.1|  192|Drosophila melanogaster CG8416-PC...    47   3e-05
AE013599-2175|AAF58066.1|  192|Drosophila melanogaster CG8416-PB...    47   3e-05
AE013599-2174|AAM70944.1|  192|Drosophila melanogaster CG8416-PA...    47   3e-05
U50314-1|AAB05666.1|  190|Drosophila melanogaster RhoL protein.        45   1e-04
BT024201-1|ABC86263.1|  283|Drosophila melanogaster RE46661p pro...    45   1e-04
AY069811-1|AAL39956.1|  190|Drosophila melanogaster SD05212p pro...    45   1e-04
AE014297-1044|AAF54453.1|  233|Drosophila melanogaster CG8500-PA...    45   1e-04
AE014297-950|AAF54385.1|  190|Drosophila melanogaster CG9366-PA ...    45   1e-04
AB035355-1|BAA87881.1|  190|Drosophila melanogaster Drac3 protein.     45   1e-04
AY075329-1|AAL68196.1|  197|Drosophila melanogaster GH11193p pro...    44   2e-04
AE014298-769|AAF46057.1|  197|Drosophila melanogaster CG3129-PA ...    44   2e-04
D84317-1|BAA21710.1|  197|Drosophila melanogaster rab-related pr...    44   2e-04
AY071647-1|AAL49269.1|  213|Drosophila melanogaster RE70650p pro...    44   3e-04
AY071139-1|AAL48761.1|  256|Drosophila melanogaster RE17845p pro...    44   3e-04
AE014296-128|AAF47406.1|  213|Drosophila melanogaster CG12015-PA...    44   3e-04
AE014134-3093|AAF53798.1|  256|Drosophila melanogaster CG9994-PA...    44   3e-04
M80535-1|AAA28845.1|  184|Drosophila melanogaster GTP-binding pr...    43   5e-04
AY121688-1|AAM52015.1|  184|Drosophila melanogaster RE42418p pro...    43   5e-04
AF186654-1|AAF15520.1|  184|Drosophila melanogaster roughened pr...    43   5e-04
AE014296-375|AAF47583.1|  184|Drosophila melanogaster CG1956-PA ...    43   5e-04
D84316-1|BAA21709.1|  215|Drosophila melanogaster rab14 protein.       42   7e-04
D84313-1|BAA21706.1|  213|Drosophila melanogaster rab2 protein.        42   7e-04
BT003315-1|AAO25075.1|  213|Drosophila melanogaster GH01619p pro...    42   7e-04
AE014134-2489|AAF53390.1|  215|Drosophila melanogaster CG4212-PA...    42   7e-04
AE014134-2488|AAO41194.1|  233|Drosophila melanogaster CG4212-PC...    42   7e-04
AE014134-2487|AAO41193.1|  239|Drosophila melanogaster CG4212-PB...    42   7e-04
AE013599-209|AAM70817.1|  213|Drosophila melanogaster CG3269-PA ...    42   7e-04
AB035352-1|BAA87878.1|  213|Drosophila melanogaster Drab2 protein.     42   7e-04
AY069563-1|AAL39708.1|  215|Drosophila melanogaster LD29476p pro...    42   0.001
AE013599-2512|AAS64815.1|  213|Drosophila melanogaster CG4921-PC...    42   0.001
AE013599-2511|AAM68480.1|  213|Drosophila melanogaster CG4921-PB...    42   0.001
AE013599-2510|AAF57831.1|  213|Drosophila melanogaster CG4921-PA...    42   0.001
AB035670-1|BAA88243.1|  213|Drosophila melanogaster Rab4 protein...    42   0.001
BT023048-1|AAY55464.1|  216|Drosophila melanogaster IP04009p pro...    41   0.002
BT023013-1|AAY55429.1|  216|Drosophila melanogaster IP04109p pro...    41   0.002
BT022972-1|AAY55388.1|  216|Drosophila melanogaster IP04209p pro...    41   0.002
AY752515-1|AAW31971.1|  160|Drosophila melanogaster CG2532 protein.    41   0.002
AY075502-1|AAL68311.1|  431|Drosophila melanogaster RE52190p pro...    41   0.002
AE014298-1412|AAF46555.2|  431|Drosophila melanogaster CG34104-P...    41   0.002
AE014298-1411|ABI30973.1|  582|Drosophila melanogaster CG34104-P...    41   0.002
AY752522-1|AAW31978.1|  160|Drosophila melanogaster CG2532 protein.    41   0.002
AY752521-1|AAW31977.1|  160|Drosophila melanogaster CG2532 protein.    41   0.002
AY752520-1|AAW31976.1|  160|Drosophila melanogaster CG2532 protein.    41   0.002
AY752519-1|AAW31975.1|  160|Drosophila melanogaster CG2532 protein.    41   0.002
AY752518-1|AAW31974.1|  160|Drosophila melanogaster CG2532 protein.    41   0.002
AY752517-1|AAW31973.1|  160|Drosophila melanogaster CG2532 protein.    41   0.002
AY752516-1|AAW31972.1|  160|Drosophila melanogaster CG2532 protein.    41   0.002
AY752514-1|AAW31970.1|  160|Drosophila melanogaster CG2532 protein.    41   0.002
AY752513-1|AAW31969.1|  160|Drosophila melanogaster CG2532 protein.    41   0.002
AL050231-7|CAB43324.1|  306|Drosophila melanogaster EG:BACR37P7....    41   0.002
AE014298-18|AAF45493.2|  306|Drosophila melanogaster CG13375-PA ...    41   0.002
BT012453-1|AAS93724.1|  182|Drosophila melanogaster RE63021p pro...    40   0.004
AY081181-1|AAN85553.1|  219|Drosophila melanogaster Rab5 protein.      40   0.004
AY081180-1|AAN85552.1|  219|Drosophila melanogaster Rab5 protein.      40   0.004
AY060343-1|AAL25382.1|  219|Drosophila melanogaster GH24702p pro...    40   0.004
AF111427-1|AAC98693.1|  182|Drosophila melanogaster Ras-related ...    40   0.004
AE014134-396|AAN10426.1|  219|Drosophila melanogaster CG3664-PF,...    40   0.004
AE014134-395|AAN10425.1|  219|Drosophila melanogaster CG3664-PE,...    40   0.004
AE014134-394|AAN10424.1|  219|Drosophila melanogaster CG3664-PD,...    40   0.004
AE014134-393|AAN10423.1|  219|Drosophila melanogaster CG3664-PC,...    40   0.004
AE014134-392|AAN10422.1|  219|Drosophila melanogaster CG3664-PB,...    40   0.004
AE014134-391|AAF51265.1|  219|Drosophila melanogaster CG3664-PA,...    40   0.004
AE013599-3799|AAF47155.1|  182|Drosophila melanogaster CG3204-PA...    40   0.004
AB035671-1|BAA88244.1|  219|Drosophila melanogaster Rab5 protein...    40   0.004
AB035353-1|BAA87879.1|  219|Drosophila melanogaster Drab5 protein.     40   0.004
Y07564-1|CAA68849.1|  264|Drosophila melanogaster RIC (Ras which...    40   0.005
U23800-1|AAC34902.1|  201|Drosophila melanogaster ral protein.         40   0.005
AY118912-1|AAM50772.1|  201|Drosophila melanogaster LD21679p pro...    40   0.005
AY061365-1|AAL28913.1|  147|Drosophila melanogaster LD28840p pro...    40   0.005
AY024366-1|AAK00587.1|  197|Drosophila melanogaster RAL2 protein.      40   0.005
AE014298-551|AAF45890.1|  201|Drosophila melanogaster CG2849-PC,...    40   0.005
AE014298-550|AAF45889.1|  201|Drosophila melanogaster CG2849-PA,...    40   0.005
AE014298-549|AAN09102.1|  197|Drosophila melanogaster CG2849-PB,...    40   0.005
AE013599-2181|AAF58065.1|  264|Drosophila melanogaster CG8418-PA...    40   0.005
AY118407-1|AAM48436.1|  282|Drosophila melanogaster RE62293p pro...    39   0.007
AE014298-1056|AAF46271.1|  218|Drosophila melanogaster CG12156-P...    39   0.009
M16431-1|AAA28849.1|  195|Drosophila melanogaster protein ( D.me...    38   0.011
M10804-1|AAA99202.1|  195|Drosophila melanogaster ras protein pr...    38   0.011
AY071340-1|AAL48962.1|  218|Drosophila melanogaster RE37651p pro...    38   0.011
DQ138746-1|ABA86352.1|  171|Drosophila melanogaster CG1956 protein.    38   0.020
M16429-1|AAA28847.1|  189|Drosophila melanogaster protein ( D.me...    37   0.035
BT023374-1|AAY55790.1|  358|Drosophila melanogaster IP10363p pro...    37   0.035
AY129454-1|AAM76196.1|  280|Drosophila melanogaster RE28276p pro...    37   0.035
AY094888-1|AAM11241.1|  189|Drosophila melanogaster RE53955p pro...    37   0.035
AY089541-1|AAL90279.1|  189|Drosophila melanogaster LD17536p pro...    37   0.035
AF186648-1|AAF15514.1|  189|Drosophila melanogaster Ras1 protein.      37   0.035
AE014297-953|AAF54388.1|  189|Drosophila melanogaster CG9375-PA ...    37   0.035
AE014296-330|AAF47546.1|  305|Drosophila melanogaster CG7980-PA ...    37   0.035
BT023330-1|AAY55746.1|  191|Drosophila melanogaster IP10163p pro...    36   0.046
BT023274-1|AAY55690.1|  205|Drosophila melanogaster IP10063p pro...    36   0.046
AY061218-1|AAL28766.1|  252|Drosophila melanogaster LD16331p pro...    36   0.046
AF233585-1|AAF60290.1|   21|Drosophila melanogaster Ran10A protein.    36   0.046
AE014298-1768|AAF48164.2|  255|Drosophila melanogaster CG1900-PA...    36   0.046
X02200-1|CAA26131.1|  182|Drosophila melanogaster protein ( Dros...    36   0.061
AY121695-1|AAM52022.1|  101|Drosophila melanogaster RE66843p pro...    36   0.061
K01960-1|AAA28846.1|  189|Drosophila melanogaster protein ( D.me...    36   0.081
U15967-3|AAB60243.1|  192|Drosophila melanogaster small GTP bind...    35   0.11 
AY119135-1|AAM50995.1|  192|Drosophila melanogaster RE36103p pro...    35   0.11 
AY051710-1|AAK93134.1|  745|Drosophila melanogaster LD24835p pro...    35   0.11 
AF217287-1|AAF44065.1|  745|Drosophila melanogaster G protein Rh...    35   0.11 
AE014296-3345|AAF51585.3|  745|Drosophila melanogaster CG5701-PA...    35   0.11 
AE014296-774|AAF47845.2|  192|Drosophila melanogaster CG1167-PA ...    35   0.11 
AE013599-257|AAF57410.3|  280|Drosophila melanogaster CG30158-PA...    35   0.14 
BT011477-1|AAR99135.1|  740|Drosophila melanogaster RE10036p pro...    34   0.25 
AE014296-352|AAS64934.1| 3966|Drosophila melanogaster CG15804-PB...    34   0.25 
AE014296-351|AAF47564.1| 3868|Drosophila melanogaster CG15804-PA...    34   0.25 
AE013599-2718|AAF57675.3|  740|Drosophila melanogaster CG15069-P...    34   0.25 
AE014298-3236|EAA46056.1|  189|Drosophila melanogaster CG17515-P...    33   0.33 
BT022967-1|AAY55383.1|  132|Drosophila melanogaster IP11168p pro...    33   0.43 
BT015987-1|AAV36872.1|  265|Drosophila melanogaster RE54550p pro...    33   0.43 
AE014298-1769|AAN09309.1|  265|Drosophila melanogaster CG1900-PB...    33   0.43 
AY122200-1|AAM52712.1|  261|Drosophila melanogaster LD47384p pro...    32   0.99 
AF209706-1|AAF21440.1|  261|Drosophila melanogaster Rab-related ...    32   0.99 
AE013599-3800|ABC66043.1|   61|Drosophila melanogaster CG3204-PB...    32   0.99 
AE013599-3617|AAF47018.1|  261|Drosophila melanogaster CG3870-PA...    32   0.99 
AY094809-1|AAM11162.1|  186|Drosophila melanogaster LD29185p pro...    31   1.7  
AE014297-699|AAF54194.1|  186|Drosophila melanogaster CG7891-PA ...    31   1.7  
AB185208-1|BAD30092.1|  186|Drosophila melanogaster novel small ...    31   1.7  
AY094697-1|AAM11050.1|  182|Drosophila melanogaster GH10361p pro...    31   2.3  
AE014297-281|AAF52005.3|  182|Drosophila melanogaster CG1081-PB,...    31   2.3  
AE014297-280|AAF52004.3|  182|Drosophila melanogaster CG1081-PA,...    31   2.3  
AE014296-1180|AAF50620.1|  434|Drosophila melanogaster CG8641-PA...    31   2.3  
AE013599-2719|AAM68464.1|  210|Drosophila melanogaster CG15069-P...    31   2.3  
AE014134-808|AAF50957.4| 1286|Drosophila melanogaster CG3047-PA ...    30   4.0  
L25064-1|AAA53668.1|  175|Drosophila melanogaster ADP ribosylati...    29   5.3  
L25063-1|AAA28378.1|  175|Drosophila melanogaster ADP ribosylati...    29   5.3  
AY071116-1|AAL48738.1|  175|Drosophila melanogaster RE16882p pro...    29   5.3  
AE013599-2044|AAM68535.1|  175|Drosophila melanogaster CG8156-PE...    29   5.3  
AE013599-2043|AAM68534.1|  175|Drosophila melanogaster CG8156-PD...    29   5.3  
AE013599-2042|AAM68533.1|  175|Drosophila melanogaster CG8156-PC...    29   5.3  
AE013599-2041|AAM68532.1|  175|Drosophila melanogaster CG8156-PB...    29   5.3  
AE013599-2040|AAF58148.1|  175|Drosophila melanogaster CG8156-PA...    29   5.3  
AY089644-1|AAL90382.1|  611|Drosophila melanogaster RE71924p pro...    29   7.0  
AY061235-1|AAL28783.1|  200|Drosophila melanogaster LD17730p pro...    29   7.0  
AE014298-1275|AAF46445.2|  200|Drosophila melanogaster CG7039-PA...    29   7.0  
AE014296-1555|AAN11979.1|  611|Drosophila melanogaster CG5651-PB...    29   7.0  
AE014296-1554|AAF50342.1|  611|Drosophila melanogaster CG5651-PA...    29   7.0  
AY118519-1|AAM49888.1|  104|Drosophila melanogaster LD16736p pro...    29   9.3  

>BT003574-1|AAO39578.1|  216|Drosophila melanogaster LD40852p
           protein.
          Length = 216

 Score =  227 bits (556), Expect = 1e-59
 Identities = 116/210 (55%), Positives = 133/210 (63%), Gaps = 1/210 (0%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
           D+PTFKCVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL+FHTNRG         
Sbjct: 7   DIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDT 66

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
             +     L      +     +MFDVTSRVTYKNVPNWHRDLVRVCE IPIVLCGNKVDI
Sbjct: 67  AGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDI 126

Query: 461 KDRKVKAKTIVFHRKKICXXXXXXXXXXXXXKNPSCG*LEN*LVTVTLSLLPCLPFCHQK 640
           KDRKVKAK+IVFHRKK               + P        +    L  +        +
Sbjct: 127 KDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPE 186

Query: 641 LQWDPQWQNPIEK-IFRCTNTALPEEDEDL 727
           ++ D  WQ  IE+ +     TALP+EDE+L
Sbjct: 187 VKMDKDWQAQIERDLQEAQATALPDEDEEL 216


>AY070533-1|AAL48004.1|  216|Drosophila melanogaster GM14354p
           protein.
          Length = 216

 Score =  227 bits (556), Expect = 1e-59
 Identities = 116/210 (55%), Positives = 133/210 (63%), Gaps = 1/210 (0%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
           D+PTFKCVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL+FHTNRG         
Sbjct: 7   DIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDT 66

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
             +     L      +     +MFDVTSRVTYKNVPNWHRDLVRVCE IPIVLCGNKVDI
Sbjct: 67  AGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDI 126

Query: 461 KDRKVKAKTIVFHRKKICXXXXXXXXXXXXXKNPSCG*LEN*LVTVTLSLLPCLPFCHQK 640
           KDRKVKAK+IVFHRKK               + P        +    L  +        +
Sbjct: 127 KDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPE 186

Query: 641 LQWDPQWQNPIEK-IFRCTNTALPEEDEDL 727
           ++ D  WQ  IE+ +     TALP+EDE+L
Sbjct: 187 VKMDKDWQAQIERDLQEAQATALPDEDEEL 216


>AY061398-1|AAL28946.1|  216|Drosophila melanogaster LD32416p
           protein.
          Length = 216

 Score =  227 bits (556), Expect = 1e-59
 Identities = 116/210 (55%), Positives = 133/210 (63%), Gaps = 1/210 (0%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
           D+PTFKCVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL+FHTNRG         
Sbjct: 7   DIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDT 66

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
             +     L      +     +MFDVTSRVTYKNVPNWHRDLVRVCE IPIVLCGNKVDI
Sbjct: 67  AGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDI 126

Query: 461 KDRKVKAKTIVFHRKKICXXXXXXXXXXXXXKNPSCG*LEN*LVTVTLSLLPCLPFCHQK 640
           KDRKVKAK+IVFHRKK               + P        +    L  +        +
Sbjct: 127 KDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPE 186

Query: 641 LQWDPQWQNPIEK-IFRCTNTALPEEDEDL 727
           ++ D  WQ  IE+ +     TALP+EDE+L
Sbjct: 187 VKMDKDWQAQIERDLQEAQATALPDEDEEL 216


>AF233584-1|AAF60289.1|  216|Drosophila melanogaster Ran10A protein.
          Length = 216

 Score =  227 bits (556), Expect = 1e-59
 Identities = 116/210 (55%), Positives = 133/210 (63%), Gaps = 1/210 (0%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
           D+PTFKCVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL+FHTNRG         
Sbjct: 7   DIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDT 66

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
             +     L      +     +MFDVTSRVTYKNVPNWHRDLVRVCE IPIVLCGNKVDI
Sbjct: 67  AGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDI 126

Query: 461 KDRKVKAKTIVFHRKKICXXXXXXXXXXXXXKNPSCG*LEN*LVTVTLSLLPCLPFCHQK 640
           KDRKVKAK+IVFHRKK               + P        +    L  +        +
Sbjct: 127 KDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPE 186

Query: 641 LQWDPQWQNPIEK-IFRCTNTALPEEDEDL 727
           ++ D  WQ  IE+ +     TALP+EDE+L
Sbjct: 187 VKMDKDWQAQIERDLQEAQATALPDEDEEL 216


>AE014298-1568|AAN09287.1|  216|Drosophila melanogaster CG1404-PB,
           isoform B protein.
          Length = 216

 Score =  227 bits (556), Expect = 1e-59
 Identities = 116/210 (55%), Positives = 133/210 (63%), Gaps = 1/210 (0%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
           D+PTFKCVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL+FHTNRG         
Sbjct: 7   DIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDT 66

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
             +     L      +     +MFDVTSRVTYKNVPNWHRDLVRVCE IPIVLCGNKVDI
Sbjct: 67  AGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDI 126

Query: 461 KDRKVKAKTIVFHRKKICXXXXXXXXXXXXXKNPSCG*LEN*LVTVTLSLLPCLPFCHQK 640
           KDRKVKAK+IVFHRKK               + P        +    L  +        +
Sbjct: 127 KDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPE 186

Query: 641 LQWDPQWQNPIEK-IFRCTNTALPEEDEDL 727
           ++ D  WQ  IE+ +     TALP+EDE+L
Sbjct: 187 VKMDKDWQAQIERDLQEAQATALPDEDEEL 216


>AE014298-1567|AAF48008.1|  216|Drosophila melanogaster CG1404-PA,
           isoform A protein.
          Length = 216

 Score =  227 bits (556), Expect = 1e-59
 Identities = 116/210 (55%), Positives = 133/210 (63%), Gaps = 1/210 (0%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
           D+PTFKCVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL+FHTNRG         
Sbjct: 7   DIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDT 66

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
             +     L      +     +MFDVTSRVTYKNVPNWHRDLVRVCE IPIVLCGNKVDI
Sbjct: 67  AGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDI 126

Query: 461 KDRKVKAKTIVFHRKKICXXXXXXXXXXXXXKNPSCG*LEN*LVTVTLSLLPCLPFCHQK 640
           KDRKVKAK+IVFHRKK               + P        +    L  +        +
Sbjct: 127 KDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPE 186

Query: 641 LQWDPQWQNPIEK-IFRCTNTALPEEDEDL 727
           ++ D  WQ  IE+ +     TALP+EDE+L
Sbjct: 187 VKMDKDWQAQIERDLQEAQATALPDEDEEL 216


>AF220950-1|AAF30287.1|  216|Drosophila melanogaster GTP-binding
           nuclear protein RAN protein.
          Length = 216

 Score =  219 bits (536), Expect = 3e-57
 Identities = 113/210 (53%), Positives = 130/210 (61%), Gaps = 1/210 (0%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
           D+PTFKCVLVGDGGTGKTTFVKRH+TGEFEKKYVATLGVEVHPL+FHTNRG         
Sbjct: 7   DIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDT 66

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
             +     L      +     +M D  SRVTYKNVPNWHRDLVRVCE IPIVLCGNKVDI
Sbjct: 67  AGQEKFGGLRDGYYIQGQCAVIMVDGNSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDI 126

Query: 461 KDRKVKAKTIVFHRKKICXXXXXXXXXXXXXKNPSCG*LEN*LVTVTLSLLPCLPFCHQK 640
           KDRKVKAK+IVFHRKK               + P        +    L  +        +
Sbjct: 127 KDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLCWARKLVGDPNLEFVAMPALLPPE 186

Query: 641 LQWDPQWQNPIEK-IFRCTNTALPEEDEDL 727
           ++ D  WQ  IE+ +     TALP+EDE+L
Sbjct: 187 VKMDKDWQAQIERDLQEAQATALPDEDEEL 216


>AY070523-1|AAL47994.1|  217|Drosophila melanogaster GH25818p
           protein.
          Length = 217

 Score =  144 bits (349), Expect = 1e-34
 Identities = 71/131 (54%), Positives = 84/131 (64%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GDGGTGKTT VKRHLTGEF+ +Y ATLGVEV  L+F+TNRG F +       + 
Sbjct: 11  FKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWDTAGQE 70

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDRK 472
               L      +     +MFDV S  TY NV  WHRDLVRVC  IPIV+CGNKVDI  +K
Sbjct: 71  RYGGLRDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKK 130

Query: 473 VKAKTIVFHRK 505
              K + F RK
Sbjct: 131 TWKKGVDFDRK 141



 Score = 95.9 bits (228), Expect = 5e-20
 Identities = 50/135 (37%), Positives = 75/135 (55%)
 Frame = +1

Query: 259 RFNVWDTAGQEKFGGLRDGYYIQGQCAISHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCL 438
           R +VWDTAGQE++GGLRDGY++Q QCAI       S+                   P  +
Sbjct: 60  RIDVWDTAGQERYGGLRDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVI 119

Query: 439 VRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVAM 618
              +     +K+  +   F ++ ++   ++SAKSNYN EKPF++L RKL+GD +L+ V  
Sbjct: 120 CGNKVDIMHKKTWKKGVDFDRKTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQS 179

Query: 619 PALLPPEVTMGSSMA 663
           PA+ PP+V     M+
Sbjct: 180 PAIQPPKVVFTDEMS 194


>AE014296-2503|AAF49642.1|  217|Drosophila melanogaster CG7815-PA
           protein.
          Length = 217

 Score =  144 bits (349), Expect = 1e-34
 Identities = 71/131 (54%), Positives = 84/131 (64%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GDGGTGKTT VKRHLTGEF+ +Y ATLGVEV  L+F+TNRG F +       + 
Sbjct: 11  FKLILIGDGGTGKTTLVKRHLTGEFKMQYNATLGVEVEQLLFNTNRGVFRIDVWDTAGQE 70

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDRK 472
               L      +     +MFDV S  TY NV  WHRDLVRVC  IPIV+CGNKVDI  +K
Sbjct: 71  RYGGLRDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVICGNKVDIMHKK 130

Query: 473 VKAKTIVFHRK 505
              K + F RK
Sbjct: 131 TWKKGVDFDRK 141



 Score = 95.9 bits (228), Expect = 5e-20
 Identities = 50/135 (37%), Positives = 75/135 (55%)
 Frame = +1

Query: 259 RFNVWDTAGQEKFGGLRDGYYIQGQCAISHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCL 438
           R +VWDTAGQE++GGLRDGY++Q QCAI       S+                   P  +
Sbjct: 60  RIDVWDTAGQERYGGLRDGYFVQSQCAIIMFDVASSNTYNNVKRWHRDLVRVCGNIPIVI 119

Query: 439 VRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVAM 618
              +     +K+  +   F ++ ++   ++SAKSNYN EKPF++L RKL+GD +L+ V  
Sbjct: 120 CGNKVDIMHKKTWKKGVDFDRKTNIYLIEMSAKSNYNVEKPFVYLLRKLVGDPSLQLVQS 179

Query: 619 PALLPPEVTMGSSMA 663
           PA+ PP+V     M+
Sbjct: 180 PAIQPPKVVFTDEMS 194


>AY752534-1|AAW31990.1|  195|Drosophila melanogaster CG2885 protein.
          Length = 195

 Score = 64.9 bits (151), Expect = 1e-10
 Identities = 37/139 (26%), Positives = 76/139 (54%), Gaps = 5/139 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHP-LVFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +KY+ T+G++V    V   +R   + +  T  DK
Sbjct: 8   FKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDK 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIKD 466
           R   ++ ++      +L +++D+TS  +++N+  W +++ R+C + + ++L GNK D  +
Sbjct: 68  RFNSLMPSNYRSAHGIL-LVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPN 126

