SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20002
         (732 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY060758-1|AAL28306.1|  178|Drosophila melanogaster GH20904p pro...    37   0.025
AE013599-1764|AAF58336.1|  178|Drosophila melanogaster CG6305-PA...    37   0.025
AY071231-1|AAL48853.1|  217|Drosophila melanogaster RE26879p pro...    37   0.033
AE013599-2993|AAF57484.2|  217|Drosophila melanogaster CG9036-PA...    37   0.033
AE013599-2342|AAF57953.1|  620|Drosophila melanogaster CG15920-P...    37   0.033
AY071448-1|AAL49070.1|  815|Drosophila melanogaster RE53044p pro...    36   0.075
AE013599-1762|AAF58339.2|  815|Drosophila melanogaster CG13338-P...    36   0.075
BT022412-1|AAY54828.1|  424|Drosophila melanogaster IP11572p pro...    33   0.53 
BT022352-1|AAY54768.1|  424|Drosophila melanogaster IP11272p pro...    33   0.53 
BT022288-1|AAY54704.1|  424|Drosophila melanogaster IP11372p pro...    33   0.53 
BT022236-1|AAY54652.1|  424|Drosophila melanogaster IP11472p pro...    33   0.53 
AE014296-3164|AAF49151.1|  401|Drosophila melanogaster CG9295-PB...    33   0.53 
AY061158-1|AAL28706.1|  180|Drosophila melanogaster LD12613p pro...    32   0.70 
AE014296-371|AAF47580.1|  180|Drosophila melanogaster CG1919-PA ...    32   0.70 
AM294620-1|CAL26618.1|  204|Drosophila melanogaster CG9283 protein.    31   1.2  
AM294619-1|CAL26617.1|  204|Drosophila melanogaster CG9283 protein.    31   1.2  
AM294618-1|CAL26616.1|  204|Drosophila melanogaster CG9283 protein.    31   1.2  
AM294617-1|CAL26615.1|  204|Drosophila melanogaster CG9283 protein.    31   1.2  
AM294616-1|CAL26614.1|  204|Drosophila melanogaster CG9283 protein.    31   1.2  
AM294614-1|CAL26612.1|  204|Drosophila melanogaster CG9283 protein.    31   1.2  
AM294613-1|CAL26611.1|  204|Drosophila melanogaster CG9283 protein.    31   1.2  
AM294612-1|CAL26610.1|  204|Drosophila melanogaster CG9283 protein.    31   1.2  
AM294611-1|CAL26609.1|  204|Drosophila melanogaster CG9283 protein.    31   1.2  
AM294610-1|CAL26608.1|  204|Drosophila melanogaster CG9283 protein.    31   1.2  
AM294609-1|CAL26607.1|  204|Drosophila melanogaster CG9283 protein.    31   1.2  
AE014296-3162|AAF49153.1|  204|Drosophila melanogaster CG9283-PA...    31   1.2  
AM294615-1|CAL26613.1|  204|Drosophila melanogaster CG9283 protein.    31   1.6  
BT016066-1|AAV36951.1|  138|Drosophila melanogaster LP12967p pro...    31   2.1  
AE014296-1422|AAF50443.2|  407|Drosophila melanogaster CG7072-PA...    31   2.1  
U35816-4|AAB09051.1| 1972|Drosophila melanogaster nonmuscle myos...    30   3.7  
U35816-3|AAB09050.1| 2012|Drosophila melanogaster nonmuscle myos...    30   3.7  
U35816-2|AAB09048.1| 2017|Drosophila melanogaster nonmuscle myos...    30   3.7  
U35816-1|AAB09049.1| 2057|Drosophila melanogaster nonmuscle myos...    30   3.7  
M35012-1|AAA28713.1| 1972|Drosophila melanogaster protein ( D.me...    30   3.7  
BT011451-1|AAR99109.1|  340|Drosophila melanogaster RE37955p pro...    30   3.7  
AE014134-1758|AAN10718.1|  340|Drosophila melanogaster CG33302-P...    30   3.7  
AE013599-4011|AAM70805.1| 2011|Drosophila melanogaster CG15792-P...    30   3.7  
AE013599-4010|AAX52688.1| 1971|Drosophila melanogaster CG15792-P...    30   3.7  
AE013599-4009|AAF47311.1| 2056|Drosophila melanogaster CG15792-P...    30   3.7  
AE013599-4008|AAX52687.1| 2016|Drosophila melanogaster CG15792-P...    30   3.7  
AE013599-113|AAF57305.2|  399|Drosophila melanogaster CG12754-PA...    30   3.7  
BT024400-1|ABC86462.1|  162|Drosophila melanogaster IP05056p pro...    29   4.9  
BT010217-1|AAQ23535.1|  194|Drosophila melanogaster RH05746p pro...    29   4.9  
AF156228-1|AAD43808.1|  157|Drosophila melanogaster salivary gla...    29   4.9  
AE014296-1423|AAF50442.1|  162|Drosophila melanogaster CG7076-PA...    29   4.9  
AE014296-370|AAF47579.2|  194|Drosophila melanogaster CG13935-PA...    29   4.9  
BT024343-1|ABC86405.1|  266|Drosophila melanogaster IP09562p pro...    29   6.5  
AE014296-1421|AAF50444.1|  266|Drosophila melanogaster CG13670-P...    29   6.5  
AE014134-808|AAF50957.4| 1286|Drosophila melanogaster CG3047-PA ...    29   6.5  
BT023126-1|AAY55542.1|  245|Drosophila melanogaster IP08764p pro...    29   8.6  
BT023042-1|AAY55458.1|  245|Drosophila melanogaster IP08564p pro...    29   8.6  
AY069040-1|AAL39185.1|  429|Drosophila melanogaster GH03623p pro...    29   8.6  
AE014297-2676|AAF55678.2|  245|Drosophila melanogaster CG6240-PA...    29   8.6  
AE014296-3165|AAF49150.3| 1242|Drosophila melanogaster CG9299-PA...    29   8.6  
AE014296-2717|AAF49476.1|  429|Drosophila melanogaster CG4784-PA...    29   8.6  

>AY060758-1|AAL28306.1|  178|Drosophila melanogaster GH20904p
           protein.
          Length = 178

 Score = 37.1 bits (82), Expect = 0.025
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +3

Query: 267 AEGKVVGG-YRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNANPFGQG 407
           ++G VV G YRV +PDGR   V YT    +G+   +S++  A  + QG
Sbjct: 111 SDGDVVTGEYRVQMPDGRTQIVRYTADWKTGYHADVSYEGEAT-YPQG 157


>AE013599-1764|AAF58336.1|  178|Drosophila melanogaster CG6305-PA
           protein.
          Length = 178

 Score = 37.1 bits (82), Expect = 0.025
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +3

Query: 267 AEGKVVGG-YRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNANPFGQG 407
           ++G VV G YRV +PDGR   V YT    +G+   +S++  A  + QG
Sbjct: 111 SDGDVVTGEYRVQMPDGRTQIVRYTADWKTGYHADVSYEGEAT-YPQG 157


>AY071231-1|AAL48853.1|  217|Drosophila melanogaster RE26879p
           protein.
          Length = 217

 Score = 36.7 bits (81), Expect = 0.033
 Identities = 19/42 (45%), Positives = 23/42 (54%)
 Frame = +3

Query: 282 VGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNANPFGQG 407
           VG Y VLLPDGR   VEY     +G+ P I ++   N  G G
Sbjct: 155 VGRYYVLLPDGRKQIVEYEAD-QNGYRPTIRYEQVGNGNGNG 195



 Score = 34.7 bits (76), Expect = 0.13
 Identities = 15/25 (60%), Positives = 17/25 (68%)
 Frame = +2

Query: 176 EEQYPPMPYEYKYDVEDPEKTLYFG 250
           EEQY P  YE+KYDV+D E    FG
Sbjct: 120 EEQYGPAKYEFKYDVQDYESGNDFG 144


>AE013599-2993|AAF57484.2|  217|Drosophila melanogaster CG9036-PA
           protein.
          Length = 217

 Score = 36.7 bits (81), Expect = 0.033
 Identities = 19/42 (45%), Positives = 23/42 (54%)
 Frame = +3

Query: 282 VGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNANPFGQG 407
           VG Y VLLPDGR   VEY     +G+ P I ++   N  G G
Sbjct: 155 VGRYYVLLPDGRKQIVEYEAD-QNGYRPTIRYEQVGNGNGNG 195