Query: 467 RKVKAKTIVF---HRKKIC 514
            +  +    F   HR+ +C
Sbjct: 127 HRQVSMEQGFNYAHRQSLC 145


>AY752540-1|AAW31996.1|  195|Drosophila melanogaster CG2885 protein.
          Length = 195

 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 33/117 (28%), Positives = 67/117 (57%), Gaps = 2/117 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHP-LVFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +KY+ T+G++V    V   +R   + +  T  DK
Sbjct: 8   FKVIVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDK 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVD 457
           R   ++ ++      +L +++D+TS  +++N+  W +++ R+C + + ++L GNK D
Sbjct: 68  RFNSLMPSNYRSAHGIL-LVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSD 123


>AY752539-1|AAW31995.1|  195|Drosophila melanogaster CG2885 protein.
          Length = 195

 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 33/117 (28%), Positives = 67/117 (57%), Gaps = 2/117 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHP-LVFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +KY+ T+G++V    V   +R   + +  T  DK
Sbjct: 8   FKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDK 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVD 457
           R   ++ ++      +L +++D+TS  +++N+  W +++ R+C + + ++L GNK D
Sbjct: 68  RFNSLMPSNYRSAHGIL-LVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKCD 123


>AY752542-1|AAW31998.1|  195|Drosophila melanogaster CG2885 protein.
          Length = 195

 Score = 63.3 bits (147), Expect = 4e-10
 Identities = 33/117 (28%), Positives = 67/117 (57%), Gaps = 2/117 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHP-LVFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +KY+ T+G++V    V   +R   + +  T  DK
Sbjct: 8   FKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDK 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVD 457
           R   ++ ++      +L +++D+TS  +++N+  W +++ R+C + + ++L GNK D
Sbjct: 68  RFNSLMPSNYRSAHGIL-LVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSD 123


>AY752538-1|AAW31994.1|  195|Drosophila melanogaster CG2885 protein.
          Length = 195

 Score = 63.3 bits (147), Expect = 4e-10
 Identities = 33/117 (28%), Positives = 67/117 (57%), Gaps = 2/117 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHP-LVFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +KY+ T+G++V    V   +R   + +  T  DK
Sbjct: 8   FKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDK 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVD 457
           R   ++ ++      +L +++D+TS  +++N+  W +++ R+C + + ++L GNK D
Sbjct: 68  RFNSLMPSNYRSAHGIL-LVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSD 123


>AY752536-1|AAW31992.1|  195|Drosophila melanogaster CG2885 protein.
          Length = 195

 Score = 63.3 bits (147), Expect = 4e-10
 Identities = 33/117 (28%), Positives = 67/117 (57%), Gaps = 2/117 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHP-LVFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +KY+ T+G++V    V   +R   + +  T  DK
Sbjct: 8   FKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDK 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVD 457
           R   ++ ++      +L +++D+TS  +++N+  W +++ R+C + + ++L GNK D
Sbjct: 68  RFNSLMPSNYRSAHGIL-LVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSD 123


>AY752535-1|AAW31991.1|  195|Drosophila melanogaster CG2885 protein.
          Length = 195

 Score = 63.3 bits (147), Expect = 4e-10
 Identities = 33/117 (28%), Positives = 67/117 (57%), Gaps = 2/117 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHP-LVFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +KY+ T+G++V    V   +R   + +  T  DK
Sbjct: 8   FKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDK 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVD 457
           R   ++ ++      +L +++D+TS  +++N+  W +++ R+C + + ++L GNK D
Sbjct: 68  RFNSLMPSNYRSAHGIL-LVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSD 123


>AE014298-1452|AAF46585.1|  195|Drosophila melanogaster CG2885-PA
           protein.
          Length = 195

 Score = 63.3 bits (147), Expect = 4e-10
 Identities = 33/117 (28%), Positives = 67/117 (57%), Gaps = 2/117 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHP-LVFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +KY+ T+G++V    V   +R   + +  T  DK
Sbjct: 8   FKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDK 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVD 457
           R   ++ ++      +L +++D+TS  +++N+  W +++ R+C + + ++L GNK D
Sbjct: 68  RFNSLMPSNYRSAHGIL-LVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSD 123


>D84348-1|BAA21712.1|  219|Drosophila melanogaster rab-related
           protein 3 protein.
          Length = 219

 Score = 62.9 bits (146), Expect = 5e-10
 Identities = 33/121 (27%), Positives = 59/121 (48%), Gaps = 1/121 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK VL+GD GTGKT  V R  TG + +++  T+GV+           Q  L       + 
Sbjct: 22  FKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQE 81

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
               +        N + +++D+T R ++ N+  W  ++ R     + I+L GNK D++++
Sbjct: 82  RFRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQ 141

Query: 470 K 472
           +
Sbjct: 142 R 142


>AY071400-1|AAL49022.1|  219|Drosophila melanogaster RE48347p
           protein.
          Length = 219

 Score = 62.9 bits (146), Expect = 5e-10
 Identities = 33/121 (27%), Positives = 59/121 (48%), Gaps = 1/121 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK VL+GD GTGKT  V R  TG + +++  T+GV+           Q  L       + 
Sbjct: 22  FKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQE 81

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
               +        N + +++D+T R ++ N+  W  ++ R     + I+L GNK D++++
Sbjct: 82  RFRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQ 141

Query: 470 K 472
           +
Sbjct: 142 R 142


>AY061826-1|AAL27637.1|  388|Drosophila melanogaster GH21984p
           protein.
          Length = 388

 Score = 62.9 bits (146), Expect = 5e-10
 Identities = 44/133 (33%), Positives = 72/133 (54%), Gaps = 6/133 (4%)
 Frame = +2

Query: 98  DDMPTFKCVLVGDGGTGKTTFVKRHLTGEFE-KKYVATLGVEVHPLVFHTNRGQFVL-MC 271
           DD    K +L+GD G GKT+F+ ++ TGEF    + AT+G+ +   V   +  +  L + 
Sbjct: 186 DDTVNHKTILLGDSGVGKTSFLVKYNTGEFRLGSFSATVGIALTNKVVVVDGTRVKLQIW 245

Query: 272 GTQPDKRSLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCG 445
            T   +R   V  T   ++D + L +++DVT++ TY N+  W  ++     E + IVL G
Sbjct: 246 DTAGQERFRSV--THAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIG 303

Query: 446 NKVDI--KDRKVK 478
           NK D    +R+VK
Sbjct: 304 NKADCSGSERQVK 316


>AE014296-3519|AAF51708.2|  388|Drosophila melanogaster CG7605-PA
           protein.
          Length = 388

 Score = 62.9 bits (146), Expect = 5e-10
 Identities = 44/133 (33%), Positives = 72/133 (54%), Gaps = 6/133 (4%)
 Frame = +2

Query: 98  DDMPTFKCVLVGDGGTGKTTFVKRHLTGEFE-KKYVATLGVEVHPLVFHTNRGQFVL-MC 271
           DD    K +L+GD G GKT+F+ ++ TGEF    + AT+G+ +   V   +  +  L + 
Sbjct: 186 DDTVNHKTILLGDSGVGKTSFLVKYNTGEFRLGSFSATVGIALTNKVVVVDGTRVKLQIW 245

Query: 272 GTQPDKRSLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCG 445
            T   +R   V  T   ++D + L +++DVT++ TY N+  W  ++     E + IVL G
Sbjct: 246 DTAGQERFRSV--THAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIG 303

Query: 446 NKVDI--KDRKVK 478
           NK D    +R+VK
Sbjct: 304 NKADCSGSERQVK 316


>AE014296-1412|AAF50452.1|  219|Drosophila melanogaster CG7062-PA
           protein.
          Length = 219

 Score = 62.9 bits (146), Expect = 5e-10
 Identities = 33/121 (27%), Positives = 59/121 (48%), Gaps = 1/121 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK VL+GD GTGKT  V R  TG + +++  T+GV+           Q  L       + 
Sbjct: 22  FKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQE 81

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
               +        N + +++D+T R ++ N+  W  ++ R     + I+L GNK D++++
Sbjct: 82  RFRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQ 141

Query: 470 K 472
           +
Sbjct: 142 R 142


>AY752537-1|AAW31993.1|  195|Drosophila melanogaster CG2885 protein.
          Length = 195

 Score = 62.5 bits (145), Expect = 6e-10
 Identities = 33/117 (28%), Positives = 67/117 (57%), Gaps = 2/117 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHP-LVFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +KY+ T+G++V    V   +R   + +  T  DK
Sbjct: 8   FKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDK 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVD 457
           R   ++ ++      +L +++D+TS  +++N+  W +++ R+C + + ++L GNK D
Sbjct: 68  RFNSLMPSNYRSAHGIL-LVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSD 123


>AY752533-1|AAW31989.1|  195|Drosophila melanogaster CG2885 protein.
          Length = 195

 Score = 62.5 bits (145), Expect = 6e-10
 Identities = 33/117 (28%), Positives = 67/117 (57%), Gaps = 2/117 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHP-LVFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +KY+ T+G++V    V   +R   + +  T  DK
Sbjct: 8   FKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDK 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVD 457
           R   ++ ++      +L +++D+TS  +++N+  W +++ R+C + + ++L GNK D
Sbjct: 68  RFNSLMPSNYRSAHGIL-LVYDITSSKSFQNIDGWMKEIRRMCPDKVIVLLVGNKSD 123


>AE014298-1475|AAF46610.2|  197|Drosophila melanogaster CG9807-PA
           protein.
          Length = 197

 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 37/141 (26%), Positives = 76/141 (53%), Gaps = 7/141 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVH--PLVFHTNR-GQFVLMCGTQP 283
           FK +++GD G GKT  + R    +F +++  T+G++     + F   R G+ + +  T  
Sbjct: 8   FKIIILGDSGVGKTCLLMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGRMLQVWDTSD 67

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDI 460
           D+R  ++  T       +L +++D+TS  +++N+  W +++ R+C + + ++L GNK D 
Sbjct: 68  DERFKLLKATQCRSAHGIL-LVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDD 126

Query: 461 KDRKVKAKTIVF---HRKKIC 514
            + +  +    F   HR+ IC
Sbjct: 127 PNHRQVSMAQGFNYAHRQSIC 147


>AY113574-1|AAM29579.1|  268|Drosophila melanogaster RH23273p
           protein.
          Length = 268

 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 36/133 (27%), Positives = 64/133 (48%), Gaps = 2/133 (1%)
 Frame = +2

Query: 83  TTKMADDMP-TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF 259
           T+   DD+    K V+VG+GG GK++ ++R+  G F K Y  T+GV+        +    
Sbjct: 27  TSMREDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDV 86

Query: 260 VLMCGTQPDKRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCEGIPIV 436
            +M      +     + T   ++    SV+ F  T R ++  + +W R +   C  IP V
Sbjct: 87  RIMLWDTAGQEEFDCI-TKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECNEIPTV 145

Query: 437 LCGNKVDIKDRKV 475
           +  NK+D+ ++ V
Sbjct: 146 IVQNKIDLIEQAV 158


>AE014298-1530|AAF47981.2|  197|Drosophila melanogaster CG32671-PA
           protein.
          Length = 197

 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 37/141 (26%), Positives = 76/141 (53%), Gaps = 7/141 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVH--PLVFHTNR-GQFVLMCGTQP 283
           FK +++GD G GKT  + R    +F  ++ +T+G++     + F   R G+ + +  T  
Sbjct: 8   FKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGRMLQVWDTSD 67

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDI 460
           D+R  ++  T       +L +++D+TS  +++N+  W +++ R+C + + ++L GNK D 
Sbjct: 68  DERFKLLKATQCRSAHGIL-LVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDD 126

Query: 461 KDRKVKAKTIVF---HRKKIC 514
            + +  +    F   HR+ IC
Sbjct: 127 PNHRQVSMAQGFNYAHRQSIC 147


>AE014298-1478|AAN09264.1|  197|Drosophila melanogaster CG32673-PA
           protein.
          Length = 197

 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 38/141 (26%), Positives = 76/141 (53%), Gaps = 7/141 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVH--PLVFHTNR-GQFVLMCGTQP 283
           FK +++GD G GKT  + R    +F  ++ +TLG++     + F   R G+ + +  T  
Sbjct: 8   FKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTLGMDRRECSVEFADWRMGRMLQVWDTSD 67

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDI 460
           D+R  ++  T       +L +++D+TS  +++N+  W +++ R+C + + ++L GNK D 
Sbjct: 68  DERFKLLKATHCRSAHGIL-LVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDD 126

Query: 461 KDRKVKAKTIVF---HRKKIC 514
            + +  +    F   HR+ IC
Sbjct: 127 PNHRQVSMAQGFNYAHRQSIC 147


>AE014298-1469|AAN09263.1|  197|Drosophila melanogaster CG32678-PA
           protein.
          Length = 197

 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 38/141 (26%), Positives = 76/141 (53%), Gaps = 7/141 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVH--PLVFHTNR-GQFVLMCGTQP 283
           FK +L+GD G GKT  + R    +F  ++ +T+G++     + F   R G+ + +  T  
Sbjct: 8   FKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGRMLQVWDTSD 67

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDI 460
           D+R  ++  T       +L +++D+TS  +++N+  W +++ R+C + + ++L GNK D 
Sbjct: 68  DERFKLLKATQCRSAHGIL-LVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDD 126

Query: 461 KDRKVKAKTIVF---HRKKIC 514
            + +  +    F   HR+ IC
Sbjct: 127 PNHRQVSMAQGFNYAHRQSIC 147


>AE014297-330|AAF51970.1|  268|Drosophila melanogaster CG2108-PA
           protein.
          Length = 268

 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 36/133 (27%), Positives = 64/133 (48%), Gaps = 2/133 (1%)
 Frame = +2

Query: 83  TTKMADDMP-TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF 259
           T+   DD+    K V+VG+GG GK++ ++R+  G F K Y  T+GV+        +    
Sbjct: 27  TSMREDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDV 86

Query: 260 VLMCGTQPDKRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCEGIPIV 436
            +M      +     + T   ++    SV+ F  T R ++  + +W R +   C  IP V
Sbjct: 87  RIMLWDTAGQEEFDCI-TKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECNEIPTV 145

Query: 437 LCGNKVDIKDRKV 475
           +  NK+D+ ++ V
Sbjct: 146 IVQNKIDLIEQAV 158


>AY752541-1|AAW31997.1|  185|Drosophila melanogaster CG2885 protein.
          Length = 185

 Score = 59.3 bits (137), Expect = 6e-09
 Identities = 31/114 (27%), Positives = 65/114 (57%), Gaps = 2/114 (1%)
 Frame = +2

Query: 122 VLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHP-LVFHTNRGQFVLMCGTQPDKRSL 298
           +++GD G GK+  + R     F +KY+ T+G++V    V   +R   + +  T  DKR  
Sbjct: 1   LVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSRVMMLQVWDTSGDKRFN 60

Query: 299 VVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVD 457
            ++ ++      +L +++D+TS  +++N+  W +++ R+C + + ++L GNK D
Sbjct: 61  SLMPSNYRSAHGIL-LVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSD 113


>AY094795-1|AAM11148.1|  201|Drosophila melanogaster LD21953p
           protein.
          Length = 201

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 34/122 (27%), Positives = 59/122 (48%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +++GD G GK++ + R     F   Y+ T+GV+           +  L       + 
Sbjct: 9   FKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDR 469
               + T T ++  + + V++DVT+  ++ NV  W  ++   C+ +  VL GNK D  DR
Sbjct: 69  RFRTI-TSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDVVKKVLVGNKNDDPDR 127

Query: 470 KV 475
           KV
Sbjct: 128 KV 129


>AE014298-2969|AAF45371.1|  201|Drosophila melanogaster CG9575-PA
           protein.
          Length = 201

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 34/122 (27%), Positives = 59/122 (48%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +++GD G GK++ + R     F   Y+ T+GV+           +  L       + 
Sbjct: 9   FKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDR 469
               + T T ++  + + V++DVT+  ++ NV  W  ++   C+ +  VL GNK D  DR
Sbjct: 69  RFRTI-TSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDVVKKVLVGNKNDDPDR 127

Query: 470 KV 475
           KV
Sbjct: 128 KV 129


>U11824-1|AAA62871.1|  191|Drosophila melanogaster Dcdc42 protein.
          Length = 191

 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 34/136 (25%), Positives = 64/136 (47%), Gaps = 1/136 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M T KCV+VGDG  GKT  +  + T +F  +YV T+  + + +        + L      
Sbjct: 1   MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTV-FDNYAVTVMIGGEPYTLGLFDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDI 460
            +     L   +  + +V  V F V S  +++NV   W  ++   C+  P +L G ++D+
Sbjct: 60  GQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDL 119

Query: 461 KDRKVKAKTIVFHRKK 508
           +D     + +  +++K
Sbjct: 120 RDENSTLEKLAKNKQK 135


>D84312-1|BAA21705.1|  205|Drosophila melanogaster rab1 protein.
          Length = 205

 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GK+  + R     + + Y++T+GV+        +     L       + 
Sbjct: 12  FKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQE 71

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
               + +      + + V++D T + ++ NV  W  ++ R  CE +  +L GNK D+  +
Sbjct: 72  RFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTK 131

Query: 470 KV 475
           KV
Sbjct: 132 KV 133


>AY119570-1|AAM50224.1|  191|Drosophila melanogaster HL08128p
           protein.
          Length = 191

 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 34/136 (25%), Positives = 64/136 (47%), Gaps = 1/136 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M T KCV+VGDG  GKT  +  + T +F  +YV T+  + + +        + L      
Sbjct: 1   MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTV-FDNYAVTVMIGGEPYTLGLFDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDI 460
            +     L   +  + +V  V F V S  +++NV   W  ++   C+  P +L G ++D+
Sbjct: 60  GQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDL 119

Query: 461 KDRKVKAKTIVFHRKK 508
           +D     + +  +++K
Sbjct: 120 RDENSTLEKLAKNKQK 135


>AF153428-1|AAD43792.1|  191|Drosophila melanogaster CDC42 protein
           protein.
          Length = 191

 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 34/136 (25%), Positives = 64/136 (47%), Gaps = 1/136 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M T KCV+VGDG  GKT  +  + T +F  +YV T+  + + +        + L      
Sbjct: 1   MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTV-FDNYAVTVMIGGEPYTLGLFDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDI 460
            +     L   +  + +V  V F V S  +++NV   W  ++   C+  P +L G ++D+
Sbjct: 60  GQEDYNRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDL 119

Query: 461 KDRKVKAKTIVFHRKK 508
           +D     + +  +++K
Sbjct: 120 RDENSTLEKLAKNKQK 135


>AF153427-1|AAD43791.1|  191|Drosophila melanogaster CDC42 protein
           protein.
          Length = 191

 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 34/136 (25%), Positives = 64/136 (47%), Gaps = 1/136 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M T KCV+VGDG  GKT  +  + T +F  +YV T+  + + +        + L      
Sbjct: 1   MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTV-FDNYAVTVMIGGEPYTLGLFDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDI 460
            +     L   +  + +V  V F V S  +++NV   W  ++   C+  P +L G ++D+
Sbjct: 60  GQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDL 119

Query: 461 KDRKVKAKTIVFHRKK 508
           +D     + +  +++K
Sbjct: 120 RDENSTLEKLAKNKQK 135


>AF153425-1|AAD43789.1|  191|Drosophila melanogaster CDC42 protein
           protein.
          Length = 191

 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 34/136 (25%), Positives = 64/136 (47%), Gaps = 1/136 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M T KCV+VGDG  GKT  +  + T +F  +YV T+  + + +        + L      
Sbjct: 1   MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTV-FDNYAVTVMIGGEPYTLGLFDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDI 460
            +     L   +  + +V  V F V S  +++NV   W  ++   C+  P +L G ++D+
Sbjct: 60  GQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDL 119

Query: 461 KDRKVKAKTIVFHRKK 508
           +D     + +  +++K
Sbjct: 120 RDENSTLEKLAKNKQK 135


>AF153423-1|AAD43787.1|  191|Drosophila melanogaster CDC42 protein
           protein.
          Length = 191

 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 34/136 (25%), Positives = 64/136 (47%), Gaps = 1/136 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M T KCV+VGDG  GKT  +  + T +F  +YV T+  + + +        + L      
Sbjct: 1   MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTV-FDNYAVTVMIGGEPYTLGLFDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDI 460
            +     L   +  + +V  V F V S  +++NV   W  ++   C+  P +L G ++D+
Sbjct: 60  GQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDL 119

Query: 461 KDRKVKAKTIVFHRKK 508
           +D     + +  +++K
Sbjct: 120 RDENSTLEKLAKNKQK 135


>AE014298-2918|AAN09512.1|  191|Drosophila melanogaster CG12530-PB,
           isoform B protein.
          Length = 191

 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 34/136 (25%), Positives = 64/136 (47%), Gaps = 1/136 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M T KCV+VGDG  GKT  +  + T +F  +YV T+  + + +        + L      
Sbjct: 1   MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTV-FDNYAVTVMIGGEPYTLGLFDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDI 460
            +     L   +  + +V  V F V S  +++NV   W  ++   C+  P +L G ++D+
Sbjct: 60  GQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDL 119

Query: 461 KDRKVKAKTIVFHRKK 508
           +D     + +  +++K
Sbjct: 120 RDENSTLEKLAKNKQK 135


>AE014298-2917|AAF49007.1|  191|Drosophila melanogaster CG12530-PA,
           isoform A protein.
          Length = 191

 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 34/136 (25%), Positives = 64/136 (47%), Gaps = 1/136 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M T KCV+VGDG  GKT  +  + T +F  +YV T+  + + +        + L      
Sbjct: 1   MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTV-FDNYAVTVMIGGEPYTLGLFDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDI 460
            +     L   +  + +V  V F V S  +++NV   W  ++   C+  P +L G ++D+
Sbjct: 60  GQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDL 119

Query: 461 KDRKVKAKTIVFHRKK 508
           +D     + +  +++K
Sbjct: 120 RDENSTLEKLAKNKQK 135


>AE014297-2966|AAN13857.1|  146|Drosophila melanogaster CG3320-PB,
           isoform B protein.
          Length = 146

 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GK+  + R     + + Y++T+GV+        +     L       + 
Sbjct: 12  FKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQE 71

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
               + +      + + V++D T + ++ NV  W  ++ R  CE +  +L GNK D+  +
Sbjct: 72  RFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTK 131

Query: 470 KV 475
           KV
Sbjct: 132 KV 133


>AE014297-2965|AAF55873.1|  205|Drosophila melanogaster CG3320-PA,
           isoform A protein.
          Length = 205

 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GK+  + R     + + Y++T+GV+        +     L       + 
Sbjct: 12  FKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQE 71

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
               + +      + + V++D T + ++ NV  W  ++ R  CE +  +L GNK D+  +
Sbjct: 72  RFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTK 131

Query: 470 KV 475
           KV
Sbjct: 132 KV 133


>AF153429-1|AAD43793.1|  191|Drosophila melanogaster CDC42 protein
           protein.
          Length = 191

 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 34/136 (25%), Positives = 64/136 (47%), Gaps = 1/136 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M T KCV+VGDG  GKT  +  + T +F  +YV T+  + + +        + L      
Sbjct: 1   MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTV-FDNYAVTVMIGGEPYTLGLFDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDI 460
            +     L   +  + +V  V F V S  +++NV   W  ++   C+  P +L G ++D+
Sbjct: 60  GQEDYDRLRPLSYPQTDVFLVCFLVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDL 119

Query: 461 KDRKVKAKTIVFHRKK 508
           +D     + +  +++K
Sbjct: 120 RDENSTLEKLAKNKQK 135


>BT001448-1|AAN71203.1|  306|Drosophila melanogaster GH26660p
           protein.
          Length = 306

 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 6/121 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           +K +++G+ GTGKT+F+KR++   F + Y AT+GV+    V   +    V +       +
Sbjct: 104 YKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQ 163

Query: 293 SLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL---VRVCEG--IPIVLCGNKV 454
                 T   +K+ V   ++FDVT   T+  V  W  DL   V++ +G  IP +L  NK 
Sbjct: 164 ERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKC 223

Query: 455 D 457
           D
Sbjct: 224 D 224


>AY069328-1|AAL39473.1|  388|Drosophila melanogaster LD04613p
           protein.
          Length = 388

 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 6/121 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           +K +++G+ GTGKT+F+KR++   F + Y AT+GV+    V   +    V +       +
Sbjct: 186 YKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQ 245

Query: 293 SLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL---VRVCEG--IPIVLCGNKV 454
                 T   +K+ V   ++FDVT   T+  V  W  DL   V++ +G  IP +L  NK 
Sbjct: 246 ERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKC 305

Query: 455 D 457
           D
Sbjct: 306 D 306


>AE013599-820|AAF58970.1|  686|Drosophila melanogaster CG8024-PB,
           isoform B protein.
          Length = 686

 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 6/121 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           +K +++G+ GTGKT+F+KR++   F + Y AT+GV+    V   +    V +       +
Sbjct: 484 YKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQ 543

Query: 293 SLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL---VRVCEG--IPIVLCGNKV 454
                 T   +K+ V   ++FDVT   T+  V  W  DL   V++ +G  IP +L  NK 
Sbjct: 544 ERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKC 603

Query: 455 D 457
           D
Sbjct: 604 D 604


>AE013599-819|AAG22295.2|  385|Drosophila melanogaster CG8024-PA,
           isoform A protein.
          Length = 385

 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 6/121 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           +K +++G+ GTGKT+F+KR++   F + Y AT+GV+    V   +    V +       +
Sbjct: 183 YKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQ 242

Query: 293 SLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL---VRVCEG--IPIVLCGNKV 454
                 T   +K+ V   ++FDVT   T+  V  W  DL   V++ +G  IP +L  NK 
Sbjct: 243 ERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKC 302

Query: 455 D 457
           D
Sbjct: 303 D 303


>AE013599-818|AAM68818.1|  388|Drosophila melanogaster CG8024-PE,
           isoform E protein.
          Length = 388

 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 6/121 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           +K +++G+ GTGKT+F+KR++   F + Y AT+GV+    V   +    V +       +
Sbjct: 186 YKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQ 245