 Score = 34.7 bits (76), Expect = 0.13
 Identities = 15/25 (60%), Positives = 17/25 (68%)
 Frame = +2

Query: 176 EEQYPPMPYEYKYDVEDPEKTLYFG 250
           EEQY P  YE+KYDV+D E    FG
Sbjct: 120 EEQYGPAKYEFKYDVQDYESGNDFG 144


>AE013599-2342|AAF57953.1|  620|Drosophila melanogaster CG15920-PA,
           isoform A protein.
          Length = 620

 Score = 36.7 bits (81), Expect = 0.033
 Identities = 17/36 (47%), Positives = 22/36 (61%)
 Frame = +3

Query: 285 GGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           G Y VLLPDGR   VEY      G+ P+I ++ +AN
Sbjct: 373 GQYNVLLPDGRKQIVEYEAD-QQGYRPQIRYEGDAN 407


>AY071448-1|AAL49070.1|  815|Drosophila melanogaster RE53044p
           protein.
          Length = 815

 Score = 35.5 bits (78), Expect = 0.075
 Identities = 17/39 (43%), Positives = 22/39 (56%)
 Frame = +3

Query: 264 DAEGKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFD 380
           D  G   G Y +LLPDGR+  V Y    D+GF   +SF+
Sbjct: 773 DLHGVTRGQYHILLPDGRIQNVIYHAD-DTGFHADVSFE 810


>AE013599-1762|AAF58339.2|  815|Drosophila melanogaster CG13338-PA
           protein.
          Length = 815

 Score = 35.5 bits (78), Expect = 0.075
 Identities = 17/39 (43%), Positives = 22/39 (56%)
 Frame = +3

Query: 264 DAEGKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFD 380
           D  G   G Y +LLPDGR+  V Y    D+GF   +SF+
Sbjct: 773 DLHGVTRGQYHILLPDGRIQNVIYHAD-DTGFHADVSFE 810


>BT022412-1|AAY54828.1|  424|Drosophila melanogaster IP11572p
           protein.
          Length = 424

 Score = 32.7 bits (71), Expect = 0.53
 Identities = 16/32 (50%), Positives = 18/32 (56%)
 Frame = +3

Query: 264 DAEGKVVGGYRVLLPDGRLMTVEYTVQGDSGF 359
           D +G V G Y VL PDG + TV YT     GF
Sbjct: 78  DGDG-VKGHYSVLEPDGSIRTVHYTADAKKGF 108


>BT022352-1|AAY54768.1|  424|Drosophila melanogaster IP11272p
           protein.
          Length = 424

 Score = 32.7 bits (71), Expect = 0.53
 Identities = 16/32 (50%), Positives = 18/32 (56%)
 Frame = +3

Query: 264 DAEGKVVGGYRVLLPDGRLMTVEYTVQGDSGF 359
           D +G V G Y VL PDG + TV YT     GF
Sbjct: 78  DGDG-VKGHYSVLEPDGSIRTVHYTADAKKGF 108


>BT022288-1|AAY54704.1|  424|Drosophila melanogaster IP11372p
           protein.
          Length = 424

 Score = 32.7 bits (71), Expect = 0.53
 Identities = 16/32 (50%), Positives = 18/32 (56%)
 Frame = +3

Query: 264 DAEGKVVGGYRVLLPDGRLMTVEYTVQGDSGF 359
           D +G V G Y VL PDG + TV YT     GF
Sbjct: 78  DGDG-VKGHYSVLEPDGSIRTVHYTADAKKGF 108


>BT022236-1|AAY54652.1|  424|Drosophila melanogaster IP11472p
           protein.
          Length = 424

 Score = 32.7 bits (71), Expect = 0.53
 Identities = 16/32 (50%), Positives = 18/32 (56%)
 Frame = +3

Query: 264 DAEGKVVGGYRVLLPDGRLMTVEYTVQGDSGF 359
           D +G V G Y VL PDG + TV YT     GF
Sbjct: 78  DGDG-VKGHYSVLEPDGSIRTVHYTADAKKGF 108


>AE014296-3164|AAF49151.1|  401|Drosophila melanogaster CG9295-PB
           protein.
          Length = 401