Query: 293 SLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL---VRVCEG--IPIVLCGNKV 454
                 T   +K+ V   ++FDVT   T+  V  W  DL   V++ +G  IP +L  NK 
Sbjct: 246 ERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKC 305

Query: 455 D 457
           D
Sbjct: 306 D 306


>AE013599-817|AAM68817.1|  388|Drosophila melanogaster CG8024-PC,
           isoform C protein.
          Length = 388

 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 6/121 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           +K +++G+ GTGKT+F+KR++   F + Y AT+GV+    V   +    V +       +
Sbjct: 186 YKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQ 245

Query: 293 SLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL---VRVCEG--IPIVLCGNKV 454
                 T   +K+ V   ++FDVT   T+  V  W  DL   V++ +G  IP +L  NK 
Sbjct: 246 ERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKC 305

Query: 455 D 457
           D
Sbjct: 306 D 306


>AE013599-816|AAM68816.2|  222|Drosophila melanogaster CG8024-PD,
           isoform D protein.
          Length = 222

 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 6/121 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           +K +++G+ GTGKT+F+KR++   F + Y AT+GV+    V   +    V +       +
Sbjct: 20  YKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQ 79

Query: 293 SLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL---VRVCEG--IPIVLCGNKV 454
                 T   +K+ V   ++FDVT   T+  V  W  DL   V++ +G  IP +L  NK 
Sbjct: 80  ERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKC 139

Query: 455 D 457
           D
Sbjct: 140 D 140


>AB035646-1|BAA88238.1|  231|Drosophila melanogaster Rab-related
           protein 1 protein.
          Length = 231

 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 6/121 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           +K +++G+ GTGKT+F+KR++   F + Y AT+GV+    V   +    V +       +
Sbjct: 29  YKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQ 88

Query: 293 SLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL---VRVCEG--IPIVLCGNKV 454
                 T   +K+ V   ++FDVT   T+  V  W  DL   V++ +G  IP +L  NK 
Sbjct: 89  ERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKC 148

Query: 455 D 457
           D
Sbjct: 149 D 149


>AF153426-1|AAD43790.1|  191|Drosophila melanogaster CDC42 protein
           protein.
          Length = 191

 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 33/136 (24%), Positives = 63/136 (46%), Gaps = 1/136 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M T KCV+VGDG  GKT  +  + T +F  +YV T+  + + +        + L      
Sbjct: 1   MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTV-FDNYAVTVMIGGEPYTLGLFDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDI 460
            +     L   +  + +V  V F V S  +++NV   W  ++   C+  P +L   ++D+
Sbjct: 60  GQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVDTQIDL 119

Query: 461 KDRKVKAKTIVFHRKK 508
           +D     + +  +++K
Sbjct: 120 RDENSTLEKLAKNKQK 135


>AF153424-1|AAD43788.1|  191|Drosophila melanogaster CDC42 protein
           protein.
          Length = 191

 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 33/136 (24%), Positives = 63/136 (46%), Gaps = 1/136 (0%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M T KCV+V DG  GKT  +  + T +F  +YV T+  + + +        + L      
Sbjct: 1   MQTIKCVVVDDGAVGKTCLLISYTTNKFPSEYVPTV-FDNYAVTVMIGGEPYTLGLFDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDI 460
            +     L   +  + +V  V F V S  +++NV   W  ++   C+  P +L G ++D+
Sbjct: 60  GQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDL 119

Query: 461 KDRKVKAKTIVFHRKK 508
           +D     + +  +++K
Sbjct: 120 RDENSTLEKLAKNKQK 135


>D84315-1|BAA21708.1|  214|Drosophila melanogaster rab11 protein.
          Length = 214

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE        +       +  T   +
Sbjct: 12  FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQE 71

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   +  T   ++  V +++ +D+   +TY+NV  W R+L     + I I+L GNK D++
Sbjct: 72  RYRAI--TSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLR 129


>BT024998-1|ABE01228.1|  214|Drosophila melanogaster IP08727p
           protein.
          Length = 214

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 33/122 (27%), Positives = 65/122 (53%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL-VFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +K+V T+G++     V    R   + +  T  D+
Sbjct: 8   FKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDE 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKVDIKD 466
           R   +L +       +L +++D+TS  +++N+  W +++ R+  E + ++L GNK D  D
Sbjct: 68  RFKSLLPSYYRGAHGIL-LVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLD 126

Query: 467 RK 472
            +
Sbjct: 127 NR 128



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 18/55 (32%), Positives = 24/55 (43%)
 Frame = +1

Query: 157 LCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           L  +  D R  EK  C  G      ++    R +   +WDTAG E+F  L   YY
Sbjct: 23  LLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDERFKSLLPSYY 77


>BT023110-1|AAY55526.1|  410|Drosophila melanogaster IP08719p
           protein.
          Length = 410

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 41/143 (28%), Positives = 73/143 (51%), Gaps = 7/143 (4%)
 Frame = +2

Query: 71  NSHKTTKMADDMPTF-KCVLVGDGGTGKTTFVKRHLTGEFEKKY-VATLGVEVHPLVFHT 244
           +S K  +  D+     K +++GD G GKT+ + R   G +   Y ++T+G++    V   
Sbjct: 198 SSSKAPEEEDEFDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVV 257

Query: 245 NRGQFVL-MCGTQPDKRSLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRVC 418
           +  +  L +  T   +R   V  T   ++D + L +++DVT++ TY N+  W  ++    
Sbjct: 258 DGTRVKLQIWDTAGQERFRSV--THAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYA 315

Query: 419 -EGIPIVLCGNKVDI--KDRKVK 478
            E + IVL GNK D    +R+VK
Sbjct: 316 QEDVVIVLIGNKADCSGSERQVK 338



 Score = 31.9 bits (69), Expect = 0.99
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYY 321
           ++  +WDTAGQE+F  +   YY
Sbjct: 262 VKLQIWDTAGQERFRSVTHAYY 283


>BT023070-1|AAY55486.1|  433|Drosophila melanogaster IP08619p
           protein.
          Length = 433

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 41/143 (28%), Positives = 73/143 (51%), Gaps = 7/143 (4%)
 Frame = +2

Query: 71  NSHKTTKMADDMPTF-KCVLVGDGGTGKTTFVKRHLTGEFEKKY-VATLGVEVHPLVFHT 244
           +S K  +  D+     K +++GD G GKT+ + R   G +   Y ++T+G++    V   
Sbjct: 221 SSSKAPEEEDEFDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVV 280

Query: 245 NRGQFVL-MCGTQPDKRSLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRVC 418
           +  +  L +  T   +R   V  T   ++D + L +++DVT++ TY N+  W  ++    
Sbjct: 281 DGTRVKLQIWDTAGQERFRSV--THAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYA 338

Query: 419 -EGIPIVLCGNKVDI--KDRKVK 478
            E + IVL GNK D    +R+VK
Sbjct: 339 QEDVVIVLIGNKADCSGSERQVK 361



 Score = 31.9 bits (69), Expect = 0.99
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYY 321
           ++  +WDTAGQE+F  +   YY
Sbjct: 285 VKLQIWDTAGQERFRSVTHAYY 306


>BT003196-1|AAO24951.1|  222|Drosophila melanogaster RE56408p
           protein.
          Length = 222

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 6/121 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           +K +++G  GTGKT+F+KR++   F + Y AT+GV+    V   +    V +       +
Sbjct: 20  YKILVIGGLGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQ 79

Query: 293 SLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL---VRVCEG--IPIVLCGNKV 454
                 T   +K+ V   ++FDVT   T+  V  W  DL   V++ +G  IP +L  NK 
Sbjct: 80  ERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKC 139

Query: 455 D 457
           D
Sbjct: 140 D 140


>AY752532-1|AAW31988.1|  174|Drosophila melanogaster CG2532 protein.
          Length = 174

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 33/122 (27%), Positives = 65/122 (53%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL-VFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +K+V T+G++     V    R   + +  T  D+
Sbjct: 8   FKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDE 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKVDIKD 466
           R   +L +       +L +++D+TS  +++N+  W +++ R+  E + ++L GNK D  D
Sbjct: 68  RFKSLLPSYYRGAHGIL-LVYDITSSKSFRNIDGWLKEIRRMSSENVNVMLVGNKCDDLD 126

Query: 467 RK 472
            +
Sbjct: 127 NR 128



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 18/55 (32%), Positives = 24/55 (43%)
 Frame = +1

Query: 157 LCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           L  +  D R  EK  C  G      ++    R +   +WDTAG E+F  L   YY
Sbjct: 23  LLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDERFKSLLPSYY 77


>AY752531-1|AAW31987.1|  174|Drosophila melanogaster CG2532 protein.
          Length = 174

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 33/122 (27%), Positives = 65/122 (53%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL-VFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +K+V T+G++     V    R   + +  T  D+
Sbjct: 8   FKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDE 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKVDIKD 466
           R   +L +       +L +++D+TS  +++N+  W +++ R+  E + ++L GNK D  D
Sbjct: 68  RFKSLLPSYYRGAHGIL-LVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLD 126

Query: 467 RK 472
            +
Sbjct: 127 NR 128



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 18/55 (32%), Positives = 24/55 (43%)
 Frame = +1

Query: 157 LCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           L  +  D R  EK  C  G      ++    R +   +WDTAG E+F  L   YY
Sbjct: 23  LLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDERFKSLLPSYY 77


>AY752530-1|AAW31986.1|  174|Drosophila melanogaster CG2532 protein.
          Length = 174

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 33/122 (27%), Positives = 65/122 (53%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL-VFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +K+V T+G++     V    R   + +  T  D+
Sbjct: 8   FKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDE 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKVDIKD 466
           R   +L +       +L +++D+TS  +++N+  W +++ R+  E + ++L GNK D  D
Sbjct: 68  RFKSLLPSYYRGAHGIL-LVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLD 126

Query: 467 RK 472
            +
Sbjct: 127 NR 128



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 18/55 (32%), Positives = 24/55 (43%)
 Frame = +1

Query: 157 LCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           L  +  D R  EK  C  G      ++    R +   +WDTAG E+F  L   YY
Sbjct: 23  LLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDERFKSLLPSYY 77


>AY752529-1|AAW31985.1|  174|Drosophila melanogaster CG2532 protein.
          Length = 174

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 33/122 (27%), Positives = 65/122 (53%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL-VFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +K+V T+G++     V    R   + +  T  D+
Sbjct: 8   FKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDE 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKVDIKD 466
           R   +L +       +L +++D+TS  +++N+  W +++ R+  E + ++L GNK D  D
Sbjct: 68  RFKSLLPSYYRGAHGIL-LVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLD 126

Query: 467 RK 472
            +
Sbjct: 127 NR 128



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 18/55 (32%), Positives = 24/55 (43%)
 Frame = +1

Query: 157 LCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           L  +  D R  EK  C  G      ++    R +   +WDTAG E+F  L   YY
Sbjct: 23  LLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDERFKSLLPSYY 77


>AY752528-1|AAW31984.1|  146|Drosophila melanogaster CG2532 protein.
          Length = 146

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 33/122 (27%), Positives = 65/122 (53%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL-VFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +K+V T+G++     V    R   + +  T  D+
Sbjct: 8   FKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDE 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKVDIKD 466
           R   +L +       +L +++D+TS  +++N+  W +++ R+  E + ++L GNK D  D
Sbjct: 68  RFKSLLPSYYRGAHGIL-LVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLD 126

Query: 467 RK 472
            +
Sbjct: 127 NR 128



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 18/55 (32%), Positives = 24/55 (43%)
 Frame = +1

Query: 157 LCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           L  +  D R  EK  C  G      ++    R +   +WDTAG E+F  L   YY
Sbjct: 23  LLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDERFKSLLPSYY 77


>AY752527-1|AAW31983.1|  174|Drosophila melanogaster CG2532 protein.
          Length = 174

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 33/122 (27%), Positives = 65/122 (53%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL-VFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +K+V T+G++     V    R   + +  T  D+
Sbjct: 8   FKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDE 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKVDIKD 466
           R   +L +       +L +++D+TS  +++N+  W +++ R+  E + ++L GNK D  D
Sbjct: 68  RFKSLLPSYYRGAHGIL-LVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLD 126

Query: 467 RK 472
            +
Sbjct: 127 NR 128



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 18/55 (32%), Positives = 24/55 (43%)
 Frame = +1

Query: 157 LCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           L  +  D R  EK  C  G      ++    R +   +WDTAG E+F  L   YY
Sbjct: 23  LLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDERFKSLLPSYY 77


>AY752526-1|AAW31982.1|  174|Drosophila melanogaster CG2532 protein.
          Length = 174

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 33/122 (27%), Positives = 65/122 (53%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL-VFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +K+V T+G++     V    R   + +  T  D+
Sbjct: 8   FKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDE 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKVDIKD 466
           R   +L +       +L +++D+TS  +++N+  W +++ R+  E + ++L GNK D  D
Sbjct: 68  RFKSLLPSYYRGAHGIL-LVYDITSSKSFRNIDGWLKEIRRMSSENVNVMLVGNKCDDLD 126

Query: 467 RK 472
            +
Sbjct: 127 NR 128



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 18/55 (32%), Positives = 24/55 (43%)
 Frame = +1

Query: 157 LCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           L  +  D R  EK  C  G      ++    R +   +WDTAG E+F  L   YY
Sbjct: 23  LLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDERFKSLLPSYY 77


>AY752525-1|AAW31981.1|  174|Drosophila melanogaster CG2532 protein.
          Length = 174

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 33/122 (27%), Positives = 65/122 (53%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL-VFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +K+V T+G++     V    R   + +  T  D+
Sbjct: 8   FKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDE 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKVDIKD 466
           R   +L +       +L +++D+TS  +++N+  W +++ R+  E + ++L GNK D  D
Sbjct: 68  RFKSLLPSYYRGAHGIL-LVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLD 126

Query: 467 RK 472
            +
Sbjct: 127 NR 128



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 18/55 (32%), Positives = 24/55 (43%)
 Frame = +1

Query: 157 LCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           L  +  D R  EK  C  G      ++    R +   +WDTAG E+F  L   YY
Sbjct: 23  LLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDERFKSLLPSYY 77


>AY752524-1|AAW31980.1|  174|Drosophila melanogaster CG2532 protein.
          Length = 174

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 33/122 (27%), Positives = 65/122 (53%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL-VFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +K+V T+G++     V    R   + +  T  D+
Sbjct: 8   FKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDE 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKVDIKD 466
           R   +L +       +L +++D+TS  +++N+  W +++ R+  E + ++L GNK D  D
Sbjct: 68  RFKSLLPSYYRGAHGIL-LVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLD 126

Query: 467 RK 472
            +
Sbjct: 127 NR 128



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 18/55 (32%), Positives = 24/55 (43%)
 Frame = +1

Query: 157 LCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           L  +  D R  EK  C  G      ++    R +   +WDTAG E+F  L   YY
Sbjct: 23  LLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDERFKSLLPSYY 77


>AY752523-1|AAW31979.1|  174|Drosophila melanogaster CG2532 protein.
          Length = 174

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 33/122 (27%), Positives = 65/122 (53%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL-VFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +K+V T+G++     V    R   + +  T  D+
Sbjct: 8   FKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDE 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKVDIKD 466
           R   +L +       +L +++D+TS  +++N+  W +++ R+  E + ++L GNK D  D
Sbjct: 68  RFKSLLPSYYRGAHGIL-LVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLD 126

Query: 467 RK 472
            +
Sbjct: 127 NR 128



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 18/55 (32%), Positives = 24/55 (43%)
 Frame = +1

Query: 157 LCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           L  +  D R  EK  C  G      ++    R +   +WDTAG E+F  L   YY
Sbjct: 23  LLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDERFKSLLPSYY 77


>AY113404-1|AAM29409.1|  214|Drosophila melanogaster RE11886p
           protein.
          Length = 214

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE        +       +  T   +
Sbjct: 12  FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQE 71

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   +  T   ++  V +++ +D+   +TY+NV  W R+L     + I I+L GNK D++
Sbjct: 72  RYRAI--TSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLR 129


>AY070528-1|AAL47999.1|  214|Drosophila melanogaster GM06568p
           protein.
          Length = 214

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE        +       +  T   +
Sbjct: 12  FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQE 71

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   +  T   ++  V +++ +D+   +TY+NV  W R+L     + I I+L GNK D++
Sbjct: 72  RYRAI--TSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLR 129


>AE014298-1531|AAN09277.1|  214|Drosophila melanogaster CG32670-PA
           protein.
          Length = 214

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 33/122 (27%), Positives = 65/122 (53%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL-VFHTNRGQFVLMCGTQPDK 289
           FK +++GD G GK+  + R     F +K+V T+G++     V    R   + +  T  D+
Sbjct: 8   FKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDE 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIVLCGNKVDIKD 466
           R   +L +       +L +++D+TS  +++N+  W +++ R+  E + ++L GNK D  D
Sbjct: 68  RFKSLLPSYYRGAHGIL-LVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLD 126

Query: 467 RK 472
            +
Sbjct: 127 NR 128



 Score = 35.9 bits (79), Expect = 0.061
 Identities = 18/55 (32%), Positives = 24/55 (43%)
 Frame = +1

Query: 157 LCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           L  +  D R  EK  C  G      ++    R +   +WDTAG E+F  L   YY
Sbjct: 23  LLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDERFKSLLPSYY 77


>AE014297-2931|AAN13849.1|  214|Drosophila melanogaster CG5771-PB,
           isoform B protein.
          Length = 214

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE        +       +  T   +
Sbjct: 12  FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQE 71

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   +  T   ++  V +++ +D+   +TY+NV  W R+L     + I I+L GNK D++
Sbjct: 72  RYRAI--TSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLR 129


>AE014297-2930|AAF55850.1|  214|Drosophila melanogaster CG5771-PA,
           isoform A protein.
          Length = 214

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE        +       +  T   +
Sbjct: 12  FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQE 71

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   +  T   ++  V +++ +D+   +TY+NV  W R+L     + I I+L GNK D++
Sbjct: 72  RYRAI--TSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLR 129


>AB035354-1|BAA87880.1|  214|Drosophila melanogaster Drab11 protein.
          Length = 214

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE        +       +  T   +
Sbjct: 12  FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQE 71

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   +  T   ++  V +++ +D+   +TY+NV  W R+L     + I I+L GNK D++
Sbjct: 72  RYRAI--TSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLR 129


>BT001785-1|AAN71540.1|  214|Drosophila melanogaster RH21315p
           protein.
          Length = 214

 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE        +       +  T   +
Sbjct: 12  FKVVLIGDSGVGKSNLLSRFTRNEFNLESNSTIGVEFATRSIEVDGKTIKAQIWDTAGQE 71

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   +  T   ++  V +++ +D+   +TY+NV  W R+L     + I I+L GNK D++
Sbjct: 72  RYRAI--TSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLR 129


>AY071080-1|AAL48702.1|  223|Drosophila melanogaster RE14786p
           protein.
          Length = 223

 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 34/129 (26%), Positives = 57/129 (44%), Gaps = 1/129 (0%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           M D    FK VLVG+ G GKT  V+R   G F     AT+GV+           +  L  
Sbjct: 1   MEDYKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQI 60

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG-IPIVLCGN 448
                +     +        + L +++D++ + T+  +P+W R++       +  +L GN
Sbjct: 61  WDTAGQERFRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGN 120

Query: 449 KVDIKDRKV 475
           K D  DR++
Sbjct: 121 KTDRDDREI 129


>AE014134-1221|AAN10613.1|  223|Drosophila melanogaster CG9100-PC,
           isoform C protein.
          Length = 223

 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 34/129 (26%), Positives = 57/129 (44%), Gaps = 1/129 (0%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           M D    FK VLVG+ G GKT  V+R   G F     AT+GV+           +  L  
Sbjct: 1   MEDYKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQI 60

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG-IPIVLCGN 448
                +     +        + L +++D++ + T+  +P+W R++       +  +L GN
Sbjct: 61  WDTAGQERFRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGN 120

Query: 449 KVDIKDRKV 475
           K D  DR++
Sbjct: 121 KTDRDDREI 129


>AE014134-1220|AAN10612.1|  223|Drosophila melanogaster CG9100-PB,
           isoform B protein.
          Length = 223

 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 34/129 (26%), Positives = 57/129 (44%), Gaps = 1/129 (0%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           M D    FK VLVG+ G GKT  V+R   G F     AT+GV+           +  L  
Sbjct: 1   MEDYKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQI 60

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG-IPIVLCGN 448
                +     +        + L +++D++ + T+  +P+W R++       +  +L GN
Sbjct: 61  WDTAGQERFRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGN 120

Query: 449 KVDIKDRKV 475
           K D  DR++
Sbjct: 121 KTDRDDREI 129


>AE014134-1219|AAF52477.1|  223|Drosophila melanogaster CG9100-PA,
           isoform A protein.
          Length = 223

 Score = 53.2 bits (122), Expect = 4e-07
 Identities = 34/129 (26%), Positives = 57/129 (44%), Gaps = 1/129 (0%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           M D    FK VLVG+ G GKT  V+R   G F     AT+GV+           +  L  
Sbjct: 1   MEDYKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQI 60

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG-IPIVLCGN 448
                +     +        + L +++D++ + T+  +P+W R++       +  +L GN
Sbjct: 61  WDTAGQERFRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGN 120

Query: 449 KVDIKDRKV 475
           K D  DR++
Sbjct: 121 KTDRDDREI 129


>D84347-1|BAA21711.1|  207|Drosophila melanogaster rab8 protein.
          Length = 207

 Score = 52.8 bits (121), Expect = 5e-07
 Identities = 27/125 (21%), Positives = 58/125 (46%), Gaps = 1/125 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GKT  + R     F   +++T+G++        +  +  L       + 
Sbjct: 9   FKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIKDR 469
               + T        + +++D+T   +++N+ NW R++       +  +L GNK ++ D+
Sbjct: 69  RFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDK 128

Query: 470 KVKAK 484
           +  +K
Sbjct: 129 RQVSK 133


>AY069671-1|AAL39816.1|  207|Drosophila melanogaster LD44762p
           protein.
          Length = 207

 Score = 52.8 bits (121), Expect = 5e-07
 Identities = 27/125 (21%), Positives = 58/125 (46%), Gaps = 1/125 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GKT  + R     F   +++T+G++        +  +  L       + 
Sbjct: 9   FKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIKDR 469
               + T        + +++D+T   +++N+ NW R++       +  +L GNK ++ D+
Sbjct: 69  RFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDK 128

Query: 470 KVKAK 484
           +  +K
Sbjct: 129 RQVSK 133


>AY060425-1|AAL25464.1|  204|Drosophila melanogaster LD39986p
           protein.
          Length = 204

 Score = 52.8 bits (121), Expect = 5e-07
 Identities = 28/125 (22%), Positives = 58/125 (46%), Gaps = 1/125 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GKT  + R     F   +++T+G++           +  L       + 
Sbjct: 10  FKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQE 69

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIKDR 469
               + T        + +++D+T+  +++N+  W R++     E +  ++ GNK D+ D+
Sbjct: 70  RFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDK 129

Query: 470 KVKAK 484
           +V  K
Sbjct: 130 RVVNK 134


>AE014298-3000|AAF50924.1|  204|Drosophila melanogaster CG17060-PA
           protein.
          Length = 204

 Score = 52.8 bits (121), Expect = 5e-07
 Identities = 28/125 (22%), Positives = 58/125 (46%), Gaps = 1/125 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GKT  + R     F   +++T+G++           +  L       + 
Sbjct: 10  FKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQE 69

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIKDR 469
               + T        + +++D+T+  +++N+  W R++     E +  ++ GNK D+ D+
Sbjct: 70  RFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDK 129

Query: 470 KVKAK 484
           +V  K
Sbjct: 130 RVVNK 134


>AE014296-3237|AAF49101.1|  207|Drosophila melanogaster CG8287-PA
           protein.
          Length = 207

 Score = 52.8 bits (121), Expect = 5e-07
 Identities = 27/125 (21%), Positives = 58/125 (46%), Gaps = 1/125 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GKT  + R     F   +++T+G++        +  +  L       + 
Sbjct: 9   FKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIKDR 469
               + T        + +++D+T   +++N+ NW R++       +  +L GNK ++ D+
Sbjct: 69  RFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDK 128

Query: 470 KVKAK 484
           +  +K
Sbjct: 129 RQVSK 133


>AB112933-1|BAD07038.1|  207|Drosophila melanogaster Rab8 protein.
          Length = 207

 Score = 52.8 bits (121), Expect = 5e-07
 Identities = 27/125 (21%), Positives = 58/125 (46%), Gaps = 1/125 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GKT  + R     F   +++T+G++        +  +  L       + 
Sbjct: 9   FKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIKDR 469
               + T        + +++D+T   +++N+ NW R++       +  +L GNK ++ D+
Sbjct: 69  RFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDK 128

Query: 470 KVKAK 484
           +  +K
Sbjct: 129 RQVSK 133


>AB006189-1|BAA21744.1|  204|Drosophila melanogaster Rab10 protein.
          Length = 204

 Score = 52.8 bits (121), Expect = 5e-07
 Identities = 28/125 (22%), Positives = 58/125 (46%), Gaps = 1/125 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GKT  + R     F   +++T+G++           +  L       + 
Sbjct: 10  FKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQE 69

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIKDR 469
               + T        + +++D+T+  +++N+  W R++     E +  ++ GNK D+ D+
Sbjct: 70  RFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDK 129

Query: 470 KVKAK 484
           +V  K
Sbjct: 130 RVVNK 134


>M64621-1|AAA28843.1|  220|Drosophila melanogaster rab3 protein.
          Length = 220

 Score = 52.4 bits (120), Expect = 7e-07
 Identities = 30/124 (24%), Positives = 66/124 (53%), Gaps = 3/124 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVH-PLVFHTNRGQFVLMCGTQPDK 289
           FK +++G+   GKT+F+ R+    F   +V+T+G++     VF  ++   + +  T   +
Sbjct: 22  FKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQE 81

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIK 463
           R   +  T   ++  +   +M+DVT+  ++ +V +W   +     +   ++L GNK D++
Sbjct: 82  RYRTI--TTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDME 139

Query: 464 DRKV 475
           D++V
Sbjct: 140 DQRV 143


>AY060449-1|AAL25488.1|  220|Drosophila melanogaster LP05860p
           protein.
          Length = 220

 Score = 52.4 bits (120), Expect = 7e-07
 Identities = 30/124 (24%), Positives = 66/124 (53%), Gaps = 3/124 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVH-PLVFHTNRGQFVLMCGTQPDK 289
           FK +++G+   GKT+F+ R+    F   +V+T+G++     VF  ++   + +  T   +
Sbjct: 22  FKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQE 81

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIK 463
           R   +  T   ++  +   +M+DVT+  ++ +V +W   +     +   ++L GNK D++
Sbjct: 82  RYRTI--TTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDME 139

Query: 464 DRKV 475
           D++V
Sbjct: 140 DQRV 143


>AE013599-1159|AAF58762.1|  220|Drosophila melanogaster CG7576-PA
           protein.
          Length = 220

 Score = 52.4 bits (120), Expect = 7e-07
 Identities = 30/124 (24%), Positives = 66/124 (53%), Gaps = 3/124 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVH-PLVFHTNRGQFVLMCGTQPDK 289
           FK +++G+   GKT+F+ R+    F   +V+T+G++     VF  ++   + +  T   +
Sbjct: 22  FKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQE 81

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIK 463
           R   +  T   ++  +   +M+DVT+  ++ +V +W   +     +   ++L GNK D++
Sbjct: 82  RYRTI--TTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDME 139

Query: 464 DRKV 475
           D++V
Sbjct: 140 DQRV 143


>AB112932-1|BAD07037.1|  220|Drosophila melanogaster Rab3 protein.
          Length = 220

 Score = 52.4 bits (120), Expect = 7e-07
 Identities = 30/124 (24%), Positives = 66/124 (53%), Gaps = 3/124 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVH-PLVFHTNRGQFVLMCGTQPDK 289
           FK +++G+   GKT+F+ R+    F   +V+T+G++     VF  ++   + +  T   +
Sbjct: 22  FKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQE 81

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIK 463
           R   +  T   ++  +   +M+DVT+  ++ +V +W   +     +   ++L GNK D++
Sbjct: 82  RYRTI--TTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDME 139

Query: 464 DRKV 475
           D++V
Sbjct: 140 DQRV 143


>Z35643-1|CAA84710.1|  192|Drosophila melanogaster RacB protein.
          Length = 192

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 3/126 (2%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT-- 277
           M   KCV+VGDG  GKT  +  + T  F  +Y+ T+       V    +   + +  T  
Sbjct: 1   MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG 60

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKV 454
           Q D   L  L      + +V  + F + +  +++NV   W  ++   C  +PI+L G K+
Sbjct: 61  QEDYDRLRPLSYP---QTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKL 117

Query: 455 DIKDRK 472
           D++D K
Sbjct: 118 DLRDDK 123



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           S+++  + + I   +WDTAGQE +  LR   Y Q
Sbjct: 41  SANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQ 74


>L38310-1|AAA67041.1|  192|Drosophila melanogaster Rac2 protein.
          Length = 192

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 3/126 (2%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT-- 277
           M   KCV+VGDG  GKT  +  + T  F  +Y+ T+       V    +   + +  T  
Sbjct: 1   MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG 60

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKV 454
           Q D   L  L      + +V  + F + +  +++NV   W  ++   C  +PI+L G K+
Sbjct: 61  QEDYDRLRPLSYP---QTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKL 117

Query: 455 DIKDRK 472
           D++D K
Sbjct: 118 DLRDDK 123



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           S+++  + + I   +WDTAGQE +  LR   Y Q
Sbjct: 41  SANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQ 74


>D84314-1|BAA21707.1|  208|Drosophila melanogaster rab6 protein.
          Length = 208

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 33/123 (26%), Positives = 63/123 (51%), Gaps = 3/123 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPDK 289
           FK V +G+   GKT+ + R +   F+  Y AT+G++ +   ++  +R   + +  T   +
Sbjct: 13  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 72

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG--IPIVLCGNKVDIK 463
           R   ++ +  I    V  V++D+T+  ++     W  D VR   G  + I+L GNK D+ 
Sbjct: 73  RFRSLIPS-YIRDSTVAVVVYDITNTNSFHQTSKWIDD-VRTERGSDVIIMLVGNKTDLS 130

Query: 464 DRK 472
           D++
Sbjct: 131 DKR 133


>AY118845-1|AAM50705.1|  192|Drosophila melanogaster GM13874p
           protein.
          Length = 192

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 3/126 (2%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT-- 277
           M   KCV+VGDG  GKT  +  + T  F  +Y+ T+       V    +   + +  T  
Sbjct: 1   MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG 60

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKV 454
           Q D   L  L      + +V  + F + +  +++NV   W  ++   C  +PI+L G K+
Sbjct: 61  QEDYDRLRPLSYP---QTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKL 117

Query: 455 DIKDRK 472
           D++D K
Sbjct: 118 DLRDDK 123



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           S+++  + + I   +WDTAGQE +  LR   Y Q
Sbjct: 41  SANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQ 74


>AY060261-1|AAL25300.1|  208|Drosophila melanogaster GH09086p
           protein.
          Length = 208

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 33/123 (26%), Positives = 63/123 (51%), Gaps = 3/123 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPDK 289
           FK V +G+   GKT+ + R +   F+  Y AT+G++ +   ++  +R   + +  T   +
Sbjct: 13  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 72

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG--IPIVLCGNKVDIK 463
           R   ++ +  I    V  V++D+T+  ++     W  D VR   G  + I+L GNK D+ 
Sbjct: 73  RFRSLIPS-YIRDSTVAVVVYDITNTNSFHQTSKWIDD-VRTERGSDVIIMLVGNKTDLS 130

Query: 464 DRK 472
           D++
Sbjct: 131 DKR 133


>AE014296-1260|AAF50559.1|  192|Drosophila melanogaster CG8556-PA
           protein.
          Length = 192

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 3/126 (2%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT-- 277
           M   KCV+VGDG  GKT  +  + T  F  +Y+ T+       V    +   + +  T  
Sbjct: 1   MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG 60

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKV 454
           Q D   L  L      + +V  + F + +  +++NV   W  ++   C  +PI+L G K+
Sbjct: 61  QEDYDRLRPLSYP---QTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKL 117

Query: 455 DIKDRK 472
           D++D K
Sbjct: 118 DLRDDK 123



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           S+++  + + I   +WDTAGQE +  LR   Y Q
Sbjct: 41  SANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQ 74


>AE014134-2164|AAF53168.1|  208|Drosophila melanogaster CG6601-PA
           protein.
          Length = 208

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 33/123 (26%), Positives = 63/123 (51%), Gaps = 3/123 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPDK 289
           FK V +G+   GKT+ + R +   F+  Y AT+G++ +   ++  +R   + +  T   +
Sbjct: 13  FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 72

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG--IPIVLCGNKVDIK 463
           R   ++ +  I    V  V++D+T+  ++     W  D VR   G  + I+L GNK D+ 
Sbjct: 73  RFRSLIPS-YIRDSTVAVVVYDITNTNSFHQTSKWIDD-VRTERGSDVIIMLVGNKTDLS 130

Query: 464 DRK 472
           D++
Sbjct: 131 DKR 133


>Z35642-1|CAA84709.1|  192|Drosophila melanogaster RacA protein.
          Length = 192

 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 3/126 (2%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT-- 277
           M   KCV+VGDG  GKT  +  + T  F  +Y+ T+       V    +   + +  T  
Sbjct: 1   MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG 60

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKV 454
           Q D   L  L      + +V  + F + +  +++NV   W+ ++   C   PI+L G K+
Sbjct: 61  QEDYDRLRPLSYP---QTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKL 117

Query: 455 DIKDRK 472
           D++D K
Sbjct: 118 DLRDDK 123



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           S+++  + + I   +WDTAGQE +  LR   Y Q
Sbjct: 41  SANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQ 74


>U11823-1|AAA62870.1|  192|Drosophila melanogaster Drac1 protein.
          Length = 192

 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 3/126 (2%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT-- 277
           M   KCV+VGDG  GKT  +  + T  F  +Y+ T+       V    +   + +  T  
Sbjct: 1   MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG 60

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKV 454
           Q D   L  L      + +V  + F + +  +++NV   W+ ++   C   PI+L G K+
Sbjct: 61  QEDYDRLRPLSYP---QTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKL 117

Query: 455 DIKDRK 472
           D++D K
Sbjct: 118 DLRDDK 123



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           S+++  + + I   +WDTAGQE +  LR   Y Q
Sbjct: 41  SANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQ 74


>L38309-1|AAA67040.1|  192|Drosophila melanogaster Rac1 protein.
          Length = 192

 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 3/126 (2%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT-- 277
           M   KCV+VGDG  GKT  +  + T  F  +Y+ T+       V    +   + +  T  
Sbjct: 1   MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG 60

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKV 454
           Q D   L  L      + +V  + F + +  +++NV   W+ ++   C   PI+L G K+
Sbjct: 61  QEDYDRLRPLSYP---QTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKL 117

Query: 455 DIKDRK 472
           D++D K
Sbjct: 118 DLRDDK 123



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           S+++  + + I   +WDTAGQE +  LR   Y Q
Sbjct: 41  SANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQ 74


>AY060408-1|AAL25447.1|  192|Drosophila melanogaster LD34217p
           protein.
          Length = 192

 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 3/126 (2%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT-- 277
           M   KCV+VGDG  GKT  +  + T  F  +Y+ T+       V    +   + +  T  
Sbjct: 1   MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG 60

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKV 454
           Q D   L  L      + +V  + F + +  +++NV   W+ ++   C   PI+L G K+
Sbjct: 61  QEDYDRLRPLSYP---QTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKL 117

Query: 455 DIKDRK 472
           D++D K
Sbjct: 118 DLRDDK 123



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           S+++  + + I   +WDTAGQE +  LR   Y Q
Sbjct: 41  SANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQ 74


>AE014296-217|AAF47469.1|  192|Drosophila melanogaster CG2248-PA
           protein.
          Length = 192

 Score = 50.8 bits (116), Expect = 2e-06
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 3/126 (2%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT-- 277
           M   KCV+VGDG  GKT  +  + T  F  +Y+ T+       V    +   + +  T  
Sbjct: 1   MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG 60

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKV 454
           Q D   L  L      + +V  + F + +  +++NV   W+ ++   C   PI+L G K+
Sbjct: 61  QEDYDRLRPLSYP---QTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKL 117

Query: 455 DIKDRK 472
           D++D K
Sbjct: 118 DLRDDK 123



 Score = 30.3 bits (65), Expect = 3.0
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           S+++  + + I   +WDTAGQE +  LR   Y Q
Sbjct: 41  SANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQ 74


>BT003609-1|AAO39612.1|  230|Drosophila melanogaster GH17339p
           protein.
          Length = 230

 Score = 50.0 bits (114), Expect = 4e-06
 Identities = 33/131 (25%), Positives = 67/131 (51%), Gaps = 8/131 (6%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV-HPLVFHTNRGQ----FVLMCGTQ 280
           K +++GD G GKT  + ++  G F  ++++T+G++     + + +RG+     + +  T 
Sbjct: 13  KFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTA 72

Query: 281 PDKRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL--VRVCEGIPIVLCGNK 451
             +R   +  T   ++D +   ++FD+TS  ++    NW   L      E   +VLCGNK
Sbjct: 73  GQERFRSL--TTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNK 130

Query: 452 VDIKDRKVKAK 484
            D+   +V ++
Sbjct: 131 CDLLQLRVVSR 141


>AY060977-1|AAL28525.1|  230|Drosophila melanogaster GM10914p
           protein.
          Length = 230

 Score = 50.0 bits (114), Expect = 4e-06
 Identities = 33/131 (25%), Positives = 67/131 (51%), Gaps = 8/131 (6%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV-HPLVFHTNRGQ----FVLMCGTQ 280
           K +++GD G GKT  + ++  G F  ++++T+G++     + + +RG+     + +  T 
Sbjct: 13  KFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTA 72

Query: 281 PDKRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL--VRVCEGIPIVLCGNK 451
             +R   +  T   ++D +   ++FD+TS  ++    NW   L      E   +VLCGNK
Sbjct: 73  GQERFRSL--TTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNK 130

Query: 452 VDIKDRKVKAK 484
            D+   +V ++
Sbjct: 131 CDLLQLRVVSR 141


>AE014298-220|AAF45634.2|  230|Drosophila melanogaster CG14791-PC,
           isoform C protein.
          Length = 230

 Score = 50.0 bits (114), Expect = 4e-06
 Identities = 33/131 (25%), Positives = 67/131 (51%), Gaps = 8/131 (6%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV-HPLVFHTNRGQ----FVLMCGTQ 280
           K +++GD G GKT  + ++  G F  ++++T+G++     + + +RG+     + +  T 
Sbjct: 13  KFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTA 72

Query: 281 PDKRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL--VRVCEGIPIVLCGNK 451
             +R   +  T   ++D +   ++FD+TS  ++    NW   L      E   +VLCGNK
Sbjct: 73  GQERFRSL--TTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNK 130

Query: 452 VDIKDRKVKAK 484
            D+   +V ++
Sbjct: 131 CDLLQLRVVSR 141


>AB112931-1|BAD07036.1|  230|Drosophila melanogaster Rab27 protein.
          Length = 230

 Score = 50.0 bits (114), Expect = 4e-06
 Identities = 33/131 (25%), Positives = 67/131 (51%), Gaps = 8/131 (6%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV-HPLVFHTNRGQ----FVLMCGTQ 280
           K +++GD G GKT  + ++  G F  ++++T+G++     + + +RG+     + +  T 
Sbjct: 13  KFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTA 72

Query: 281 PDKRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL--VRVCEGIPIVLCGNK 451
             +R   +  T   ++D +   ++FD+TS  ++    NW   L      E   +VLCGNK
Sbjct: 73  GQERFRSL--TTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNK 130

Query: 452 VDIKDRKVKAK 484
            D+   +V ++
Sbjct: 131 CDLLQLRVVSR 141


>AY113279-1|AAM29284.1|  195|Drosophila melanogaster AT17867p
           protein.
          Length = 195

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 31/118 (26%), Positives = 57/118 (48%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           KCV+VGDG  GKT  +  + T  F  +YV T+  + +      +  Q  L       +  
Sbjct: 8   KCVVVGDGTVGKTCMLISYTTDCFPGEYVPTV-FDNYSAPMQVDTIQVSLGLWDTAGQED 66

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +  + +V  + + V S  +++NV + W+ ++   C   PI+L G K+D+++
Sbjct: 67  YDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLRE 124


>AY060236-1|AAL25275.1|  207|Drosophila melanogaster GH03685p
           protein.
          Length = 207

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD   GKT+ + +++   F  +Y AT+G +        N     +       +  
Sbjct: 10  KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-----RVCEGIPIVLCGNKVDI 460
              L        +   +++DVT+  ++KN+ +W  + +     R  +  P V+ GNKVD+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129

Query: 461 KDRKVKAK 484
            +R+V  +
Sbjct: 130 DNRQVSTR 137



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 11/189 (5%)
 Frame = +1

Query: 148 QNNLCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           + +L  +  + R   + +   G    +  +    R +   +WDTAGQE+F  L   +Y  
Sbjct: 21  KTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGVAFYRG 80

Query: 328 GQCAI-------SHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCLV-RKQSGY*RQKS--* 477
             C +        +  +NL S+  +    A    P    +P+ ++  K     RQ S   
Sbjct: 81  ADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPD--HFPFVVLGNKVDLDNRQVSTRR 138

Query: 478 GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVA-MPALLPPEVTMGS 654
            + +C   + D+ YY+ SAK   N E  F  +A+  +    LE  A +    P ++T+GS
Sbjct: 139 AQQWC-QSKNDIPYYETSAKEGINVEMAFQVIAKNAL---ELEAEAEVINDFPDQITLGS 194

Query: 655 SMAEPN*KD 681
               P   D
Sbjct: 195 QNNRPGNPD 203


>AM294833-1|CAL26819.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD   GKT+ + +++   F  +Y AT+G +        N     +       +  
Sbjct: 10  KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-----RVCEGIPIVLCGNKVDI 460
              L        +   +++DVT+  ++KN+ +W  + +     R  +  P V+ GNKVD+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129

Query: 461 KDRKVKAK 484
            +R+V  +
Sbjct: 130 DNRQVSTR 137



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 11/189 (5%)
 Frame = +1

Query: 148 QNNLCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           + +L  +  + R   + +   G    +  +    R +   +WDTAGQE+F  L   +Y  
Sbjct: 21  KTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGVAFYRG 80

Query: 328 GQCAI-------SHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCLV-RKQSGY*RQKS--* 477
             C +        +  +NL S+  +    A    P    +P+ ++  K     RQ S   
Sbjct: 81  ADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPD--HFPFVVLGNKVDLDNRQVSTRR 138

Query: 478 GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVA-MPALLPPEVTMGS 654
            + +C   + D+ YY+ SAK   N E  F  +A+  +    LE  A +    P ++T+GS
Sbjct: 139 AQQWC-QSKNDIPYYETSAKEGINVEMAFQVIAKNAL---ELEAEAEVINDFPDQITLGS 194

Query: 655 SMAEPN*KD 681
               P   D
Sbjct: 195 QNNRPGNPD 203


>AM294832-1|CAL26818.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD   GKT+ + +++   F  +Y AT+G +        N     +       +  
Sbjct: 10  KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-----RVCEGIPIVLCGNKVDI 460
              L        +   +++DVT+  ++KN+ +W  + +     R  +  P V+ GNKVD+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129

Query: 461 KDRKVKAK 484
            +R+V  +
Sbjct: 130 DNRQVSTR 137



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 11/189 (5%)
 Frame = +1

Query: 148 QNNLCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           + +L  +  + R   + +   G    +  +    R +   +WDTAGQE+F  L   +Y  
Sbjct: 21  KTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGVAFYRG 80

Query: 328 GQCAI-------SHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCLV-RKQSGY*RQKS--* 477
             C +        +  +NL S+  +    A    P    +P+ ++  K     RQ S   
Sbjct: 81  ADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPD--HFPFVVLGNKVDLDNRQVSTRR 138

Query: 478 GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVA-MPALLPPEVTMGS 654
            + +C   + D+ YY+ SAK   N E  F  +A+  +    LE  A +    P ++T+GS
Sbjct: 139 AQQWC-QSKNDIPYYETSAKEGINVEMAFQVIAKNAL---ELEAEAEVINDFPDQITLGS 194

Query: 655 SMAEPN*KD 681
               P   D
Sbjct: 195 QNNRPGNPD 203


>AM294831-1|CAL26817.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD   GKT+ + +++   F  +Y AT+G +        N     +       +  
Sbjct: 10  KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-----RVCEGIPIVLCGNKVDI 460
              L        +   +++DVT+  ++KN+ +W  + +     R  +  P V+ GNKVD+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129

Query: 461 KDRKVKAK 484
            +R+V  +
Sbjct: 130 DNRQVSTR 137



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 11/189 (5%)
 Frame = +1

Query: 148 QNNLCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           + +L  +  + R   + +   G    +  +    R +   +WDTAGQE+F  L   +Y  
Sbjct: 21  KTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGVAFYRG 80

Query: 328 GQCAI-------SHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCLV-RKQSGY*RQKS--* 477
             C +        +  +NL S+  +    A    P    +P+ ++  K     RQ S   
Sbjct: 81  ADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPD--HFPFVVLGNKVDLDNRQVSTRR 138

Query: 478 GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVA-MPALLPPEVTMGS 654
            + +C   + D+ YY+ SAK   N E  F  +A+  +    LE  A +    P ++T+GS
Sbjct: 139 AQQWC-QSKNDIPYYETSAKEGINVEMAFQVIAKNAL---ELEAEAEVINDFPDQITLGS 194

Query: 655 SMAEPN*KD 681
               P   D
Sbjct: 195 QNNRPGNPD 203


>AM294830-1|CAL26816.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD   GKT+ + +++   F  +Y AT+G +        N     +       +  
Sbjct: 10  KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-----RVCEGIPIVLCGNKVDI 460
              L        +   +++DVT+  ++KN+ +W  + +     R  +  P V+ GNKVD+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129

Query: 461 KDRKVKAK 484
            +R+V  +
Sbjct: 130 DNRQVSTR 137



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 11/189 (5%)
 Frame = +1

Query: 148 QNNLCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           + +L  +  + R   + +   G    +  +    R +   +WDTAGQE+F  L   +Y  
Sbjct: 21  KTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGVAFYRG 80

Query: 328 GQCAI-------SHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCLV-RKQSGY*RQKS--* 477
             C +        +  +NL S+  +    A    P    +P+ ++  K     RQ S   
Sbjct: 81  ADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPD--HFPFVVLGNKVDLDNRQVSTRR 138

Query: 478 GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVA-MPALLPPEVTMGS 654
            + +C   + D+ YY+ SAK   N E  F  +A+  +    LE  A +    P ++T+GS
Sbjct: 139 AQQWC-QSKNDIPYYETSAKEGINVEMAFQVIAKNAL---ELEAEAEVINDFPDQITLGS 194

Query: 655 SMAEPN*KD 681
               P   D
Sbjct: 195 QNNRPGNPD 203


>AM294829-1|CAL26815.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD   GKT+ + +++   F  +Y AT+G +        N     +       +  
Sbjct: 10  KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-----RVCEGIPIVLCGNKVDI 460
              L        +   +++DVT+  ++KN+ +W  + +     R  +  P V+ GNKVD+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129

Query: 461 KDRKVKAK 484
            +R+V  +
Sbjct: 130 DNRQVSTR 137



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 11/189 (5%)
 Frame = +1

Query: 148 QNNLCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           + +L  +  + R   + +   G    +  +    R +   +WDTAGQE+F  L   +Y  
Sbjct: 21  KTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGVAFYRG 80

Query: 328 GQCAI-------SHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCLV-RKQSGY*RQKS--* 477
             C +        +  +NL S+  +    A    P    +P+ ++  K     RQ S   
Sbjct: 81  ADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPD--HFPFVVLGNKVDLDNRQVSTRR 138

Query: 478 GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVA-MPALLPPEVTMGS 654
            + +C   + D+ YY+ SAK   N E  F  +A+  +    LE  A +    P ++T+GS
Sbjct: 139 AQQWC-QSKNDIPYYETSAKEGINVEMAFQVIAKNAL---ELEAEAEVINDFPDQITLGS 194

Query: 655 SMAEPN*KD 681
               P   D
Sbjct: 195 QNNRPGNPD 203


>AM294828-1|CAL26814.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD   GKT+ + +++   F  +Y AT+G +        N     +       +  
Sbjct: 10  KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-----RVCEGIPIVLCGNKVDI 460
              L        +   +++DVT+  ++KN+ +W  + +     R  +  P V+ GNKVD+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129

Query: 461 KDRKVKAK 484
            +R+V  +
Sbjct: 130 DNRQVSTR 137



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 11/189 (5%)
 Frame = +1

Query: 148 QNNLCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           + +L  +  + R   + +   G    +  +    R +   +WDTAGQE+F  L   +Y  
Sbjct: 21  KTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGVAFYRG 80

Query: 328 GQCAI-------SHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCLV-RKQSGY*RQKS--* 477
             C +        +  +NL S+  +    A    P    +P+ ++  K     RQ S   
Sbjct: 81  ADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPD--HFPFVVLGNKVDLDNRQVSTRR 138

Query: 478 GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVA-MPALLPPEVTMGS 654
            + +C   + D+ YY+ SAK   N E  F  +A+  +    LE  A +    P ++T+GS
Sbjct: 139 AQQWC-QSKNDIPYYETSAKEGINVEMAFQVIAKNAL---ELEAEAEVINDFPDQITLGS 194

Query: 655 SMAEPN*KD 681
               P   D
Sbjct: 195 QNNRPGNPD 203


>AM294827-1|CAL26813.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD   GKT+ + +++   F  +Y AT+G +        N     +       +  
Sbjct: 10  KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-----RVCEGIPIVLCGNKVDI 460
              L        +   +++DVT+  ++KN+ +W  + +     R  +  P V+ GNKVD+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129

Query: 461 KDRKVKAK 484
            +R+V  +
Sbjct: 130 DNRQVSTR 137



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 11/189 (5%)
 Frame = +1

Query: 148 QNNLCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           + +L  +  + R   + +   G    +  +    R +   +WDTAGQE+F  L   +Y  
Sbjct: 21  KTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGVAFYRG 80

Query: 328 GQCAI-------SHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCLV-RKQSGY*RQKS--* 477
             C +        +  +NL S+  +    A    P    +P+ ++  K     RQ S   
Sbjct: 81  ADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPD--HFPFVVLGNKVDLDNRQVSTRR 138

Query: 478 GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVA-MPALLPPEVTMGS 654
            + +C   + D+ YY+ SAK   N E  F  +A+  +    LE  A +    P ++T+GS
Sbjct: 139 AQQWC-QSKNDIPYYETSAKEGINVEMAFQVIAKNAL---ELEAEAEVINDFPDQITLGS 194

Query: 655 SMAEPN*KD 681
               P   D
Sbjct: 195 QNNRPGNPD 203


>AM294826-1|CAL26812.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD   GKT+ + +++   F  +Y AT+G +        N     +       +  
Sbjct: 10  KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-----RVCEGIPIVLCGNKVDI 460
              L        +   +++DVT+  ++KN+ +W  + +     R  +  P V+ GNKVD+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129

Query: 461 KDRKVKAK 484
            +R+V  +
Sbjct: 130 DNRQVSTR 137



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 11/189 (5%)
 Frame = +1

Query: 148 QNNLCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           + +L  +  + R   + +   G    +  +    R +   +WDTAGQE+F  L   +Y  
Sbjct: 21  KTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGVAFYRG 80

Query: 328 GQCAI-------SHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCLV-RKQSGY*RQKS--* 477
             C +        +  +NL S+  +    A    P    +P+ ++  K     RQ S   
Sbjct: 81  ADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPD--HFPFVVLGNKVDLDNRQVSTRR 138