 Score = 32.7 bits (71), Expect = 0.53
 Identities = 16/32 (50%), Positives = 18/32 (56%)
 Frame = +3

Query: 264 DAEGKVVGGYRVLLPDGRLMTVEYTVQGDSGF 359
           D +G V G Y VL PDG + TV YT     GF
Sbjct: 55  DGDG-VKGHYSVLEPDGSIRTVHYTADAKKGF 85


>AY061158-1|AAL28706.1|  180|Drosophila melanogaster LD12613p
           protein.
          Length = 180

 Score = 32.3 bits (70), Expect = 0.70
 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
 Frame = +3

Query: 270 EGKVV-GGYRVLLPDGRLMTVEYTVQGDSGF 359
           +G VV G Y ++ PDG + TVEYT    +GF
Sbjct: 76  DGDVVKGSYSLVEPDGSVRTVEYTADDHNGF 106


>AE014296-371|AAF47580.1|  180|Drosophila melanogaster CG1919-PA
           protein.
          Length = 180

 Score = 32.3 bits (70), Expect = 0.70
 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
 Frame = +3

Query: 270 EGKVV-GGYRVLLPDGRLMTVEYTVQGDSGF 359
           +G VV G Y ++ PDG + TVEYT    +GF
Sbjct: 76  DGDVVKGSYSLVEPDGSVRTVEYTADDHNGF 106


>AM294620-1|CAL26618.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +3

Query: 276 KVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           KV GGY +   DGR   VEYT    +GF   +    +A+
Sbjct: 125 KVKGGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHAS 163


>AM294619-1|CAL26617.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +3

Query: 276 KVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           KV GGY +   DGR   VEYT    +GF   +    +A+
Sbjct: 125 KVKGGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHAS 163


>AM294618-1|CAL26616.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +3

Query: 276 KVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           KV GGY +   DGR   VEYT    +GF   +    +A+
Sbjct: 125 KVKGGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHAS 163


>AM294617-1|CAL26615.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +3

Query: 276 KVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           KV GGY +   DGR   VEYT    +GF   +    +A+
Sbjct: 125 KVKGGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHAS 163


>AM294616-1|CAL26614.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +3

Query: 276 KVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           KV GGY +   DGR   VEYT    +GF   +    +A+
Sbjct: 125 KVKGGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHAS 163


>AM294614-1|CAL26612.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +3

Query: 276 KVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           KV GGY +   DGR   VEYT    +GF   +    +A+
Sbjct: 125 KVKGGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHAS 163


>AM294613-1|CAL26611.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +3

Query: 276 KVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           KV GGY +   DGR   VEYT    +GF   +    +A+
Sbjct: 125 KVKGGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHAS 163


>AM294612-1|CAL26610.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +3

Query: 276 KVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           KV GGY +   DGR   VEYT    +GF   +    +A+
Sbjct: 125 KVKGGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHAS 163


>AM294611-1|CAL26609.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +3

Query: 276 KVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           KV GGY +   DGR   VEYT    +GF   +    +A+
Sbjct: 125 KVKGGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHAS 163


>AM294610-1|CAL26608.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +3

Query: 276 KVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           KV GGY +   DGR   VEYT    +GF   +    +A+
Sbjct: 125 KVKGGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHAS 163


>AM294609-1|CAL26607.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +3

Query: 276 KVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           KV GGY +   DGR   VEYT    +GF   +    +A+
Sbjct: 125 KVKGGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHAS 163


>AE014296-3162|AAF49153.1|  204|Drosophila melanogaster CG9283-PA
           protein.
          Length = 204

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +3

Query: 276 KVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           KV GGY +   DGR   VEYT    +GF   +    +A+
Sbjct: 125 KVKGGYTMKEADGRTRIVEYTADSHNGFQATVKHVGHAS 163


>AM294615-1|CAL26613.1|  204|Drosophila melanogaster CG9283 protein.
          Length = 204

 Score = 31.1 bits (67), Expect = 1.6
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +3

Query: 276 KVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNAN 392
           KV GGY +   DGR   VEYT    +GF   +    +A+
Sbjct: 125 KVKGGYTMKEADGRTRIVEYTAYSHNGFQATVKHVGHAS 163


>BT016066-1|AAV36951.1|  138|Drosophila melanogaster LP12967p
           protein.
          Length = 138

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%)
 Frame = +3

Query: 264 DAEGKVVGG-YRVLLPDGRLMTVEYTVQGDSGF 359
           + +G VV G Y ++ PDG + TV+YT    +GF
Sbjct: 72  ERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGF 104


>AE014296-1422|AAF50443.2|  407|Drosophila melanogaster CG7072-PA
           protein.
          Length = 407

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%)
 Frame = +3

Query: 264 DAEGKVVGG-YRVLLPDGRLMTVEYTVQGDSGF 359
           + +G VV G Y ++ PDG + TV+YT    +GF
Sbjct: 111 ERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGF 143



 Score = 28.7 bits (61), Expect = 8.6
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = +3

Query: 273 GKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKI 371
           G + G Y    PDGR+   +Y  + D G+  +I
Sbjct: 182 GSIQGSYGYARPDGRIEVTKYMAKEDGGYSAQI 214


>U35816-4|AAB09051.1| 1972|Drosophila melanogaster nonmuscle
           myosin-II heavy chain protein.
          Length = 1972

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 13/43 (30%), Positives = 28/43 (65%)
 Frame = -2

Query: 335 VLDRHESTVRKKHSVPPNDFAFSVTDSSRRSTMSSQDLQRRIC 207
           +++R++    K+H VPP+   F++TDS+ R+ +  ++ Q  +C
Sbjct: 140 IMERYKGI--KRHEVPPH--VFAITDSAYRNMLGDREDQSILC 178


>U35816-3|AAB09050.1| 2012|Drosophila melanogaster nonmuscle
           myosin-II heavy chain protein.
          Length = 2012

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 13/43 (30%), Positives = 28/43 (65%)
 Frame = -2

Query: 335 VLDRHESTVRKKHSVPPNDFAFSVTDSSRRSTMSSQDLQRRIC 207
           +++R++    K+H VPP+   F++TDS+ R+ +  ++ Q  +C
Sbjct: 140 IMERYKGI--KRHEVPPH--VFAITDSAYRNMLGDREDQSILC 178


>U35816-2|AAB09048.1| 2017|Drosophila melanogaster nonmuscle
           myosin-II heavy chain protein.
          Length = 2017

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 13/43 (30%), Positives = 28/43 (65%)
 Frame = -2

Query: 335 VLDRHESTVRKKHSVPPNDFAFSVTDSSRRSTMSSQDLQRRIC 207
           +++R++    K+H VPP+   F++TDS+ R+ +  ++ Q  +C
Sbjct: 185 IMERYKGI--KRHEVPPH--VFAITDSAYRNMLGDREDQSILC 223


>U35816-1|AAB09049.1| 2057|Drosophila melanogaster nonmuscle
           myosin-II heavy chain protein.
          Length = 2057

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 13/43 (30%), Positives = 28/43 (65%)
 Frame = -2

Query: 335 VLDRHESTVRKKHSVPPNDFAFSVTDSSRRSTMSSQDLQRRIC 207
           +++R++    K+H VPP+   F++TDS+ R+ +  ++ Q  +C
Sbjct: 185 IMERYKGI--KRHEVPPH--VFAITDSAYRNMLGDREDQSILC 223


>M35012-1|AAA28713.1| 1972|Drosophila melanogaster protein (
           D.melanogaster non-musclemyosin heavy chain mRNA. ).
          Length = 1972

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 13/43 (30%), Positives = 28/43 (65%)
 Frame = -2

Query: 335 VLDRHESTVRKKHSVPPNDFAFSVTDSSRRSTMSSQDLQRRIC 207
           +++R++    K+H VPP+   F++TDS+ R+ +  ++ Q  +C
Sbjct: 140 IMERYKGI--KRHEVPPH--VFAITDSAYRNMLGDREDQSILC 178


>BT011451-1|AAR99109.1|  340|Drosophila melanogaster RE37955p
           protein.
          Length = 340

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 15/29 (51%), Positives = 16/29 (55%)
 Frame = +3

Query: 273 GKVVGGYRVLLPDGRLMTVEYTVQGDSGF 359
           G VVG Y VL  DG   TV YT    +GF
Sbjct: 159 GNVVGSYSVLDADGFKRTVTYTADDINGF 187


>AE014134-1758|AAN10718.1|  340|Drosophila melanogaster CG33302-PA
           protein.
          Length = 340