Query: 478 GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVA-MPALLPPEVTMGS 654
            + +C   + D+ YY+ SAK   N E  F  +A+  +    LE  A +    P ++T+GS
Sbjct: 139 AQQWC-QSKNDIPYYETSAKEGINVEMAFQVIAKNAL---ELEAEAEVINDFPDQITLGS 194

Query: 655 SMAEPN*KD 681
               P   D
Sbjct: 195 QNNRPGNPD 203


>AM294825-1|CAL26811.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD   GKT+ + +++   F  +Y AT+G +        N     +       +  
Sbjct: 10  KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-----RVCEGIPIVLCGNKVDI 460
              L        +   +++DVT+  ++KN+ +W  + +     R  +  P V+ GNKVD+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129

Query: 461 KDRKVKAK 484
            +R+V  +
Sbjct: 130 DNRQVSTR 137



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 11/189 (5%)
 Frame = +1

Query: 148 QNNLCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           + +L  +  + R   + +   G    +  +    R +   +WDTAGQE+F  L   +Y  
Sbjct: 21  KTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGVAFYRG 80

Query: 328 GQCAI-------SHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCLV-RKQSGY*RQKS--* 477
             C +        +  +NL S+  +    A    P    +P+ ++  K     RQ S   
Sbjct: 81  ADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPD--HFPFVVLGNKVDLDNRQVSTRR 138

Query: 478 GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVA-MPALLPPEVTMGS 654
            + +C   + D+ YY+ SAK   N E  F  +A+  +    LE  A +    P ++T+GS
Sbjct: 139 AQQWC-QSKNDIPYYETSAKEGINVEMAFQVIAKNAL---ELEAEAEVINDFPDQITLGS 194

Query: 655 SMAEPN*KD 681
               P   D
Sbjct: 195 QNNRPGNPD 203


>AM294824-1|CAL26810.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD   GKT+ + +++   F  +Y AT+G +        N     +       +  
Sbjct: 10  KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-----RVCEGIPIVLCGNKVDI 460
              L        +   +++DVT+  ++KN+ +W  + +     R  +  P V+ GNKVD+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129

Query: 461 KDRKVKAK 484
            +R+V  +
Sbjct: 130 DNRQVSTR 137



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 11/189 (5%)
 Frame = +1

Query: 148 QNNLCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           + +L  +  + R   + +   G    +  +    R +   +WDTAGQE+F  L   +Y  
Sbjct: 21  KTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGVAFYRG 80

Query: 328 GQCAI-------SHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCLV-RKQSGY*RQKS--* 477
             C +        +  +NL S+  +    A    P    +P+ ++  K     RQ S   
Sbjct: 81  ADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPD--HFPFVVLGNKVDLDNRQVSTRR 138

Query: 478 GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVA-MPALLPPEVTMGS 654
            + +C   + D+ YY+ SAK   N E  F  +A+  +    LE  A +    P ++T+GS
Sbjct: 139 AQQWC-QSKNDIPYYETSAKEGINVEMAFQVIAKNAL---ELEAEAEVINDFPDQITLGS 194

Query: 655 SMAEPN*KD 681
               P   D
Sbjct: 195 QNNRPGNPD 203


>AM294823-1|CAL26809.1|  207|Drosophila melanogaster CG5915 protein.
          Length = 207

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD   GKT+ + +++   F  +Y AT+G +        N     +       +  
Sbjct: 10  KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-----RVCEGIPIVLCGNKVDI 460
              L        +   +++DVT+  ++KN+ +W  + +     R  +  P V+ GNKVD+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129

Query: 461 KDRKVKAK 484
            +R+V  +
Sbjct: 130 DNRQVSTR 137



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 11/189 (5%)
 Frame = +1

Query: 148 QNNLCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           + +L  +  + R   + +   G    +  +    R +   +WDTAGQE+F  L   +Y  
Sbjct: 21  KTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGVAFYRG 80

Query: 328 GQCAI-------SHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCLV-RKQSGY*RQKS--* 477
             C +        +  +NL S+  +    A    P    +P+ ++  K     RQ S   
Sbjct: 81  ADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPD--HFPFVVLGNKVDLDNRQVSTRR 138

Query: 478 GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVA-MPALLPPEVTMGS 654
            + +C   + D+ YY+ SAK   N E  F  +A+  +    LE  A +    P ++T+GS
Sbjct: 139 AQQWC-QSKNDIPYYETSAKEGINVEMAFQVIAKNAL---ELEAEAEVINDFPDQITLGS 194

Query: 655 SMAEPN*KD 681
               P   D
Sbjct: 195 QNNRPGNPD 203


>AJ413188-1|CAC88352.1|  195|Drosophila melanogaster small GTPase
           protein.
          Length = 195

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 31/118 (26%), Positives = 57/118 (48%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           KCV+VGDG  GKT  +  + T  F  +YV T+  + +      +  Q  L       +  
Sbjct: 8   KCVVVGDGTVGKTCMLISYTTDCFPGEYVPTV-FDNYSAPMQVDTIQVSLGLWDTAGQED 66

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +  + +V  + + V S  +++NV + W+ ++   C   PI+L G K+D+++
Sbjct: 67  YDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLRE 124


>AF263363-1|AAF73041.1|  207|Drosophila melanogaster small ras-like
           GTPase RAB7 protein.
          Length = 207

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD   GKT+ + +++   F  +Y AT+G +        N     +       +  
Sbjct: 10  KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-----RVCEGIPIVLCGNKVDI 460
              L        +   +++DVT+  ++KN+ +W  + +     R  +  P V+ GNKVD+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129

Query: 461 KDRKVKAK 484
            +R+V  +
Sbjct: 130 DNRQVSTR 137



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 11/189 (5%)
 Frame = +1

Query: 148 QNNLCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           + +L  +  + R   + +   G    +  +    R +   +WDTAGQE+F  L   +Y  
Sbjct: 21  KTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGVAFYRG 80

Query: 328 GQCAI-------SHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCLV-RKQSGY*RQKS--* 477
             C +        +  +NL S+  +    A    P    +P+ ++  K     RQ S   
Sbjct: 81  ADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPD--HFPFVVLGNKVDLDNRQVSTRR 138

Query: 478 GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVA-MPALLPPEVTMGS 654
            + +C   + D+ YY+ SAK   N E  F  +A+  +    LE  A +    P ++T+GS
Sbjct: 139 AQQWC-QSKNDIPYYETSAKEGINVEMAFQVIAKNAL---ELEAEAEVINDFPDQITLGS 194

Query: 655 SMAEPN*KD 681
               P   D
Sbjct: 195 QNNRPGNPD 203


>AF238044-1|AAF44665.1|  195|Drosophila melanogaster Mig-2-like
           GTPase Mtl protein.
          Length = 195

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 31/118 (26%), Positives = 57/118 (48%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           KCV+VGDG  GKT  +  + T  F  +YV T+  + +      +  Q  L       +  
Sbjct: 8   KCVVVGDGTVGKTCMLISYTTDCFPGEYVPTV-FDNYSAPMQVDTIQVSLGLWDTAGQED 66

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +  + +V  + + V S  +++NV + W+ ++   C   PI+L G K+D+++
Sbjct: 67  YDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLRE 124


>AF079459-1|AAC32270.1|  207|Drosophila melanogaster small ras-like
           GTPase protein.
          Length = 207

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD   GKT+ + +++   F  +Y AT+G +        N     +       +  
Sbjct: 10  KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-----RVCEGIPIVLCGNKVDI 460
              L        +   +++DVT+  ++KN+ +W  + +     R  +  P V+ GNKVD+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129

Query: 461 KDRKVKAK 484
            +R+V  +
Sbjct: 130 DNRQVSTR 137



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 11/189 (5%)
 Frame = +1

Query: 148 QNNLCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           + +L  +  + R   + +   G    +  +    R +   +WDTAGQE+F  L   +Y  
Sbjct: 21  KTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGVAFYRG 80

Query: 328 GQCAI-------SHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCLV-RKQSGY*RQKS--* 477
             C +        +  +NL S+  +    A    P    +P+ ++  K     RQ S   
Sbjct: 81  ADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPD--HFPFVVLGNKVDLDNRQVSTRR 138

Query: 478 GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVA-MPALLPPEVTMGS 654
            + +C   + D+ YY+ SAK   N E  F  +A+  +    LE  A +    P ++T+GS
Sbjct: 139 AQQWC-QSKNDIPYYETSAKEGINVEMAFQVIAKNAL---ELEAEAEVINDFPDQITLGS 194

Query: 655 SMAEPN*KD 681
               P   D
Sbjct: 195 QNNRPGNPD 203


>AE014297-4152|AAN14120.1|  195|Drosophila melanogaster CG5588-PC,
           isoform C protein.
          Length = 195

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 31/118 (26%), Positives = 57/118 (48%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           KCV+VGDG  GKT  +  + T  F  +YV T+  + +      +  Q  L       +  
Sbjct: 8   KCVVVGDGTVGKTCMLISYTTDCFPGEYVPTV-FDNYSAPMQVDTIQVSLGLWDTAGQED 66

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +  + +V  + + V S  +++NV + W+ ++   C   PI+L G K+D+++
Sbjct: 67  YDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLRE 124


>AE014297-4151|AAF56727.1|  195|Drosophila melanogaster CG5588-PB,
           isoform B protein.
          Length = 195

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 31/118 (26%), Positives = 57/118 (48%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           KCV+VGDG  GKT  +  + T  F  +YV T+  + +      +  Q  L       +  
Sbjct: 8   KCVVVGDGTVGKTCMLISYTTDCFPGEYVPTV-FDNYSAPMQVDTIQVSLGLWDTAGQED 66

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +  + +V  + + V S  +++NV + W+ ++   C   PI+L G K+D+++
Sbjct: 67  YDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLRE 124


>AE014297-4150|AAF56728.1|  195|Drosophila melanogaster CG5588-PA,
           isoform A protein.
          Length = 195

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 31/118 (26%), Positives = 57/118 (48%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           KCV+VGDG  GKT  +  + T  F  +YV T+  + +      +  Q  L       +  
Sbjct: 8   KCVVVGDGTVGKTCMLISYTTDCFPGEYVPTV-FDNYSAPMQVDTIQVSLGLWDTAGQED 66

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +  + +V  + + V S  +++NV + W+ ++   C   PI+L G K+D+++
Sbjct: 67  YDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLRE 124


>AE014297-3431|AAF56218.1|  207|Drosophila melanogaster CG5915-PA
           protein.
          Length = 207

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD   GKT+ + +++   F  +Y AT+G +        N     +       +  
Sbjct: 10  KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-----RVCEGIPIVLCGNKVDI 460
              L        +   +++DVT+  ++KN+ +W  + +     R  +  P V+ GNKVD+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129

Query: 461 KDRKVKAK 484
            +R+V  +
Sbjct: 130 DNRQVSTR 137



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 11/189 (5%)
 Frame = +1

Query: 148 QNNLCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           + +L  +  + R   + +   G    +  +    R +   +WDTAGQE+F  L   +Y  
Sbjct: 21  KTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGVAFYRG 80

Query: 328 GQCAI-------SHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCLV-RKQSGY*RQKS--* 477
             C +        +  +NL S+  +    A    P    +P+ ++  K     RQ S   
Sbjct: 81  ADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPD--HFPFVVLGNKVDLDNRQVSTRR 138

Query: 478 GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVA-MPALLPPEVTMGS 654
            + +C   + D+ YY+ SAK   N E  F  +A+  +    LE  A +    P ++T+GS
Sbjct: 139 AQQWC-QSKNDIPYYETSAKEGINVEMAFQVIAKNAL---ELEAEAEVINDFPDQITLGS 194

Query: 655 SMAEPN*KD 681
               P   D
Sbjct: 195 QNNRPGNPD 203


>AB035672-1|BAA88245.1|  207|Drosophila melanogaster Rab7 protein
           protein.
          Length = 207

 Score = 49.6 bits (113), Expect = 5e-06
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD   GKT+ + +++   F  +Y AT+G +        N     +       +  
Sbjct: 10  KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-----RVCEGIPIVLCGNKVDI 460
              L        +   +++DVT+  ++KN+ +W  + +     R  +  P V+ GNKVD+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129

Query: 461 KDRKVKAK 484
            +R+V  +
Sbjct: 130 DNRQVSTR 137



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 45/189 (23%), Positives = 78/189 (41%), Gaps = 11/189 (5%)
 Frame = +1

Query: 148 QNNLCQKTFDWRVREKIRCDSGCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQ 327
           + +L  +  + R   + +   G    +  +    R +   +WDTAGQE+F  L   +Y  
Sbjct: 21  KTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGVAFYRG 80

Query: 328 GQCAI-------SHVRRNLSSYVQKCT*LA*RFGPCM*RYPYCLV-RKQSGY*RQKS--* 477
             C +        +  +NL S+  +    A    P    +P+ ++  K     RQ S   
Sbjct: 81  ADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPD--HFPFVVLGNKVDLDNRQVSTRR 138

Query: 478 GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVA-MPALLPPEVTMGS 654
            + +C   + D+ YY+ SAK   N E  F  +A+  +    LE  A +    P ++T+GS
Sbjct: 139 AQQWC-QSKNDIPYYETSAKEGINVEMAFQVIAKNAL---ELEAEAEVINDFPDQITLGS 194

Query: 655 SMAEPN*KD 681
               P   D
Sbjct: 195 QNNRPGNPD 203


>AY119634-1|AAM50288.1|  222|Drosophila melanogaster RE42508p
           protein.
          Length = 222

 Score = 49.2 bits (112), Expect = 6e-06
 Identities = 33/124 (26%), Positives = 64/124 (51%), Gaps = 4/124 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV--HPLVFHTNRGQFVLMCGTQPD 286
           FK VL+G+G  GKT+ V R++   F  ++++TL        +     R   + +  T   
Sbjct: 14  FKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQ 73

Query: 287 KRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG--IPIVLCGNKVDI 460
           +R   +        D  L +++D+T R +++ V +W R+L R   G  I +++ GNK D+
Sbjct: 74  ERFHALGPIYYRGSDGAL-LVYDITDRDSFQKVKSWVREL-RQMRGTEIALIIVGNKTDL 131

Query: 461 KDRK 472
           ++++
Sbjct: 132 EEQR 135


>AE014298-3235|EAA46055.2|  273|Drosophila melanogaster CG17515-PB,
           isoform B protein.
          Length = 273

 Score = 49.2 bits (112), Expect = 6e-06
 Identities = 33/124 (26%), Positives = 64/124 (51%), Gaps = 4/124 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV--HPLVFHTNRGQFVLMCGTQPD 286
           FK VL+G+G  GKT+ V R++   F  ++++TL        +     R   + +  T   
Sbjct: 65  FKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQ 124

Query: 287 KRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG--IPIVLCGNKVDI 460
           +R   +        D  L +++D+T R +++ V +W R+L R   G  I +++ GNK D+
Sbjct: 125 ERFHALGPIYYRGSDGAL-LVYDITDRDSFQKVKSWVREL-RQMRGTEIALIIVGNKTDL 182

Query: 461 KDRK 472
           ++++
Sbjct: 183 EEQR 186


>AL031027-5|CAA19844.2|  236|Drosophila melanogaster EG:80H7.4
           protein.
          Length = 236

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 32/129 (24%), Positives = 66/129 (51%), Gaps = 8/129 (6%)
 Frame = +2

Query: 122 VLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV-HPLVFHTNRGQ----FVLMCGTQPD 286
           +++GD G GKT  + ++  G F  ++++T+G++     + + +RG+     + +  T   
Sbjct: 21  LVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTAGQ 80

Query: 287 KRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL--VRVCEGIPIVLCGNKVD 457
           +R   +  T   ++D +   ++FD+TS  ++    NW   L      E   +VLCGNK D
Sbjct: 81  ERFRSL--TTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCD 138

Query: 458 IKDRKVKAK 484
           +   +V ++
Sbjct: 139 LLQLRVVSR 147


>AE014298-219|AAF45635.1|  236|Drosophila melanogaster CG14791-PB,
           isoform B protein.
          Length = 236

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 32/129 (24%), Positives = 66/129 (51%), Gaps = 8/129 (6%)
 Frame = +2

Query: 122 VLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV-HPLVFHTNRGQ----FVLMCGTQPD 286
           +++GD G GKT  + ++  G F  ++++T+G++     + + +RG+     + +  T   
Sbjct: 21  LVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTAGQ 80

Query: 287 KRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL--VRVCEGIPIVLCGNKVD 457
           +R   +  T   ++D +   ++FD+TS  ++    NW   L      E   +VLCGNK D
Sbjct: 81  ERFRSL--TTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCD 138

Query: 458 IKDRKVKAK 484
           +   +V ++
Sbjct: 139 LLQLRVVSR 147


>AE014297-3639|AAF56345.2|  213|Drosophila melanogaster CG31118-PA
           protein.
          Length = 213

 Score = 48.8 bits (111), Expect = 8e-06
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 1/121 (0%)
 Frame = +2

Query: 98  DDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGT 277
           D + T+K +++GD   GKT  V R+   ++   Y++T+G++    + + +     L    
Sbjct: 4   DFVATYKVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWD 63

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKV 454
              +     L T        + +M+DVT+  +Y N+  W R++       +  VL GNK 
Sbjct: 64  TAGQERFRTLTTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKC 123

Query: 455 D 457
           +
Sbjct: 124 E 124



 Score = 38.3 bits (85), Expect = 0.011
 Identities = 35/115 (30%), Positives = 50/115 (43%), Gaps = 5/115 (4%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAI--SHVRRNLSSYVQKCT*LA*---RFGPCM* 420
           I+  +WDTAGQE+F  L   YY +G   I   +   NL SY      L        P + 
Sbjct: 57  IKLQIWDTAGQERFRTLTTAYY-RGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVV 115

Query: 421 RYPYCLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKL 585
           +       + S   R           +  D+ ++++S KSN N E  FL LARK+
Sbjct: 116 KVLAGNKCECSATQRMVDKERGEKIAENFDMPFFEVSCKSNINIEDAFLSLARKI 170


>L38311-1|AAA67042.1|  192|Drosophila melanogaster Rho1 protein.
          Length = 192

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDG  GKT  +      +F + YV T+  E +      +  Q  L       +  
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTV-FENYVADIEVDGKQVELALWDTAGQED 65

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +    +V+ + F V S  + +N+P  W  ++   C  +PI+L GNK D+++
Sbjct: 66  YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRN 123


>BT010085-1|AAQ22554.1|  192|Drosophila melanogaster LD03419p
           protein.
          Length = 192

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDG  GKT  +      +F + YV T+  E +      +  Q  L       +  
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTV-FENYVADIEVDGKQVELALWDTAGQED 65

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +    +V+ + F V S  + +N+P  W  ++   C  +PI+L GNK D+++
Sbjct: 66  YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRN 123


>AY119536-1|AAM50190.1|  192|Drosophila melanogaster GH20776p
           protein.
          Length = 192

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDG  GKT  +      +F + YV T+  E +      +  Q  L       +  
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTV-FENYVADIEVDGKQVELALWDTAGQED 65

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +    +V+ + F V S  + +N+P  W  ++   C  +PI+L GNK D+++
Sbjct: 66  YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRN 123


>AF177874-1|AAF01186.1|  192|Drosophila melanogaster small GTPase
           RHO1 protein.
          Length = 192

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDG  GKT  +      +F + YV T+  E +      +  Q  L       +  
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTV-FENYVADIEVDGKQVELALWDTAGQED 65

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +    +V+ + F V S  + +N+P  W  ++   C  +PI+L GNK D+++
Sbjct: 66  YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRN 123


>AF177873-1|AAF01185.1|  192|Drosophila melanogaster small GTPase
           RHO1 protein.
          Length = 192

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDG  GKT  +      +F + YV T+  E +      +  Q  L       +  
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTV-FENYVADIEVDGKQVELALWDTAGQED 65

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +    +V+ + F V S  + +N+P  W  ++   C  +PI+L GNK D+++
Sbjct: 66  YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRN 123


>AF177872-1|AAF01184.1|  192|Drosophila melanogaster small GTPase
           RHO1 protein.
          Length = 192

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDG  GKT  +      +F + YV T+  E +      +  Q  L       +  
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTV-FENYVADIEVDGKQVELALWDTAGQED 65

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +    +V+ + F V S  + +N+P  W  ++   C  +PI+L GNK D+++
Sbjct: 66  YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRN 123


>AF177871-1|AAF01183.1|  192|Drosophila melanogaster small GTPase
           RHO1 protein.
          Length = 192

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDG  GKT  +      +F + YV T+  E +      +  Q  L       +  
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTV-FENYVADIEVDGKQVELALWDTAGQED 65

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +    +V+ + F V S  + +N+P  W  ++   C  +PI+L GNK D+++
Sbjct: 66  YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRN 123


>AE013599-2180|AAS64844.1|  192|Drosophila melanogaster CG8416-PG,
           isoform G protein.
          Length = 192

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDG  GKT  +      +F + YV T+  E +      +  Q  L       +  
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTV-FENYVADIEVDGKQVELALWDTAGQED 65

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +    +V+ + F V S  + +N+P  W  ++   C  +PI+L GNK D+++
Sbjct: 66  YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRN 123


>AE013599-2179|AAS64843.1|  192|Drosophila melanogaster CG8416-PF,
           isoform F protein.
          Length = 192

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDG  GKT  +      +F + YV T+  E +      +  Q  L       +  
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTV-FENYVADIEVDGKQVELALWDTAGQED 65

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +    +V+ + F V S  + +N+P  W  ++   C  +PI+L GNK D+++
Sbjct: 66  YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRN 123


>AE013599-2178|AAS64842.1|  192|Drosophila melanogaster CG8416-PE,
           isoform E protein.
          Length = 192

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDG  GKT  +      +F + YV T+  E +      +  Q  L       +  
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTV-FENYVADIEVDGKQVELALWDTAGQED 65

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +    +V+ + F V S  + +N+P  W  ++   C  +PI+L GNK D+++
Sbjct: 66  YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRN 123


>AE013599-2177|AAM70946.1|  192|Drosophila melanogaster CG8416-PD,
           isoform D protein.
          Length = 192

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDG  GKT  +      +F + YV T+  E +      +  Q  L       +  
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTV-FENYVADIEVDGKQVELALWDTAGQED 65

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +    +V+ + F V S  + +N+P  W  ++   C  +PI+L GNK D+++
Sbjct: 66  YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRN 123


>AE013599-2176|AAM70945.1|  192|Drosophila melanogaster CG8416-PC,
           isoform C protein.
          Length = 192

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDG  GKT  +      +F + YV T+  E +      +  Q  L       +  
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTV-FENYVADIEVDGKQVELALWDTAGQED 65

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +    +V+ + F V S  + +N+P  W  ++   C  +PI+L GNK D+++
Sbjct: 66  YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRN 123


>AE013599-2175|AAF58066.1|  192|Drosophila melanogaster CG8416-PB,
           isoform B protein.
          Length = 192

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDG  GKT  +      +F + YV T+  E +      +  Q  L       +  
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTV-FENYVADIEVDGKQVELALWDTAGQED 65

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +    +V+ + F V S  + +N+P  W  ++   C  +PI+L GNK D+++
Sbjct: 66  YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRN 123


>AE013599-2174|AAM70944.1|  192|Drosophila melanogaster CG8416-PA,
           isoform A protein.
          Length = 192

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V+VGDG  GKT  +      +F + YV T+  E +      +  Q  L       +  
Sbjct: 7   KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTV-FENYVADIEVDGKQVELALWDTAGQED 65

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +    +V+ + F V S  + +N+P  W  ++   C  +PI+L GNK D+++
Sbjct: 66  YDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRN 123


>U50314-1|AAB05666.1|  190|Drosophila melanogaster RhoL protein.
          Length = 190

 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 27/117 (23%), Positives = 54/117 (46%), Gaps = 1/117 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K  +VGDG  GKT  +  +   EF ++Y+ T+  + H      +   + L       +  
Sbjct: 13  KITIVGDGMVGKTCMLITYTRNEFPEEYIPTV-FDNHACNIAVDDRDYNLTLWDTAGQED 71

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIK 463
              L   +    N   + + ++SR +++NV + W  ++      +P+VL G K+D++
Sbjct: 72  YERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLR 128


>BT024201-1|ABC86263.1|  283|Drosophila melanogaster RE46661p
           protein.
          Length = 283

 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 32/134 (23%), Positives = 64/134 (47%), Gaps = 7/134 (5%)
 Frame = +2

Query: 77  HKTTKMADDMPT-FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRG 253
           ++ T+ A +    ++ V+ G GG GK++ V R + G F + Y+ T+  + +  V   N+ 
Sbjct: 6   NQVTRAAPEQSNDYRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTI-EDTYRQVISCNKN 64

Query: 254 QFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEG-- 424
              L             ++  +I K +   +++ V S+ + + + P W   L++  +G  
Sbjct: 65  ICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSVCSKQSLEELRPIW--ALIKELKGAD 122

Query: 425 ---IPIVLCGNKVD 457
              IP++L GNK D
Sbjct: 123 IPNIPVMLVGNKCD 136


>AY069811-1|AAL39956.1|  190|Drosophila melanogaster SD05212p
           protein.
          Length = 190

 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 27/117 (23%), Positives = 54/117 (46%), Gaps = 1/117 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K  +VGDG  GKT  +  +   EF ++Y+ T+  + H      +   + L       +  
Sbjct: 13  KITIVGDGMVGKTCMLITYTRNEFPEEYIPTV-FDNHACNIAVDDRDYNLTLWDTAGQED 71

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIK 463
              L   +    N   + + ++SR +++NV + W  ++      +P+VL G K+D++
Sbjct: 72  YERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLR 128


>AE014297-1044|AAF54453.1|  233|Drosophila melanogaster CG8500-PA
           protein.
          Length = 233

 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 32/134 (23%), Positives = 64/134 (47%), Gaps = 7/134 (5%)
 Frame = +2

Query: 77  HKTTKMADDMPT-FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRG 253
           ++ T+ A +    ++ V+ G GG GK++ V R + G F + Y+ T+  + +  V   N+ 
Sbjct: 6   NQVTRAAPEQSNDYRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTI-EDTYRQVISCNKN 64

Query: 254 QFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEG-- 424
              L             ++  +I K +   +++ V S+ + + + P W   L++  +G  
Sbjct: 65  ICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSVCSKQSLEELRPIW--ALIKELKGAD 122

Query: 425 ---IPIVLCGNKVD 457
              IP++L GNK D
Sbjct: 123 IPNIPVMLVGNKCD 136


>AE014297-950|AAF54385.1|  190|Drosophila melanogaster CG9366-PA
           protein.
          Length = 190

 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 27/117 (23%), Positives = 54/117 (46%), Gaps = 1/117 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K  +VGDG  GKT  +  +   EF ++Y+ T+  + H      +   + L       +  
Sbjct: 13  KITIVGDGMVGKTCMLITYTRNEFPEEYIPTV-FDNHACNIAVDDRDYNLTLWDTAGQED 71

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIK 463
              L   +    N   + + ++SR +++NV + W  ++      +P+VL G K+D++
Sbjct: 72  YERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLR 128


>AB035355-1|BAA87881.1|  190|Drosophila melanogaster Drac3 protein.
          Length = 190

 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 27/117 (23%), Positives = 54/117 (46%), Gaps = 1/117 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K  +VGDG  GKT  +  +   EF ++Y+ T+  + H      +   + L       +  
Sbjct: 13  KITIVGDGMVGKTCMLITYTRNEFPEEYIPTV-FDNHACNIAVDDRDYNLTLWDTAGQED 71

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIK 463
              L   +    N   + + ++SR +++NV + W  ++      +P+VL G K+D++
Sbjct: 72  YERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLR 128


>AY075329-1|AAL68196.1|  197|Drosophila melanogaster GH11193p
           protein.
          Length = 197

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 31/136 (22%), Positives = 70/136 (51%), Gaps = 7/136 (5%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDKR 292
           K +++G+ G GK++ ++R +  +F++ +  T+G++    V   +   + V +  T   +R
Sbjct: 7   KLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAER 66

Query: 293 SLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE--GIPIVLCGNKVD-- 457
              +  T + ++  + +++ +D+TSR +   +  W  +L    +   I I++ GNK+D  
Sbjct: 67  FRSL--TPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKIDEE 124

Query: 458 -IKDRKVKAKTIVFHR 502
            + DR+   K    HR
Sbjct: 125 RVVDREEGRKFARKHR 140


>AE014298-769|AAF46057.1|  197|Drosophila melanogaster CG3129-PA
           protein.
          Length = 197

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 31/136 (22%), Positives = 70/136 (51%), Gaps = 7/136 (5%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDKR 292
           K +++G+ G GK++ ++R +  +F++ +  T+G++    V   +   + V +  T   +R
Sbjct: 7   KLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAER 66

Query: 293 SLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE--GIPIVLCGNKVD-- 457
              +  T + ++  + +++ +D+TSR +   +  W  +L    +   I I++ GNK+D  
Sbjct: 67  FRSL--TPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKIDEE 124

Query: 458 -IKDRKVKAKTIVFHR 502
            + DR+   K    HR
Sbjct: 125 RVVDREEGRKFARKHR 140


>D84317-1|BAA21710.1|  197|Drosophila melanogaster rab-related
           protein 4 protein.
          Length = 197

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 29/134 (21%), Positives = 61/134 (45%), Gaps = 5/134 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++G+ G GK++ ++R +  +F++ +  T+G++    V   +   + +          
Sbjct: 7   KLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAER 66

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCE--GIPIVLCGNKVD---I 460
              L      K     +++D+TSR +   +  W  +L    +   I I++ GNK+D   +
Sbjct: 67  FRSLTASFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKIDEERV 126

Query: 461 KDRKVKAKTIVFHR 502
            DR+   K    HR
Sbjct: 127 VDREEGRKFARKHR 140


>AY071647-1|AAL49269.1|  213|Drosophila melanogaster RE70650p
           protein.
          Length = 213

 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 33/126 (26%), Positives = 58/126 (46%), Gaps = 3/126 (2%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEF--EKKYVATLGVEVHPLVFHTNRGQFVL-MCG 274
           +P  K +L GD G GK++  +R  T  F  +    +TLG++     +  N  Q  L +  
Sbjct: 6   IPKQKVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWD 65

Query: 275 TQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKV 454
           T   +R   V  +   F +  + V F + +  ++ ++     D+V   E   I +CGNK 
Sbjct: 66  TGGMERVASVTSSYYKFAEGAILV-FALDNAASFHSLSQHLLDIVTYAENAKIFICGNKS 124

Query: 455 DIKDRK 472
           D+  R+
Sbjct: 125 DLDGRE 130


>AY071139-1|AAL48761.1|  256|Drosophila melanogaster RE17845p
           protein.
          Length = 256

 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 27/123 (21%), Positives = 52/123 (42%), Gaps = 4/123 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V++GDGG GK+  + R +   +E+    T+GVE        +  ++ L       +  
Sbjct: 14  KVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQER 73

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC----EGIPIVLCGNKVDIK 463
              L T      ++  + + +  R + K +  W  + +       +  P ++ GNK DI 
Sbjct: 74  FRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDKFPFIVVGNKNDIP 133

Query: 464 DRK 472
            +K
Sbjct: 134 AQK 136


>AE014296-128|AAF47406.1|  213|Drosophila melanogaster CG12015-PA
           protein.
          Length = 213

 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 33/126 (26%), Positives = 58/126 (46%), Gaps = 3/126 (2%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEF--EKKYVATLGVEVHPLVFHTNRGQFVL-MCG 274
           +P  K +L GD G GK++  +R  T  F  +    +TLG++     +  N  Q  L +  
Sbjct: 6   IPKQKVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWD 65

Query: 275 TQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKV 454
           T   +R   V  +   F +  + V F + +  ++ ++     D+V   E   I +CGNK 
Sbjct: 66  TGGMERVASVTSSYYKFAEGAILV-FALDNAASFHSLSQHLLDIVTYAENAKIFICGNKS 124

Query: 455 DIKDRK 472
           D+  R+
Sbjct: 125 DLDGRE 130


>AE014134-3093|AAF53798.1|  256|Drosophila melanogaster CG9994-PA
           protein.
          Length = 256

 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 27/123 (21%), Positives = 52/123 (42%), Gaps = 4/123 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V++GDGG GK+  + R +   +E+    T+GVE        +  ++ L       +  
Sbjct: 14  KVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQER 73

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC----EGIPIVLCGNKVDIK 463
              L T      ++  + + +  R + K +  W  + +       +  P ++ GNK DI 
Sbjct: 74  FRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDKFPFIVVGNKNDIP 133

Query: 464 DRK 472
            +K
Sbjct: 134 AQK 136


>M80535-1|AAA28845.1|  184|Drosophila melanogaster GTP-binding
           protein protein.
          Length = 184

 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 28/131 (21%), Positives = 60/131 (45%), Gaps = 2/131 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M  +K V++G GG GK+    + +   F +KY  T+       V   +  Q +L      
Sbjct: 1   MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQV-EVDGQQCMLEILDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVD 457
                  +    +       +++ +T++ T+ ++ +    ++RV   + +P+VL GNK D
Sbjct: 60  GTEQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCD 119

Query: 458 IKDRKVKAKTI 490
           +++ +V  K +
Sbjct: 120 LEEERVVGKEL 130


>AY121688-1|AAM52015.1|  184|Drosophila melanogaster RE42418p
           protein.
          Length = 184

 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 28/131 (21%), Positives = 60/131 (45%), Gaps = 2/131 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M  +K V++G GG GK+    + +   F +KY  T+       V   +  Q +L      
Sbjct: 1   MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQV-EVDGQQCMLEILDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVD 457
                  +    +       +++ +T++ T+ ++ +    ++RV   + +P+VL GNK D
Sbjct: 60  GTEQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCD 119

Query: 458 IKDRKVKAKTI 490
           +++ +V  K +
Sbjct: 120 LEEERVVGKEL 130


>AF186654-1|AAF15520.1|  184|Drosophila melanogaster roughened
           protein.
          Length = 184

 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 28/131 (21%), Positives = 60/131 (45%), Gaps = 2/131 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M  +K V++G GG GK+    + +   F +KY  T+       V   +  Q +L      
Sbjct: 1   MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQV-EVDGQQCMLEILDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVD 457
                  +    +       +++ +T++ T+ ++ +    ++RV   + +P+VL GNK D
Sbjct: 60  GTEQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCD 119

Query: 458 IKDRKVKAKTI 490
           +++ +V  K +
Sbjct: 120 LEEERVVGKEL 130


>AE014296-375|AAF47583.1|  184|Drosophila melanogaster CG1956-PA
           protein.
          Length = 184

 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 28/131 (21%), Positives = 60/131 (45%), Gaps = 2/131 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M  +K V++G GG GK+    + +   F +KY  T+       V   +  Q +L      
Sbjct: 1   MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQV-EVDGQQCMLEILDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVD 457
                  +    +       +++ +T++ T+ ++ +    ++RV   + +P+VL GNK D
Sbjct: 60  GTEQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCD 119

Query: 458 IKDRKVKAKTI 490
           +++ +V  K +
Sbjct: 120 LEEERVVGKEL 130


>D84316-1|BAA21709.1|  215|Drosophila melanogaster rab14 protein.
          Length = 215

 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 30/123 (24%), Positives = 59/123 (47%), Gaps = 3/123 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPDK 289
           FK +++GD G GK+  + +    +F      T+GVE    +   +  +  L +  T   +
Sbjct: 12  FKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQE 71

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCEGIPIV-LCGNKVDIK 463
           R   V  T + ++    ++M +D+T R TY ++ +W  D   +     ++ L GNK D++
Sbjct: 72  RFRAV--TRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLE 129

Query: 464 DRK 472
             +
Sbjct: 130 STR 132



 Score = 37.5 bits (83), Expect = 0.020
 Identities = 37/134 (27%), Positives = 58/134 (43%), Gaps = 7/134 (5%)
 Frame = +1

Query: 235 IPYEPRAIRFNVWDTAGQEKFGGLRDGYY--IQGQCAISHVRRNLSSYVQKCT*LA*RFG 408
           I  + + I+  +WDTAGQE+F  +   YY    G   +  + R  S+Y    + L     
Sbjct: 53  IEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRR-STYNHLSSWLTDTRN 111

Query: 409 PCM*RYPYCLVRKQSGY--*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARK 582
                    L+  +S     R+ +  E   F  E  L + + SA +  N E+ FL  ARK
Sbjct: 112 LTNPSTVIFLIGNKSDLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARK 171

Query: 583 L---IGDGNLEFVA 615
           +   I +G L+  A
Sbjct: 172 IYQNIQEGRLDLNA 185


>D84313-1|BAA21706.1|  213|Drosophila melanogaster rab2 protein.
          Length = 213

 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 28/122 (22%), Positives = 58/122 (47%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +++GD G GK+  + +     F+  +  T+GVE    +   +  Q  L       + 
Sbjct: 7   FKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQE 66

Query: 293 SLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIKD 466
           +   + T + ++    +++ +D+T R T+ ++  W  D  +     + I+L GNK D+  
Sbjct: 67  AFRSI-TRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDS 125

Query: 467 RK 472
           R+
Sbjct: 126 RR 127



 Score = 32.3 bits (70), Expect = 0.75
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +1

Query: 235 IPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           I  + + I+  +WDTAGQE F  +   YY
Sbjct: 48  ITIDGKQIKLQIWDTAGQEAFRSITRSYY 76


>BT003315-1|AAO25075.1|  213|Drosophila melanogaster GH01619p
           protein.
          Length = 213

 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 28/122 (22%), Positives = 58/122 (47%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +++GD G GK+  + +     F+  +  T+GVE    +   +  Q  L       + 
Sbjct: 7   FKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQE 66

Query: 293 SLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIKD 466
           +   + T + ++    +++ +D+T R T+ ++  W  D  +     + I+L GNK D+  
Sbjct: 67  AFRSI-TRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDS 125

Query: 467 RK 472
           R+
Sbjct: 126 RR 127



 Score = 32.3 bits (70), Expect = 0.75
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +1

Query: 235 IPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           I  + + I+  +WDTAGQE F  +   YY
Sbjct: 48  ITIDGKQIKLQIWDTAGQEAFRSITRSYY 76


>AE014134-2489|AAF53390.1|  215|Drosophila melanogaster CG4212-PA,
           isoform A protein.
          Length = 215

 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 30/123 (24%), Positives = 59/123 (47%), Gaps = 3/123 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPDK 289
           FK +++GD G GK+  + +    +F      T+GVE    +   +  +  L +  T   +
Sbjct: 12  FKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQE 71

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCEGIPIV-LCGNKVDIK 463
           R   V  T + ++    ++M +D+T R TY ++ +W  D   +     ++ L GNK D++
Sbjct: 72  RFRAV--TRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLE 129

Query: 464 DRK 472
             +
Sbjct: 130 STR 132



 Score = 37.5 bits (83), Expect = 0.020
 Identities = 37/134 (27%), Positives = 58/134 (43%), Gaps = 7/134 (5%)
 Frame = +1

Query: 235 IPYEPRAIRFNVWDTAGQEKFGGLRDGYY--IQGQCAISHVRRNLSSYVQKCT*LA*RFG 408
           I  + + I+  +WDTAGQE+F  +   YY    G   +  + R  S+Y    + L     
Sbjct: 53  IEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRR-STYNHLSSWLTDTRN 111

Query: 409 PCM*RYPYCLVRKQSGY--*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARK 582
                    L+  +S     R+ +  E   F  E  L + + SA +  N E+ FL  ARK
Sbjct: 112 LTNPSTVIFLIGNKSDLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARK 171

Query: 583 L---IGDGNLEFVA 615
           +   I +G L+  A
Sbjct: 172 IYQNIQEGRLDLNA 185


>AE014134-2488|AAO41194.1|  233|Drosophila melanogaster CG4212-PC,
           isoform C protein.
          Length = 233

 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 30/123 (24%), Positives = 59/123 (47%), Gaps = 3/123 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPDK 289
           FK +++GD G GK+  + +    +F      T+GVE    +   +  +  L +  T   +
Sbjct: 30  FKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQE 89

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCEGIPIV-LCGNKVDIK 463
           R   V  T + ++    ++M +D+T R TY ++ +W  D   +     ++ L GNK D++
Sbjct: 90  RFRAV--TRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLE 147

Query: 464 DRK 472
             +
Sbjct: 148 STR 150



 Score = 37.5 bits (83), Expect = 0.020
 Identities = 37/134 (27%), Positives = 58/134 (43%), Gaps = 7/134 (5%)
 Frame = +1

Query: 235 IPYEPRAIRFNVWDTAGQEKFGGLRDGYY--IQGQCAISHVRRNLSSYVQKCT*LA*RFG 408
           I  + + I+  +WDTAGQE+F  +   YY    G   +  + R  S+Y    + L     
Sbjct: 71  IEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRR-STYNHLSSWLTDTRN 129

Query: 409 PCM*RYPYCLVRKQSGY--*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARK 582
                    L+  +S     R+ +  E   F  E  L + + SA +  N E+ FL  ARK
Sbjct: 130 LTNPSTVIFLIGNKSDLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARK 189

Query: 583 L---IGDGNLEFVA 615
           +   I +G L+  A
Sbjct: 190 IYQNIQEGRLDLNA 203


>AE014134-2487|AAO41193.1|  239|Drosophila melanogaster CG4212-PB,
           isoform B protein.
          Length = 239

 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 30/123 (24%), Positives = 59/123 (47%), Gaps = 3/123 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPDK 289
           FK +++GD G GK+  + +    +F      T+GVE    +   +  +  L +  T   +
Sbjct: 36  FKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQE 95

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCEGIPIV-LCGNKVDIK 463
           R   V  T + ++    ++M +D+T R TY ++ +W  D   +     ++ L GNK D++
Sbjct: 96  RFRAV--TRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLE 153

Query: 464 DRK 472
             +
Sbjct: 154 STR 156



 Score = 37.5 bits (83), Expect = 0.020
 Identities = 37/134 (27%), Positives = 58/134 (43%), Gaps = 7/134 (5%)
 Frame = +1

Query: 235 IPYEPRAIRFNVWDTAGQEKFGGLRDGYY--IQGQCAISHVRRNLSSYVQKCT*LA*RFG 408
           I  + + I+  +WDTAGQE+F  +   YY    G   +  + R  S+Y    + L     
Sbjct: 77  IEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRR-STYNHLSSWLTDTRN 135

Query: 409 PCM*RYPYCLVRKQSGY--*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARK 582
                    L+  +S     R+ +  E   F  E  L + + SA +  N E+ FL  ARK
Sbjct: 136 LTNPSTVIFLIGNKSDLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARK 195

Query: 583 L---IGDGNLEFVA 615
           +   I +G L+  A
Sbjct: 196 IYQNIQEGRLDLNA 209


>AE013599-209|AAM70817.1|  213|Drosophila melanogaster CG3269-PA
           protein.
          Length = 213

 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 28/122 (22%), Positives = 58/122 (47%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +++GD G GK+  + +     F+  +  T+GVE    +   +  Q  L       + 
Sbjct: 7   FKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQE 66

Query: 293 SLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIKD 466
           +   + T + ++    +++ +D+T R T+ ++  W  D  +     + I+L GNK D+  
Sbjct: 67  AFRSI-TRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDS 125

Query: 467 RK 472
           R+
Sbjct: 126 RR 127



 Score = 32.3 bits (70), Expect = 0.75
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +1

Query: 235 IPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           I  + + I+  +WDTAGQE F  +   YY
Sbjct: 48  ITIDGKQIKLQIWDTAGQEAFRSITRSYY 76


>AB035352-1|BAA87878.1|  213|Drosophila melanogaster Drab2 protein.
          Length = 213

 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 28/122 (22%), Positives = 58/122 (47%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +++GD G GK+  + +     F+  +  T+GVE    +   +  Q  L       + 
Sbjct: 7   FKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQE 66

Query: 293 SLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIKD 466
           +   + T + ++    +++ +D+T R T+ ++  W  D  +     + I+L GNK D+  
Sbjct: 67  AFRSI-TRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDS 125

Query: 467 RK 472
           R+
Sbjct: 126 RR 127



 Score = 32.3 bits (70), Expect = 0.75
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +1

Query: 235 IPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           I  + + I+  +WDTAGQE F  +   YY
Sbjct: 48  ITIDGKQIKLQIWDTAGQEAFRSITRSYY 76


>AY069563-1|AAL39708.1|  215|Drosophila melanogaster LD29476p
           protein.
          Length = 215

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 30/122 (24%), Positives = 55/122 (45%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPDK 289
           FK +++GD G GK+  + +    +F      T+GVE    +   +  +  L +  T   +
Sbjct: 12  FKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQE 71

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIV-LCGNKVDIKD 466
           R   V  +        L V +D+T R TY ++ +W  D   +     ++ L GNK D++ 
Sbjct: 72  RFRAVTRSYHRGAAGALMV-YDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLES 130

Query: 467 RK 472
            +
Sbjct: 131 TR 132



 Score = 35.5 bits (78), Expect = 0.081
 Identities = 36/134 (26%), Positives = 58/134 (43%), Gaps = 7/134 (5%)
 Frame = +1

Query: 235 IPYEPRAIRFNVWDTAGQEKFGGLRDGYY--IQGQCAISHVRRNLSSYVQKCT*LA*RFG 408
           I  + + I+  +WDTAGQE+F  +   Y+    G   +  + R  S+Y    + L     
Sbjct: 53  IEVDDKKIKLQIWDTAGQERFRAVTRSYHRGAAGALMVYDITRR-STYNHLSSWLTDTRN 111

Query: 409 PCM*RYPYCLVRKQSGY--*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARK 582
                    L+  +S     R+ +  E   F  E  L + + SA +  N E+ FL  ARK
Sbjct: 112 LTNPSTVIFLIGNKSDLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARK 171

Query: 583 L---IGDGNLEFVA 615
           +   I +G L+  A
Sbjct: 172 IYQNIQEGRLDLNA 185


>AE013599-2512|AAS64815.1|  213|Drosophila melanogaster CG4921-PC,
           isoform C protein.
          Length = 213

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPDK 289
           FK +++G  G+GK+  +   +  +F+     T+GVE    + +       L +  T   +
Sbjct: 9   FKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQE 68

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIKD 466
           R   V  +        L +++D TSR ++  + NW  D   +    I I+L GNK D+++
Sbjct: 69  RFRSVTRSYYRGAAGAL-LVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEE 127

Query: 467 RK 472
            +
Sbjct: 128 AR 129



 Score = 32.7 bits (71), Expect = 0.57
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +1

Query: 250 RAIRFNVWDTAGQEKFGGLRDGYY 321
           ++++  +WDTAGQE+F  +   YY
Sbjct: 55  KSVKLQIWDTAGQERFRSVTRSYY 78


>AE013599-2511|AAM68480.1|  213|Drosophila melanogaster CG4921-PB,
           isoform B protein.
          Length = 213

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPDK 289
           FK +++G  G+GK+  +   +  +F+     T+GVE    + +       L +  T   +
Sbjct: 9   FKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQE 68

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIKD 466
           R   V  +        L +++D TSR ++  + NW  D   +    I I+L GNK D+++
Sbjct: 69  RFRSVTRSYYRGAAGAL-LVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEE 127

Query: 467 RK 472
            +
Sbjct: 128 AR 129



 Score = 32.7 bits (71), Expect = 0.57
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +1

Query: 250 RAIRFNVWDTAGQEKFGGLRDGYY 321
           ++++  +WDTAGQE+F  +   YY
Sbjct: 55  KSVKLQIWDTAGQERFRSVTRSYY 78


>AE013599-2510|AAF57831.1|  213|Drosophila melanogaster CG4921-PA,
           isoform A protein.
          Length = 213

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPDK 289
           FK +++G  G+GK+  +   +  +F+     T+GVE    + +       L +  T   +
Sbjct: 9   FKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQE 68

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIKD 466
           R   V  +        L +++D TSR ++  + NW  D   +    I I+L GNK D+++
Sbjct: 69  RFRSVTRSYYRGAAGAL-LVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEE 127

Query: 467 RK 472
            +
Sbjct: 128 AR 129



 Score = 32.7 bits (71), Expect = 0.57
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +1

Query: 250 RAIRFNVWDTAGQEKFGGLRDGYY 321
           ++++  +WDTAGQE+F  +   YY
Sbjct: 55  KSVKLQIWDTAGQERFRSVTRSYY 78


>AB035670-1|BAA88243.1|  213|Drosophila melanogaster Rab4 protein
           protein.
          Length = 213

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPDK 289
           FK +++G  G+GK+  +   +  +F+     T+GVE    + +       L +  T   +
Sbjct: 9   FKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQE 68

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIKD 466
           R   V  +        L +++D TSR ++  + NW  D   +    I I+L GNK D+++
Sbjct: 69  RFRSVTRSYYRGAAGAL-LVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEE 127

Query: 467 RK 472
            +
Sbjct: 128 AR 129



 Score = 32.7 bits (71), Expect = 0.57
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +1

Query: 250 RAIRFNVWDTAGQEKFGGLRDGYY 321
           ++++  +WDTAGQE+F  +   YY
Sbjct: 55  KSVKLQIWDTAGQERFRSVTRSYY 78


>BT023048-1|AAY55464.1|  216|Drosophila melanogaster IP04009p
           protein.
          Length = 216

 Score = 41.1 bits (92), Expect = 0.002
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVAT 208
           +A   P+ KCVLVGDG  GKT  +  +L   F  +++ T
Sbjct: 20  IAQPQPSIKCVLVGDGAVGKTNLILSYLENRFNPEHIPT 58


>BT023013-1|AAY55429.1|  216|Drosophila melanogaster IP04109p
           protein.
          Length = 216

 Score = 41.1 bits (92), Expect = 0.002
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVAT 208
           +A   P+ KCVLVGDG  GKT  +  +L   F  +++ T
Sbjct: 20  IAQPQPSIKCVLVGDGAVGKTNLILSYLENRFNPEHIPT 58


>BT022972-1|AAY55388.1|  216|Drosophila melanogaster IP04209p
           protein.
          Length = 216

 Score = 41.1 bits (92), Expect = 0.002
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVAT 208
           +A   P+ KCVLVGDG  GKT  +  +L   F  +++ T
Sbjct: 20  IAQPQPSIKCVLVGDGAVGKTNLILSYLENRFNPEHIPT 58


>AY752515-1|AAW31971.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 41.1 bits (92), Expect = 0.002
 Identities = 24/92 (26%), Positives = 49/92 (53%), Gaps = 4/92 (4%)
 Frame = +2

Query: 251 GQFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGI 427
           G+ + +  T  D+R  ++  T       +L V +D+TS  +++N+  W +++ R+C + +
Sbjct: 20  GRMLQVWDTSDDERFKLLKATQCRSAHGILLV-YDITSSKSFQNIDGWMKEIRRLCPDKV 78

Query: 428 PIVLCGNKVDIKDRKVKAKTIVF---HRKKIC 514
            ++L GNK D  + +  +    F   HR+ IC
Sbjct: 79  IVLLVGNKSDDPNHRQVSMAQGFNYAHRQSIC 110


>AY075502-1|AAL68311.1|  431|Drosophila melanogaster RE52190p
           protein.
          Length = 431

 Score = 41.1 bits (92), Expect = 0.002
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVAT 208
           +A   P+ KCVLVGDG  GKT  +  +L   F  +++ T
Sbjct: 386 IAQPQPSIKCVLVGDGAVGKTNLILSYLENRFNPEHIPT 424


>AE014298-1412|AAF46555.2|  431|Drosophila melanogaster CG34104-PA,
           isoform A protein.
          Length = 431

 Score = 41.1 bits (92), Expect = 0.002
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVAT 208
           +A   P+ KCVLVGDG  GKT  +  +L   F  +++ T
Sbjct: 386 IAQPQPSIKCVLVGDGAVGKTNLILSYLENRFNPEHIPT 424