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 15/29 (51%), Positives = 16/29 (55%)
 Frame = +3

Query: 273 GKVVGGYRVLLPDGRLMTVEYTVQGDSGF 359
           G VVG Y VL  DG   TV YT    +GF
Sbjct: 159 GNVVGSYSVLDADGFKRTVTYTADDINGF 187


>AE013599-4011|AAM70805.1| 2011|Drosophila melanogaster CG15792-PB,
           isoform B protein.
          Length = 2011

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 13/43 (30%), Positives = 28/43 (65%)
 Frame = -2

Query: 335 VLDRHESTVRKKHSVPPNDFAFSVTDSSRRSTMSSQDLQRRIC 207
           +++R++    K+H VPP+   F++TDS+ R+ +  ++ Q  +C
Sbjct: 139 IMERYKGI--KRHEVPPH--VFAITDSAYRNMLGDREDQSILC 177


>AE013599-4010|AAX52688.1| 1971|Drosophila melanogaster CG15792-PC,
           isoform C protein.
          Length = 1971

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 13/43 (30%), Positives = 28/43 (65%)
 Frame = -2

Query: 335 VLDRHESTVRKKHSVPPNDFAFSVTDSSRRSTMSSQDLQRRIC 207
           +++R++    K+H VPP+   F++TDS+ R+ +  ++ Q  +C
Sbjct: 139 IMERYKGI--KRHEVPPH--VFAITDSAYRNMLGDREDQSILC 177


>AE013599-4009|AAF47311.1| 2056|Drosophila melanogaster CG15792-PA,
           isoform A protein.
          Length = 2056

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 13/43 (30%), Positives = 28/43 (65%)
 Frame = -2

Query: 335 VLDRHESTVRKKHSVPPNDFAFSVTDSSRRSTMSSQDLQRRIC 207
           +++R++    K+H VPP+   F++TDS+ R+ +  ++ Q  +C
Sbjct: 184 IMERYKGI--KRHEVPPH--VFAITDSAYRNMLGDREDQSILC 222


>AE013599-4008|AAX52687.1| 2016|Drosophila melanogaster CG15792-PD,
           isoform D protein.
          Length = 2016

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 13/43 (30%), Positives = 28/43 (65%)
 Frame = -2

Query: 335 VLDRHESTVRKKHSVPPNDFAFSVTDSSRRSTMSSQDLQRRIC 207
           +++R++    K+H VPP+   F++TDS+ R+ +  ++ Q  +C
Sbjct: 184 IMERYKGI--KRHEVPPH--VFAITDSAYRNMLGDREDQSILC 222


>AE013599-113|AAF57305.2|  399|Drosophila melanogaster CG12754-PA
           protein.
          Length = 399

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +3

Query: 483 TIFKRFFFRSFT*-LTILQLNFVSGIMSVIVFFLFIKIISLERF*FCGLCLL 635
           TIF +F         T++ + F S I + I  F+F+  I L+ F FC  C L
Sbjct: 268 TIFTQFLLIGLVLGFTLINVFFFSDIWTGIASFMFVITILLQTFPFCYTCNL 319


>BT024400-1|ABC86462.1|  162|Drosophila melanogaster IP05056p
           protein.
          Length = 162

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +3

Query: 279 VVGGYRVLLPDGRLMTVEYTVQGDSGF 359
           V G Y ++ PDG + TV+YT    +GF
Sbjct: 115 VKGQYSLVEPDGSIRTVDYTADKHNGF 141


>BT010217-1|AAQ23535.1|  194|Drosophila melanogaster RH05746p
           protein.
          Length = 194

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%)
 Frame = +3

Query: 270 EGKVVGG-YRVLLPDGRLMTVEYTVQGDSGF 359
           +G VV G Y ++ PDG + TV+YT     GF
Sbjct: 57  DGDVVKGQYSLVEPDGSIRTVDYTADSIHGF 87


>AF156228-1|AAD43808.1|  157|Drosophila melanogaster salivary gland
           secretion protein protein.
          Length = 157

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
 Frame = -3

Query: 361 TKPLSPCTVYSTVMSLPSGRSTRYP-PTTLPSASPIR 254
           T P S  T  ++  +  + RST  P PTT PSASP R
Sbjct: 5   TTPRSTTTTTTSRPTTTTPRSTTIPCPTTTPSASPTR 41