>AE014298-1411|ABI30973.1|  582|Drosophila melanogaster CG34104-PB,
           isoform B protein.
          Length = 582

 Score = 41.1 bits (92), Expect = 0.002
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVAT 208
           +A   P+ KCVLVGDG  GKT  +  +L   F  +++ T
Sbjct: 386 IAQPQPSIKCVLVGDGAVGKTNLILSYLENRFNPEHIPT 424


>AY752522-1|AAW31978.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 24/92 (26%), Positives = 49/92 (53%), Gaps = 4/92 (4%)
 Frame = +2

Query: 251 GQFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGI 427
           G+ + +  T  D+R  ++  T       +L V +D+TS  +++N+  W +++ R+C + +
Sbjct: 20  GRMLQVWDTSDDERFKLLKATHCRSAHGILLV-YDITSSKSFQNIDGWMKEIRRLCPDKV 78

Query: 428 PIVLCGNKVDIKDRKVKAKTIVF---HRKKIC 514
            ++L GNK D  + +  +    F   HR+ IC
Sbjct: 79  IVLLVGNKSDDPNHRQVSMAQGFNYAHRQSIC 110


>AY752521-1|AAW31977.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 24/92 (26%), Positives = 49/92 (53%), Gaps = 4/92 (4%)
 Frame = +2

Query: 251 GQFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGI 427
           G+ + +  T  D+R  ++  T       +L V +D+TS  +++N+  W +++ R+C + +
Sbjct: 20  GRMLQVWDTSDDERFKLLKATHCRSAHGILLV-YDITSSKSFQNIDGWMKEIRRLCPDKV 78

Query: 428 PIVLCGNKVDIKDRKVKAKTIVF---HRKKIC 514
            ++L GNK D  + +  +    F   HR+ IC
Sbjct: 79  IVLLVGNKSDDPNHRQVSMAQGFNYAHRQSIC 110


>AY752520-1|AAW31976.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 24/92 (26%), Positives = 49/92 (53%), Gaps = 4/92 (4%)
 Frame = +2

Query: 251 GQFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGI 427
           G+ + +  T  D+R  ++  T       +L V +D+TS  +++N+  W +++ R+C + +
Sbjct: 20  GRMLQVWDTSDDERFKLLKATHCRSAHGILLV-YDITSSKSFQNIDGWMKEIRRLCPDKV 78

Query: 428 PIVLCGNKVDIKDRKVKAKTIVF---HRKKIC 514
            ++L GNK D  + +  +    F   HR+ IC
Sbjct: 79  IVLLVGNKSDDPNHRQVSMAQGFNYAHRQSIC 110


>AY752519-1|AAW31975.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 24/92 (26%), Positives = 49/92 (53%), Gaps = 4/92 (4%)
 Frame = +2

Query: 251 GQFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGI 427
           G+ + +  T  D+R  ++  T       +L V +D+TS  +++N+  W +++ R+C + +
Sbjct: 20  GRMLQVWDTSDDERFKLLKATHCRSAHGILLV-YDITSSKSFQNIDGWMKEIRRLCPDKV 78

Query: 428 PIVLCGNKVDIKDRKVKAKTIVF---HRKKIC 514
            ++L GNK D  + +  +    F   HR+ IC
Sbjct: 79  IVLLVGNKSDDPNHRQVSMAQGFNYAHRQSIC 110


>AY752518-1|AAW31974.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 24/92 (26%), Positives = 49/92 (53%), Gaps = 4/92 (4%)
 Frame = +2

Query: 251 GQFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGI 427
           G+ + +  T  D+R  ++  T       +L V +D+TS  +++N+  W +++ R+C + +
Sbjct: 20  GRMLQVWDTSDDERFKLLKATHCRSAHGILLV-YDITSSKSFQNIDGWMKEIRRLCPDKV 78

Query: 428 PIVLCGNKVDIKDRKVKAKTIVF---HRKKIC 514
            ++L GNK D  + +  +    F   HR+ IC
Sbjct: 79  IVLLVGNKSDDPNHRQVSMAQGFNYAHRQSIC 110


>AY752517-1|AAW31973.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 24/92 (26%), Positives = 49/92 (53%), Gaps = 4/92 (4%)
 Frame = +2

Query: 251 GQFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGI 427
           G+ + +  T  D+R  ++  T       +L V +D+TS  +++N+  W +++ R+C + +
Sbjct: 20  GRMLQVWDTSDDERFKLLKATHCRSAHGILLV-YDITSSKSFQNIDGWMKEIRRLCPDKV 78

Query: 428 PIVLCGNKVDIKDRKVKAKTIVF---HRKKIC 514
            ++L GNK D  + +  +    F   HR+ IC
Sbjct: 79  IVLLVGNKSDDPNHRQVSMAQGFNYAHRQSIC 110


>AY752516-1|AAW31972.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 24/92 (26%), Positives = 49/92 (53%), Gaps = 4/92 (4%)
 Frame = +2

Query: 251 GQFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGI 427
           G+ + +  T  D+R  ++  T       +L V +D+TS  +++N+  W +++ R+C + +
Sbjct: 20  GRMLQVWDTSDDERFKLLKATHCRSAHGILLV-YDITSSKSFQNIDGWMKEIRRLCPDKV 78

Query: 428 PIVLCGNKVDIKDRKVKAKTIVF---HRKKIC 514
            ++L GNK D  + +  +    F   HR+ IC
Sbjct: 79  IVLLVGNKSDDPNHRQVSMAQGFNYAHRQSIC 110


>AY752514-1|AAW31970.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 24/92 (26%), Positives = 49/92 (53%), Gaps = 4/92 (4%)
 Frame = +2

Query: 251 GQFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGI 427
           G+ + +  T  D+R  ++  T       +L V +D+TS  +++N+  W +++ R+C + +
Sbjct: 20  GRMLQVWDTSDDERFKLLKATHCRSAHGILLV-YDITSSKSFQNIDGWMKEIRRLCPDKV 78

Query: 428 PIVLCGNKVDIKDRKVKAKTIVF---HRKKIC 514
            ++L GNK D  + +  +    F   HR+ IC
Sbjct: 79  IVLLVGNKSDDPNHRQVSMAQGFNYAHRQSIC 110


>AY752513-1|AAW31969.1|  160|Drosophila melanogaster CG2532 protein.
          Length = 160

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 24/92 (26%), Positives = 49/92 (53%), Gaps = 4/92 (4%)
 Frame = +2

Query: 251 GQFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGI 427
           G+ + +  T  D+R  ++  T       +L V +D+TS  +++N+  W +++ R+C + +
Sbjct: 20  GRMLQVWDTSDDERFKLLKATHCRSAHGILLV-YDITSSKSFQNIDGWMKEIRRLCPDKV 78

Query: 428 PIVLCGNKVDIKDRKVKAKTIVF---HRKKIC 514
            ++L GNK D  + +  +    F   HR+ IC
Sbjct: 79  IVLLVGNKSDDPNHRQVSMAQGFNYAHRQSIC 110


>AL050231-7|CAB43324.1|  306|Drosophila melanogaster EG:BACR37P7.8
           protein.
          Length = 306

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 28/117 (23%), Positives = 49/117 (41%), Gaps = 2/117 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V++G    GKT+ + + L   F  KY  T+  E+H   F        L          
Sbjct: 49  KIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIE-EMHQGNFSIAGVSLTLDILDTAGSYE 107

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL--VRVCEGIPIVLCGNKVDI 460
              +   +I   +   +++DVT   T++ V      +   +    +PIV+ GNK+D+
Sbjct: 108 FPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAVPIVVVGNKIDL 164


>AE014298-18|AAF45493.2|  306|Drosophila melanogaster CG13375-PA
           protein.
          Length = 306

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 28/117 (23%), Positives = 49/117 (41%), Gaps = 2/117 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K V++G    GKT+ + + L   F  KY  T+  E+H   F        L          
Sbjct: 49  KIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIE-EMHQGNFSIAGVSLTLDILDTAGSYE 107

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL--VRVCEGIPIVLCGNKVDI 460
              +   +I   +   +++DVT   T++ V      +   +    +PIV+ GNK+D+
Sbjct: 108 FPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQIHETKATTAVPIVVVGNKIDL 164


>BT012453-1|AAS93724.1|  182|Drosophila melanogaster RE63021p
           protein.
          Length = 182

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 29/121 (23%), Positives = 54/121 (44%), Gaps = 2/121 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M  FK V++G GG GK+    + ++G F +KY  T+  + +      +    VL      
Sbjct: 1   MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTI-EDFYRKEIEVDSSPCVLEILDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVD 457
                  +    I   +   VM+ +T+  T++++ +    + RV   +  PI+L  NK D
Sbjct: 60  GTEQFASMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFD 119

Query: 458 I 460
           +
Sbjct: 120 L 120


>AY081181-1|AAN85553.1|  219|Drosophila melanogaster Rab5 protein.
          Length = 219

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 3/128 (2%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI-SHVRRNLSSYVQKCT 387
           G    + +I  E   ++F +WDTAGQE++  L   YY   Q AI  +  +N  S+ +  T
Sbjct: 63  GAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKT 122

Query: 388 *LA*RFGPCM*RYPYCLVRKQS--GY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKP 561
            +              L   ++     R     E   + +E  L + + SAK+  N    
Sbjct: 123 WVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDI 182

Query: 562 FLWLARKL 585
           FL +A+KL
Sbjct: 183 FLAIAKKL 190



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 4/125 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLM-CGTQP 283
           FK VL+G+   GK++ V R + G+F +   +T+G       +       +F +     Q 
Sbjct: 30  FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQE 89

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
              SL  +            V++D+ ++ +++    W ++L  +    I I L GNK D+
Sbjct: 90  RYHSLAPMYYRGA---QAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL 146

Query: 461 KDRKV 475
            + +V
Sbjct: 147 SNIRV 151


>AY081180-1|AAN85552.1|  219|Drosophila melanogaster Rab5 protein.
          Length = 219

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 3/128 (2%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI-SHVRRNLSSYVQKCT 387
           G    + +I  E   ++F +WDTAGQE++  L   YY   Q AI  +  +N  S+ +  T
Sbjct: 63  GAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKT 122

Query: 388 *LA*RFGPCM*RYPYCLVRKQS--GY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKP 561
            +              L   ++     R     E   + +E  L + + SAK+  N    
Sbjct: 123 WVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDI 182

Query: 562 FLWLARKL 585
           FL +A+KL
Sbjct: 183 FLAIAKKL 190



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 4/125 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLM-CGTQP 283
           FK VL+G+   GK++ V R + G+F +   +T+G       +       +F +     Q 
Sbjct: 30  FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQE 89

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
              SL  +            V++D+ ++ +++    W ++L  +    I I L GNK D+
Sbjct: 90  RYHSLAPMYYRGA---QAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL 146

Query: 461 KDRKV 475
            + +V
Sbjct: 147 SNIRV 151


>AY060343-1|AAL25382.1|  219|Drosophila melanogaster GH24702p
           protein.
          Length = 219

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 3/128 (2%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI-SHVRRNLSSYVQKCT 387
           G    + +I  E   ++F +WDTAGQE++  L   YY   Q AI  +  +N  S+ +  T
Sbjct: 63  GAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKT 122

Query: 388 *LA*RFGPCM*RYPYCLVRKQS--GY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKP 561
            +              L   ++     R     E   + +E  L + + SAK+  N    
Sbjct: 123 WVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDI 182

Query: 562 FLWLARKL 585
           FL +A+KL
Sbjct: 183 FLAIAKKL 190



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 4/125 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLM-CGTQP 283
           FK VL+G+   GK++ V R + G+F +   +T+G       +       +F +     Q 
Sbjct: 30  FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQE 89

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
              SL  +            V++D+ ++ +++    W ++L  +    I I L GNK D+
Sbjct: 90  RYHSLAPMYYRGA---QAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL 146

Query: 461 KDRKV 475
            + +V
Sbjct: 147 SNIRV 151


>AF111427-1|AAC98693.1|  182|Drosophila melanogaster Ras-related
           protein 2-like protein protein.
          Length = 182

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 29/121 (23%), Positives = 54/121 (44%), Gaps = 2/121 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M  FK V++G GG GK+    + ++G F +KY  T+  + +      +    VL      
Sbjct: 1   MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTI-EDFYRKEIEVDSSPCVLEILDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVD 457
                  +    I   +   VM+ +T+  T++++ +    + RV   +  PI+L  NK D
Sbjct: 60  GTEQFASMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFD 119

Query: 458 I 460
           +
Sbjct: 120 L 120


>AE014134-396|AAN10426.1|  219|Drosophila melanogaster CG3664-PF,
           isoform F protein.
          Length = 219

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 3/128 (2%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI-SHVRRNLSSYVQKCT 387
           G    + +I  E   ++F +WDTAGQE++  L   YY   Q AI  +  +N  S+ +  T
Sbjct: 63  GAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKT 122

Query: 388 *LA*RFGPCM*RYPYCLVRKQS--GY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKP 561
            +              L   ++     R     E   + +E  L + + SAK+  N    
Sbjct: 123 WVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDI 182

Query: 562 FLWLARKL 585
           FL +A+KL
Sbjct: 183 FLAIAKKL 190



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 4/125 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLM-CGTQP 283
           FK VL+G+   GK++ V R + G+F +   +T+G       +       +F +     Q 
Sbjct: 30  FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQE 89

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
              SL  +            V++D+ ++ +++    W ++L  +    I I L GNK D+
Sbjct: 90  RYHSLAPMYYRGA---QAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL 146

Query: 461 KDRKV 475
            + +V
Sbjct: 147 SNIRV 151


>AE014134-395|AAN10425.1|  219|Drosophila melanogaster CG3664-PE,
           isoform E protein.
          Length = 219

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 3/128 (2%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI-SHVRRNLSSYVQKCT 387
           G    + +I  E   ++F +WDTAGQE++  L   YY   Q AI  +  +N  S+ +  T
Sbjct: 63  GAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKT 122

Query: 388 *LA*RFGPCM*RYPYCLVRKQS--GY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKP 561
            +              L   ++     R     E   + +E  L + + SAK+  N    
Sbjct: 123 WVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDI 182

Query: 562 FLWLARKL 585
           FL +A+KL
Sbjct: 183 FLAIAKKL 190



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 4/125 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLM-CGTQP 283
           FK VL+G+   GK++ V R + G+F +   +T+G       +       +F +     Q 
Sbjct: 30  FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQE 89

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
              SL  +            V++D+ ++ +++    W ++L  +    I I L GNK D+
Sbjct: 90  RYHSLAPMYYRGA---QAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL 146

Query: 461 KDRKV 475
            + +V
Sbjct: 147 SNIRV 151


>AE014134-394|AAN10424.1|  219|Drosophila melanogaster CG3664-PD,
           isoform D protein.
          Length = 219

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 3/128 (2%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI-SHVRRNLSSYVQKCT 387
           G    + +I  E   ++F +WDTAGQE++  L   YY   Q AI  +  +N  S+ +  T
Sbjct: 63  GAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKT 122

Query: 388 *LA*RFGPCM*RYPYCLVRKQS--GY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKP 561
            +              L   ++     R     E   + +E  L + + SAK+  N    
Sbjct: 123 WVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDI 182

Query: 562 FLWLARKL 585
           FL +A+KL
Sbjct: 183 FLAIAKKL 190



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 4/125 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLM-CGTQP 283
           FK VL+G+   GK++ V R + G+F +   +T+G       +       +F +     Q 
Sbjct: 30  FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQE 89

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
              SL  +            V++D+ ++ +++    W ++L  +    I I L GNK D+
Sbjct: 90  RYHSLAPMYYRGA---QAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL 146

Query: 461 KDRKV 475
            + +V
Sbjct: 147 SNIRV 151


>AE014134-393|AAN10423.1|  219|Drosophila melanogaster CG3664-PC,
           isoform C protein.
          Length = 219

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 3/128 (2%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI-SHVRRNLSSYVQKCT 387
           G    + +I  E   ++F +WDTAGQE++  L   YY   Q AI  +  +N  S+ +  T
Sbjct: 63  GAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKT 122

Query: 388 *LA*RFGPCM*RYPYCLVRKQS--GY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKP 561
            +              L   ++     R     E   + +E  L + + SAK+  N    
Sbjct: 123 WVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDI 182

Query: 562 FLWLARKL 585
           FL +A+KL
Sbjct: 183 FLAIAKKL 190



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 4/125 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLM-CGTQP 283
           FK VL+G+   GK++ V R + G+F +   +T+G       +       +F +     Q 
Sbjct: 30  FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQE 89

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
              SL  +            V++D+ ++ +++    W ++L  +    I I L GNK D+
Sbjct: 90  RYHSLAPMYYRGA---QAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL 146

Query: 461 KDRKV 475
            + +V
Sbjct: 147 SNIRV 151


>AE014134-392|AAN10422.1|  219|Drosophila melanogaster CG3664-PB,
           isoform B protein.
          Length = 219

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 3/128 (2%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI-SHVRRNLSSYVQKCT 387
           G    + +I  E   ++F +WDTAGQE++  L   YY   Q AI  +  +N  S+ +  T
Sbjct: 63  GAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKT 122

Query: 388 *LA*RFGPCM*RYPYCLVRKQS--GY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKP 561
            +              L   ++     R     E   + +E  L + + SAK+  N    
Sbjct: 123 WVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDI 182

Query: 562 FLWLARKL 585
           FL +A+KL
Sbjct: 183 FLAIAKKL 190



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 4/125 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLM-CGTQP 283
           FK VL+G+   GK++ V R + G+F +   +T+G       +       +F +     Q 
Sbjct: 30  FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQE 89

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
              SL  +            V++D+ ++ +++    W ++L  +    I I L GNK D+
Sbjct: 90  RYHSLAPMYYRGA---QAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL 146

Query: 461 KDRKV 475
            + +V
Sbjct: 147 SNIRV 151


>AE014134-391|AAF51265.1|  219|Drosophila melanogaster CG3664-PA,
           isoform A protein.
          Length = 219

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 3/128 (2%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI-SHVRRNLSSYVQKCT 387
           G    + +I  E   ++F +WDTAGQE++  L   YY   Q AI  +  +N  S+ +  T
Sbjct: 63  GAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKT 122

Query: 388 *LA*RFGPCM*RYPYCLVRKQS--GY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKP 561
            +              L   ++     R     E   + +E  L + + SAK+  N    
Sbjct: 123 WVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDI 182

Query: 562 FLWLARKL 585
           FL +A+KL
Sbjct: 183 FLAIAKKL 190



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 4/125 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLM-CGTQP 283
           FK VL+G+   GK++ V R + G+F +   +T+G       +       +F +     Q 
Sbjct: 30  FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQE 89

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
              SL  +            V++D+ ++ +++    W ++L  +    I I L GNK D+
Sbjct: 90  RYHSLAPMYYRGA---QAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL 146

Query: 461 KDRKV 475
            + +V
Sbjct: 147 SNIRV 151


>AE013599-3799|AAF47155.1|  182|Drosophila melanogaster CG3204-PA,
           isoform A protein.
          Length = 182

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 29/121 (23%), Positives = 54/121 (44%), Gaps = 2/121 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M  FK V++G GG GK+    + ++G F +KY  T+  + +      +    VL      
Sbjct: 1   MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTI-EDFYRKEIEVDSSPCVLEILDTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVD 457
                  +    I   +   VM+ +T+  T++++ +    + RV   +  PI+L  NK D
Sbjct: 60  GTEQFASMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFD 119

Query: 458 I 460
           +
Sbjct: 120 L 120


>AB035671-1|BAA88244.1|  219|Drosophila melanogaster Rab5 protein
           protein.
          Length = 219

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 3/128 (2%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI-SHVRRNLSSYVQKCT 387
           G    + +I  E   ++F +WDTAGQE++  L   YY   Q AI  +  +N  S+ +  T
Sbjct: 63  GAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKT 122

Query: 388 *LA*RFGPCM*RYPYCLVRKQS--GY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKP 561
            +              L   ++     R     E   + +E  L + + SAK+  N    
Sbjct: 123 WVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDI 182

Query: 562 FLWLARKL 585
           FL +A+KL
Sbjct: 183 FLAIAKKL 190



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 4/125 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLM-CGTQP 283
           FK VL+G+   GK++ V R + G+F +   +T+G       +       +F +     Q 
Sbjct: 30  FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQE 89

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
              SL  +            V++D+ ++ +++    W ++L  +    I I L GNK D+
Sbjct: 90  RYHSLAPMYYRGA---QAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL 146

Query: 461 KDRKV 475
            + +V
Sbjct: 147 SNIRV 151


>AB035353-1|BAA87879.1|  219|Drosophila melanogaster Drab5 protein.
          Length = 219

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 3/128 (2%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI-SHVRRNLSSYVQKCT 387
           G    + +I  E   ++F +WDTAGQE++  L   YY   Q AI  +  +N  S+ +  T
Sbjct: 63  GAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKT 122

Query: 388 *LA*RFGPCM*RYPYCLVRKQS--GY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKP 561
            +              L   ++     R     E   + +E  L + + SAK+  N    
Sbjct: 123 WVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDI 182

Query: 562 FLWLARKL 585
           FL +A+KL
Sbjct: 183 FLAIAKKL 190



 Score = 37.1 bits (82), Expect = 0.026
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 4/125 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLM-CGTQP 283
           FK VL+G+   GK++ V R + G+F +   +T+G       +       +F +     Q 
Sbjct: 30  FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQE 89

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
              SL  +            V++D+ ++ +++    W ++L  +    I I L GNK D+
Sbjct: 90  RYHSLAPMYYRGA---QAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL 146

Query: 461 KDRKV 475
            + +V
Sbjct: 147 SNIRV 151


>Y07564-1|CAA68849.1|  264|Drosophila melanogaster RIC (Ras which
           interacts withCalmodulin) protein.
          Length = 264

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 27/129 (20%), Positives = 57/129 (44%), Gaps = 2/129 (1%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           M   +  +K V++GDGG GK+    + ++  F   +  T+           N    + + 
Sbjct: 53  MRGGLRVYKIVILGDGGVGKSAVTLQFVSHSFLDYHDPTIEDSYQQQAVIDNEAALLDIL 112

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL--VRVCEGIPIVLCG 445
            T        + +      +  + + + VT R +++    + + +  VR+ E IP+VL  
Sbjct: 113 DTAGQVEFTAMRDQYMRCGEGFI-ICYSVTDRHSFQEASEYRKLITRVRLSEDIPLVLIA 171

Query: 446 NKVDIKDRK 472
           NKVD++ ++
Sbjct: 172 NKVDLESQR 180


>U23800-1|AAC34902.1|  201|Drosophila melanogaster ral protein.
          Length = 201

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 28/121 (23%), Positives = 51/121 (42%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K ++VG GG GK+    + +  EF + Y  T        V        + +  T   +  
Sbjct: 13  KVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDY 72

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVDIKDR 469
             + +      +  L V F +T   +++    +   ++RV   E IP +L GNK D+ D+
Sbjct: 73  AAIRDNYFRSGEGFLCV-FSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDK 131

Query: 470 K 472
           +
Sbjct: 132 R 132



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQ 333
           ++ ++ DTAGQE +  +RD Y+  G+
Sbjct: 59  VQIDILDTAGQEDYAAIRDNYFRSGE 84


>AY118912-1|AAM50772.1|  201|Drosophila melanogaster LD21679p
           protein.
          Length = 201

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 28/121 (23%), Positives = 51/121 (42%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K ++VG GG GK+    + +  EF + Y  T        V        + +  T   +  
Sbjct: 13  KVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDY 72

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVDIKDR 469
             + +      +  L V F +T   +++    +   ++RV   E IP +L GNK D+ D+
Sbjct: 73  AAIRDNYFRSGEGFLCV-FSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDK 131

Query: 470 K 472
           +
Sbjct: 132 R 132



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQ 333
           ++ ++ DTAGQE +  +RD Y+  G+
Sbjct: 59  VQIDILDTAGQEDYAAIRDNYFRSGE 84


>AY061365-1|AAL28913.1|  147|Drosophila melanogaster LD28840p
           protein.
          Length = 147

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 18/44 (40%), Positives = 27/44 (61%)
 Frame = +2

Query: 344 VMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIKDRKV 475
           V++DVT+  ++ NV  W  ++   C+ +  VL GNK D  DRKV
Sbjct: 32  VVYDVTNGESFANVRRWLEEIQNNCDVVKKVLVGNKNDDPDRKV 75



 Score = 35.5 bits (78), Expect = 0.081
 Identities = 30/114 (26%), Positives = 50/114 (43%), Gaps = 3/114 (2%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYY--IQGQCAISHVRRNLSSYVQKCT*LA*RFGPCM*RYP 429
           ++  +WDTAGQE+F  +   YY    G   +  V  N  S+      L      C     
Sbjct: 3   VKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDV-TNGESFANVRRWLEEIQNNCDVVKK 61

Query: 430 YCLVRKQSGY*RQKS*GEN-YCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLI 588
             +  K     R+    E+   F ++ D++ ++ SAK N N E  FL + R+++
Sbjct: 62  VLVGNKNDDPDRKVVITEDAQRFAKQMDIELFETSAKDNINVENMFLSITRQVL 115


>AY024366-1|AAK00587.1|  197|Drosophila melanogaster RAL2 protein.
          Length = 197

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 28/121 (23%), Positives = 51/121 (42%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K ++VG GG GK+    + +  EF + Y  T        V        + +  T   +  
Sbjct: 13  KVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDY 72

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVDIKDR 469
             + +      +  L V F +T   +++    +   ++RV   E IP +L GNK D+ D+
Sbjct: 73  AAIRDNYFRSGEGFLCV-FSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDK 131

Query: 470 K 472
           +
Sbjct: 132 R 132



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQ 333
           ++ ++ DTAGQE +  +RD Y+  G+
Sbjct: 59  VQIDILDTAGQEDYAAIRDNYFRSGE 84


>AE014298-551|AAF45890.1|  201|Drosophila melanogaster CG2849-PC,
           isoform C protein.
          Length = 201