>AE014296-1423|AAF50442.1|  162|Drosophila melanogaster CG7076-PA
           protein.
          Length = 162

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +3

Query: 279 VVGGYRVLLPDGRLMTVEYTVQGDSGF 359
           V G Y ++ PDG + TV+YT    +GF
Sbjct: 115 VKGQYSLVEPDGSIRTVDYTADKHNGF 141


>AE014296-370|AAF47579.2|  194|Drosophila melanogaster CG13935-PA
           protein.
          Length = 194

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%)
 Frame = +3

Query: 270 EGKVVGG-YRVLLPDGRLMTVEYTVQGDSGF 359
           +G VV G Y ++ PDG + TV+YT     GF
Sbjct: 57  DGDVVKGQYSLVEPDGSIRTVDYTADSIHGF 87


>BT024343-1|ABC86405.1|  266|Drosophila melanogaster IP09562p
           protein.
          Length = 266

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 15/44 (34%), Positives = 22/44 (50%)
 Frame = +3

Query: 276 KVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNANPFGQG 407
           +V G Y V+ PDG L  V+YT    +GF  ++  +      G G
Sbjct: 128 EVRGVYSVVDPDGTLRVVKYTADDANGFQAEVITNGVKTLHGHG 171


>AE014296-1421|AAF50444.1|  266|Drosophila melanogaster CG13670-PA
           protein.
          Length = 266

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 15/44 (34%), Positives = 22/44 (50%)
 Frame = +3

Query: 276 KVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNANPFGQG 407
           +V G Y V+ PDG L  V+YT    +GF  ++  +      G G
Sbjct: 128 EVRGVYSVVDPDGTLRVVKYTADDANGFQAEVITNGVKTLHGHG 171


>AE014134-808|AAF50957.4| 1286|Drosophila melanogaster CG3047-PA
            protein.
          Length = 1286

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
 Frame = -3

Query: 361  TKPLSPCTVYSTVMSLPSGRSTRYP-PTTLPSASPIR 254
            T P S  T  ++  +  + RST  P PTT PSASP R
Sbjct: 1134 TTPRSTTTTTTSRPTTTTPRSTTTPCPTTTPSASPTR 1170


>BT023126-1|AAY55542.1|  245|Drosophila melanogaster IP08764p
           protein.
          Length = 245

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 13/27 (48%), Positives = 15/27 (55%)
 Frame = +3

Query: 279 VVGGYRVLLPDGRLMTVEYTVQGDSGF 359
           V G Y V+ PDG   TV+YT     GF
Sbjct: 94  VKGSYSVVDPDGTKRTVDYTADPHHGF 120


>BT023042-1|AAY55458.1|  245|Drosophila melanogaster IP08564p
           protein.
          Length = 245

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 13/27 (48%), Positives = 15/27 (55%)
 Frame = +3

Query: 279 VVGGYRVLLPDGRLMTVEYTVQGDSGF 359
           V G Y V+ PDG   TV+YT     GF
Sbjct: 94  VKGSYSVVDPDGTKRTVDYTADPHHGF 120


>AY069040-1|AAL39185.1|  429|Drosophila melanogaster GH03623p
           protein.
          Length = 429

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 17/47 (36%), Positives = 22/47 (46%)
 Frame = +3

Query: 270 EGKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNANPFGQGK 410
           +G   G Y  +  DG+L TV Y   G  GF  + S    A P  +GK
Sbjct: 57  DGTSRGFYSYVDADGKLQTVRYEANGVQGFKAEASNQPQA-PVDKGK 102


>AE014297-2676|AAF55678.2|  245|Drosophila melanogaster CG6240-PA
           protein.
          Length = 245

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 13/27 (48%), Positives = 15/27 (55%)
 Frame = +3

Query: 279 VVGGYRVLLPDGRLMTVEYTVQGDSGF 359
           V G Y V+ PDG   TV+YT     GF
Sbjct: 94  VKGSYSVVDPDGTKRTVDYTADPHHGF 120


>AE014296-3165|AAF49150.3| 1242|Drosophila melanogaster CG9299-PA
            protein.
          Length = 1242

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%)
 Frame = +3

Query: 