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 28/121 (23%), Positives = 51/121 (42%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K ++VG GG GK+    + +  EF + Y  T        V        + +  T   +  
Sbjct: 13  KVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDY 72

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVDIKDR 469
             + +      +  L V F +T   +++    +   ++RV   E IP +L GNK D+ D+
Sbjct: 73  AAIRDNYFRSGEGFLCV-FSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDK 131

Query: 470 K 472
           +
Sbjct: 132 R 132



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQ 333
           ++ ++ DTAGQE +  +RD Y+  G+
Sbjct: 59  VQIDILDTAGQEDYAAIRDNYFRSGE 84


>AE014298-550|AAF45889.1|  201|Drosophila melanogaster CG2849-PA,
           isoform A protein.
          Length = 201

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 28/121 (23%), Positives = 51/121 (42%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K ++VG GG GK+    + +  EF + Y  T        V        + +  T   +  
Sbjct: 13  KVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDY 72

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVDIKDR 469
             + +      +  L V F +T   +++    +   ++RV   E IP +L GNK D+ D+
Sbjct: 73  AAIRDNYFRSGEGFLCV-FSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDK 131

Query: 470 K 472
           +
Sbjct: 132 R 132



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQ 333
           ++ ++ DTAGQE +  +RD Y+  G+
Sbjct: 59  VQIDILDTAGQEDYAAIRDNYFRSGE 84


>AE014298-549|AAN09102.1|  197|Drosophila melanogaster CG2849-PB,
           isoform B protein.
          Length = 197

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 28/121 (23%), Positives = 51/121 (42%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K ++VG GG GK+    + +  EF + Y  T        V        + +  T   +  
Sbjct: 13  KVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDY 72

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVDIKDR 469
             + +      +  L V F +T   +++    +   ++RV   E IP +L GNK D+ D+
Sbjct: 73  AAIRDNYFRSGEGFLCV-FSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDK 131

Query: 470 K 472
           +
Sbjct: 132 R 132



 Score = 31.1 bits (67), Expect = 1.7
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQ 333
           ++ ++ DTAGQE +  +RD Y+  G+
Sbjct: 59  VQIDILDTAGQEDYAAIRDNYFRSGE 84


>AE013599-2181|AAF58065.1|  264|Drosophila melanogaster CG8418-PA
           protein.
          Length = 264

 Score = 39.5 bits (88), Expect = 0.005
 Identities = 27/129 (20%), Positives = 57/129 (44%), Gaps = 2/129 (1%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           M   +  +K V++GDGG GK+    + ++  F   +  T+           N    + + 
Sbjct: 53  MRGGLRVYKIVILGDGGVGKSAVTLQFVSHSFLDYHDPTIEDSYQQQAVIDNEAALLDIL 112

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL--VRVCEGIPIVLCG 445
            T        + +      +  + + + VT R +++    + + +  VR+ E IP+VL  
Sbjct: 113 DTAGQVEFTAMRDQYMRCGEGFI-ICYSVTDRHSFQEASEYRKLITRVRLSEDIPLVLIA 171

Query: 446 NKVDIKDRK 472
           NKVD++ ++
Sbjct: 172 NKVDLESQR 180


>AY118407-1|AAM48436.1|  282|Drosophila melanogaster RE62293p
           protein.
          Length = 282

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 27/129 (20%), Positives = 57/129 (44%), Gaps = 2/129 (1%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           M   +  +K V++GDGG GK+    + ++  F   +  T+           N    + + 
Sbjct: 53  MRGGLRVYKIVILGDGGVGKSAVTLQFVSHSFLDYHDPTIEDSYQRQAVIDNEAALLDIL 112

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL--VRVCEGIPIVLCG 445
            T        + +      +  + + + VT R +++    + + +  VR+ E IP+VL  
Sbjct: 113 DTAGQVEFTAMRDQYMRCGEGFI-ICYSVTDRHSFQEASEYRKLITRVRLSEDIPLVLIA 171

Query: 446 NKVDIKDRK 472
           NKVD++ ++
Sbjct: 172 NKVDLESQR 180


>AE014298-1056|AAF46271.1|  218|Drosophila melanogaster CG12156-PA
           protein.
          Length = 218

 Score = 38.7 bits (86), Expect = 0.009
 Identities = 29/121 (23%), Positives = 64/121 (52%), Gaps = 5/121 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRG-QFVL-MCGTQPD 286
           F+ +L+GD   GK++ +K    G+F +    T+GV+    +     G Q  L +  T   
Sbjct: 10  FRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDTAGQ 69

Query: 287 KRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPI-VLCGNKVD 457
           +R   +  T + ++++V + +++D+++  +++++P W  +  R  E   P+  L G K+D
Sbjct: 70  ERFRSI--TKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLD 127

Query: 458 I 460
           +
Sbjct: 128 L 128



 Score = 31.9 bits (69), Expect = 0.99
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYY 321
           I+  +WDTAGQE+F  +   YY
Sbjct: 59  IKLQLWDTAGQERFRSITKSYY 80


>M16431-1|AAA28849.1|  195|Drosophila melanogaster protein (
           D.melanogaster (Dmras64B)Dras2 gene, exon 3. ).
          Length = 195

 Score = 38.3 bits (85), Expect = 0.011
 Identities = 29/129 (22%), Positives = 61/129 (47%), Gaps = 6/129 (4%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTT----FVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           M T+K V+VG GG GK+     F++ +   +++     +   + +    H N   F L+ 
Sbjct: 3   MQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDIHNNL-IFYLVL 61

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCG 445
            T   +    + E      +  L ++F +    ++  +P + R ++RV   +  P+++ G
Sbjct: 62  DTAGQEEFSAMREQYMRSGEGFL-LVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVG 120

Query: 446 NKVDIKDRK 472
           NK D+K ++
Sbjct: 121 NKCDLKHQQ 129


>M10804-1|AAA99202.1|  195|Drosophila melanogaster ras protein
           protein.
          Length = 195

 Score = 38.3 bits (85), Expect = 0.011
 Identities = 29/129 (22%), Positives = 61/129 (47%), Gaps = 6/129 (4%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTT----FVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           M T+K V+VG GG GK+     F++ +   +++     +   + +    H N   F L+ 
Sbjct: 3   MQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDIHNNL-IFYLVL 61

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCG 445
            T   +    + E      +  L ++F +    ++  +P + R ++RV   +  P+++ G
Sbjct: 62  DTAGQEEFSAMREQYMRSGEGFL-LVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVG 120

Query: 446 NKVDIKDRK 472
           NK D+K ++
Sbjct: 121 NKCDLKHQQ 129


>AY071340-1|AAL48962.1|  218|Drosophila melanogaster RE37651p
           protein.
          Length = 218

 Score = 38.3 bits (85), Expect = 0.011
 Identities = 29/121 (23%), Positives = 63/121 (52%), Gaps = 5/121 (4%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRG-QFVL-MCGTQPD 286
           F+ +L+GD   GK++ +K    G+F +    T+GV+    +     G Q  L +  T   
Sbjct: 10  FRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDTAGQ 69

Query: 287 KRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIV--LCGNKVD 457
           +R   +  T + ++++V + +++D+++  +++++P W  +  R  E    V  L G K+D
Sbjct: 70  ERFRSI--TKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRSVFALVGCKLD 127

Query: 458 I 460
           +
Sbjct: 128 L 128



 Score = 31.9 bits (69), Expect = 0.99
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYY 321
           I+  +WDTAGQE+F  +   YY
Sbjct: 59  IKLQLWDTAGQERFRSITKSYY 80


>DQ138746-1|ABA86352.1|  171|Drosophila melanogaster CG1956 protein.
          Length = 171

 Score = 37.5 bits (83), Expect = 0.020
 Identities = 25/124 (20%), Positives = 56/124 (45%), Gaps = 2/124 (1%)
 Frame = +2

Query: 125 LVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRSLVV 304
           ++G GG GK+    + +   F +KY  T+       V   +  Q +L             
Sbjct: 1   VLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQV-EVDGQQCMLEILDTAGTEQFTA 59

Query: 305 LETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVDIKDRKVK 478
           +    +       +++ +T++ T+ ++ +    ++RV   + +P+VL GNK D+++ +V 
Sbjct: 60  MRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVV 119

Query: 479 AKTI 490
            K +
Sbjct: 120 GKEL 123


>M16429-1|AAA28847.1|  189|Drosophila melanogaster protein (
           D.melanogaster Dmras85Dgene, exon 3. ).
          Length = 189

 Score = 36.7 bits (81), Expect = 0.035
 Identities = 28/121 (23%), Positives = 53/121 (43%), Gaps = 2/121 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M  +K V+VG GG GK+    + +   F  +Y  T+       V        + +  T  
Sbjct: 1   MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVD 457
            +    + +      +  L ++F V S  +++++  +   + RV   E +P+VL GNK D
Sbjct: 61  QEEYSAMRDQYMRTGEGFL-LVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCD 119

Query: 458 I 460
           +
Sbjct: 120 L 120


>BT023374-1|AAY55790.1|  358|Drosophila melanogaster IP10363p
           protein.
          Length = 358

 Score = 36.7 bits (81), Expect = 0.035
 Identities = 30/123 (24%), Positives = 55/123 (44%), Gaps = 4/123 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPDKR 292
           K + VGD   GKT  V R    +F+  Y AT+GV+     F      + L M  T   +R
Sbjct: 147 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQER 206

Query: 293 SLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIV-LCGNKVDIK 463
              +      +++ +V+ V +D++ + + ++   W    +       P+V L G K D+ 
Sbjct: 207 FRCI--AGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLL 264

Query: 464 DRK 472
            ++
Sbjct: 265 SKE 267


>AY129454-1|AAM76196.1|  280|Drosophila melanogaster RE28276p
           protein.
          Length = 280

 Score = 36.7 bits (81), Expect = 0.035
 Identities = 34/136 (25%), Positives = 64/136 (47%), Gaps = 6/136 (4%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGT 277
           D+   + VL+G  G GK++ VKR L   +  KY AT+  +++   +        V + GT
Sbjct: 3   DLERIRLVLLGGTGVGKSSIVKRFLFKTYTDKYRATV-EDLYNREYDLGGVTLKVDILGT 61

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV---CEGIPIVLCGN 448
             D +    +   +I   +   +++  TS  +++ V     ++       + IPIV+ GN
Sbjct: 62  SGDMQ-FPAMRRLSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQDIPIVIAGN 120

Query: 449 KVDI--KDRKVKAKTI 490
           K D+    R+VK + +
Sbjct: 121 KADLATTHREVKLEEV 136


>AY094888-1|AAM11241.1|  189|Drosophila melanogaster RE53955p
           protein.
          Length = 189

 Score = 36.7 bits (81), Expect = 0.035
 Identities = 28/121 (23%), Positives = 53/121 (43%), Gaps = 2/121 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M  +K V+VG GG GK+    + +   F  +Y  T+       V        + +  T  
Sbjct: 1   MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVD 457
            +    + +      +  L ++F V S  +++++  +   + RV   E +P+VL GNK D
Sbjct: 61  QEEYSAMRDQYMRTGEGFL-LVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCD 119

Query: 458 I 460
           +
Sbjct: 120 L 120


>AY089541-1|AAL90279.1|  189|Drosophila melanogaster LD17536p
           protein.
          Length = 189

 Score = 36.7 bits (81), Expect = 0.035
 Identities = 28/121 (23%), Positives = 53/121 (43%), Gaps = 2/121 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M  +K V+VG GG GK+    + +   F  +Y  T+       V        + +  T  
Sbjct: 1   MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVD 457
            +    + +      +  L ++F V S  +++++  +   + RV   E +P+VL GNK D
Sbjct: 61  QEEYSAMRDQYMRTGEGFL-LVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCD 119

Query: 458 I 460
           +
Sbjct: 120 L 120


>AF186648-1|AAF15514.1|  189|Drosophila melanogaster Ras1 protein.
          Length = 189

 Score = 36.7 bits (81), Expect = 0.035
 Identities = 28/121 (23%), Positives = 53/121 (43%), Gaps = 2/121 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M  +K V+VG GG GK+    + +   F  +Y  T+       V        + +  T  
Sbjct: 1   MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVD 457
            +    + +      +  L ++F V S  +++++  +   + RV   E +P+VL GNK D
Sbjct: 61  QEEYSAMRDQYMRTGEGFL-LVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCD 119

Query: 458 I 460
           +
Sbjct: 120 L 120


>AE014297-953|AAF54388.1|  189|Drosophila melanogaster CG9375-PA
           protein.
          Length = 189

 Score = 36.7 bits (81), Expect = 0.035
 Identities = 28/121 (23%), Positives = 53/121 (43%), Gaps = 2/121 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M  +K V+VG GG GK+    + +   F  +Y  T+       V        + +  T  
Sbjct: 1   MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVD 457
            +    + +      +  L ++F V S  +++++  +   + RV   E +P+VL GNK D
Sbjct: 61  QEEYSAMRDQYMRTGEGFL-LVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCD 119

Query: 458 I 460
           +
Sbjct: 120 L 120


>AE014296-330|AAF47546.1|  305|Drosophila melanogaster CG7980-PA
           protein.
          Length = 305

 Score = 36.7 bits (81), Expect = 0.035
 Identities = 30/123 (24%), Positives = 55/123 (44%), Gaps = 4/123 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPDKR 292
           K + VGD   GKT  V R    +F+  Y AT+GV+     F      + L M  T   +R
Sbjct: 66  KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQER 125

Query: 293 SLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIV-LCGNKVDIK 463
              +      +++ +V+ V +D++ + + ++   W    +       P+V L G K D+ 
Sbjct: 126 FRCI--AGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLL 183

Query: 464 DRK 472
            ++
Sbjct: 184 SKE 186


>BT023330-1|AAY55746.1|  191|Drosophila melanogaster IP10163p
           protein.
          Length = 191

 Score = 36.3 bits (80), Expect = 0.046
 Identities = 30/119 (25%), Positives = 53/119 (44%), Gaps = 4/119 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPDKR 292
           K + VGD   GKT  V R    +F+  Y AT+GV+     F      + L M  T   +R
Sbjct: 64  KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQER 123

Query: 293 SLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIV-LCGNKVDI 460
              +      +++ +V+ V +D++ + + ++   W    +       P+V L G K D+
Sbjct: 124 FRCI--AGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADL 180


>BT023274-1|AAY55690.1|  205|Drosophila melanogaster IP10063p
           protein.
          Length = 205

 Score = 36.3 bits (80), Expect = 0.046
 Identities = 30/119 (25%), Positives = 53/119 (44%), Gaps = 4/119 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVL-MCGTQPDKR 292
           K + VGD   GKT  V R    +F+  Y AT+GV+     F      + L M  T   +R
Sbjct: 78  KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQER 137

Query: 293 SLVVLETDTIFKD-NVLSVMFDVTSRVTYKNVPNWHRDLVRV-CEGIPIV-LCGNKVDI 460
              +      +++ +V+ V +D++ + + ++   W    +       P+V L G K D+
Sbjct: 138 FRCI--AGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADL 194


>AY061218-1|AAL28766.1|  252|Drosophila melanogaster LD16331p
           protein.
          Length = 252

 Score = 36.3 bits (80), Expect = 0.046
 Identities = 27/124 (21%), Positives = 55/124 (44%), Gaps = 1/124 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +LVGD   GK   +        E  + +    +   ++    R +  L   T    R 
Sbjct: 10  KVLLVGDSDVGKHEILSNLEDPSTESPFCSGNAYKTTTILLEGKRVKLQLW-DTSGQGRF 68

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIK-DRK 472
             ++ + +     ++ V +D+T++ ++  +  W +++     GIP VL GN++ +   R+
Sbjct: 69  CTIIRSYSRGAQGIILV-YDITNKWSFDGIDRWLKEVDEHAPGIPKVLVGNRLHLAFKRQ 127

Query: 473 VKAK 484
           V AK
Sbjct: 128 VAAK 131


>AF233585-1|AAF60290.1|   21|Drosophila melanogaster Ran10A protein.
          Length = 21

 Score = 36.3 bits (80), Expect = 0.046
 Identities = 14/15 (93%), Positives = 15/15 (100%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGT 145
           D+PTFKCVLVGDGGT
Sbjct: 7   DIPTFKCVLVGDGGT 21


>AE014298-1768|AAF48164.2|  255|Drosophila melanogaster CG1900-PA,
           isoform A protein.
          Length = 255

 Score = 36.3 bits (80), Expect = 0.046
 Identities = 27/124 (21%), Positives = 55/124 (44%), Gaps = 1/124 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +LVGD   GK   +        E  + +    +   ++    R +  L   T    R 
Sbjct: 13  KVLLVGDSDVGKHEILSNLEDPSTESPFCSGNAYKTTTILLEGKRVKLQLW-DTSGQGRF 71

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDIK-DRK 472
             ++ + +     ++ V +D+T++ ++  +  W +++     GIP VL GN++ +   R+
Sbjct: 72  CTIIRSYSRGAQGIILV-YDITNKWSFDGIDRWLKEVDEHAPGIPKVLVGNRLHLAFKRQ 130

Query: 473 VKAK 484
           V AK
Sbjct: 131 VAAK 134


>X02200-1|CAA26131.1|  182|Drosophila melanogaster protein (
           Drosophila Dras3 gene. ).
          Length = 182

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 30/132 (22%), Positives = 55/132 (41%), Gaps = 3/132 (2%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M  +K V++G GG GK+    + +   F +KY  T+       V   N  Q +L      
Sbjct: 1   MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQV-KVNERQCMLEIVNTA 59

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYK-NVPNWHRDLVRV--CEGIPIVLCGNKV 454
                  +    ++  N     +   SR   +  +      ++RV   + +P+VL GNK 
Sbjct: 60  GTEQFTAMRN--LYMKNGSDSCWSTRSRRNRRLTICRTREQILRVKDTDDVPMVLVGNKC 117

Query: 455 DIKDRKVKAKTI 490
           D+++ +V  K +
Sbjct: 118 DLEEERVVGKEL 129


>AY121695-1|AAM52022.1|  101|Drosophila melanogaster RE66843p
           protein.
          Length = 101

 Score = 35.9 bits (79), Expect = 0.061
 Identities = 13/36 (36%), Positives = 23/36 (63%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE 220
           FK +L+GD G GK+  + R     + + Y++T+GV+
Sbjct: 12  FKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVD 47


>K01960-1|AAA28846.1|  189|Drosophila melanogaster protein (
           D.melanogaster chromosome3 locus 85D Dras1 gene,
           complete. ).
          Length = 189

 Score = 35.5 bits (78), Expect = 0.081
 Identities = 26/121 (21%), Positives = 53/121 (43%), Gaps = 2/121 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M  +K V+VG GG GK+    + +   F  +Y  T+        F       + +  T  
Sbjct: 1   MTEYKLVVVGPGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQRFIDGETCLLDILDTAG 60

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL--VRVCEGIPIVLCGNKVD 457
            +    + +      +  L ++F + S  +++++  +   +  V+  E +P+VL GNK D
Sbjct: 61  QEEYSAMRDQYMRTGEGFL-LVFAINSAKSFEDIGTYREQIKHVKDAEEVPMVLAGNKCD 119

Query: 458 I 460
           +
Sbjct: 120 L 120


>U15967-3|AAB60243.1|  192|Drosophila melanogaster small GTP binding
           protein protein.
          Length = 192

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 25/125 (20%), Positives = 54/125 (43%), Gaps = 2/125 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M T+K V+VG GG GK+    + +   F   Y  T+  + +    + +     L      
Sbjct: 3   MQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTI-EDSYTKQCNIDDVPAKLDILDTA 61

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVD 457
            +     +    +       ++F +    ++  +P + R ++RV   +  P+++ GNK D
Sbjct: 62  GQEEFSAMREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCD 121

Query: 458 IKDRK 472
           +K ++
Sbjct: 122 LKHQQ 126


>AY119135-1|AAM50995.1|  192|Drosophila melanogaster RE36103p
           protein.
          Length = 192

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 25/125 (20%), Positives = 54/125 (43%), Gaps = 2/125 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M T+K V+VG GG GK+    + +   F   Y  T+  + +    + +     L      
Sbjct: 3   MQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTI-EDSYTKQCNIDDVPAKLDILDTA 61

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVD 457
            +     +    +       ++F +    ++  +P + R ++RV   +  P+++ GNK D
Sbjct: 62  GQEEFSAMREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCD 121

Query: 458 IKDRK 472
           +K ++
Sbjct: 122 LKHQQ 126


>AY051710-1|AAK93134.1|  745|Drosophila melanogaster LD24835p
           protein.
          Length = 745

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 32/142 (22%), Positives = 65/142 (45%), Gaps = 17/142 (11%)
 Frame = +2

Query: 89  KMADDMP---TFKCVLVGDGGTGKTTFV-----KRHLT-GEFEKKYVATL-GVEVHPLVF 238
           KM ++ P     KCVLVGD   GKT  +      +H++  +    +V T+  ++ + +  
Sbjct: 3   KMDNEQPHQELVKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYK 62

Query: 239 HTNRGQFVLMCGTQPDKRSLVVL---ETDTIF---KDNVLSVMFDVTSRVTYKNVPN-WH 397
                 + ++ G     R        + D  F   + +V+ + F + S ++ +N    W+
Sbjct: 63  DVLERSWEVVDGVNVSLRLWDTFGDHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWY 122

Query: 398 RDLVRVCEGIPIVLCGNKVDIK 463
            ++ R C  +P++L G K D++
Sbjct: 123 PEIRRFCPDVPVILVGCKNDLR 144


>AF217287-1|AAF44065.1|  745|Drosophila melanogaster G protein
           RhoBTB protein.
          Length = 745

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 32/142 (22%), Positives = 65/142 (45%), Gaps = 17/142 (11%)
 Frame = +2

Query: 89  KMADDMP---TFKCVLVGDGGTGKTTFV-----KRHLT-GEFEKKYVATL-GVEVHPLVF 238
           KM ++ P     KCVLVGD   GKT  +      +H++  +    +V T+  ++ + +  
Sbjct: 3   KMDNEQPHQELVKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYK 62

Query: 239 HTNRGQFVLMCGTQPDKRSLVVL---ETDTIF---KDNVLSVMFDVTSRVTYKNVPN-WH 397
                 + ++ G     R        + D  F   + +V+ + F + S ++ +N    W+
Sbjct: 63  DVLERSWEVVDGVNVSLRLWDTFGDHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWY 122

Query: 398 RDLVRVCEGIPIVLCGNKVDIK 463
            ++ R C  +P++L G K D++
Sbjct: 123 PEIRRFCPDVPVILVGCKNDLR 144


>AE014296-3345|AAF51585.3|  745|Drosophila melanogaster CG5701-PA
           protein.
          Length = 745

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 32/142 (22%), Positives = 65/142 (45%), Gaps = 17/142 (11%)
 Frame = +2

Query: 89  KMADDMP---TFKCVLVGDGGTGKTTFV-----KRHLT-GEFEKKYVATL-GVEVHPLVF 238
           KM ++ P     KCVLVGD   GKT  +      +H++  +    +V T+  ++ + +  
Sbjct: 3   KMDNEQPHQELVKCVLVGDTAVGKTRLICARACNKHVSLSQLLSTHVPTVWAIDQYRIYK 62

Query: 239 HTNRGQFVLMCGTQPDKRSLVVL---ETDTIF---KDNVLSVMFDVTSRVTYKNVPN-WH 397
                 + ++ G     R        + D  F   + +V+ + F + S ++ +N    W+
Sbjct: 63  DVLERSWEVVDGVNVSLRLWDTFGDHDKDRRFAYGRSDVVLLCFSIASPISLRNCKMMWY 122

Query: 398 RDLVRVCEGIPIVLCGNKVDIK 463
            ++ R C  +P++L G K D++
Sbjct: 123 PEIRRFCPDVPVILVGCKNDLR 144


>AE014296-774|AAF47845.2|  192|Drosophila melanogaster CG1167-PA
           protein.
          Length = 192

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 25/125 (20%), Positives = 54/125 (43%), Gaps = 2/125 (1%)
 Frame = +2

Query: 104 MPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQP 283
           M T+K V+VG GG GK+    + +   F   Y  T+  + +    + +     L      
Sbjct: 3   MQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTI-EDSYTKQCNIDDVPAKLDILDTA 61

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVD 457
            +     +    +       ++F +    ++  +P + R ++RV   +  P+++ GNK D
Sbjct: 62  GQEEFSAMREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCD 121

Query: 458 IKDRK 472
           +K ++
Sbjct: 122 LKHQQ 126


>AE013599-257|AAF57410.3|  280|Drosophila melanogaster CG30158-PA
           protein.
          Length = 280

 Score = 34.7 bits (76), Expect = 0.14
 Identities = 33/136 (24%), Positives = 63/136 (46%), Gaps = 6/136 (4%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGT 277
           D+   + VL+G  G GK++ VKR L   +  KY AT+  +++   +        V +  T
Sbjct: 3   DLERIRLVLLGGAGVGKSSIVKRFLFKTYTDKYRATV-EDLYNREYDLGGVTLKVDILDT 61

Query: 278 QPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRV---CEGIPIVLCGN 448
             D +    +   +I   +   +++  TS  +++ V     ++       + IPIV+ GN
Sbjct: 62  SGDMQ-FPAMRRLSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQDIPIVIAGN 120

Query: 449 KVDI--KDRKVKAKTI 490
           K D+    R+VK + +
Sbjct: 121 KADLATTHREVKLEEV 136


>BT011477-1|AAR99135.1|  740|Drosophila melanogaster RE10036p
           protein.
          Length = 740

 Score = 33.9 bits (74), Expect = 0.25
 Identities = 14/36 (38%), Positives = 22/36 (61%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE 220
           ++ V++GD G GKT  V + +T E+   Y A+L  E
Sbjct: 527 YRVVMLGDAGVGKTALVNQFMTSEYMHTYDASLDDE 562


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 37,546,553
Number of Sequences: 53049
Number of extensions: 845734
Number of successful extensions: 3157
Number of sequences better than 10.0: 284
Number of HSP's better than 10.0 without gapping: 2605
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2859
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3540671772
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -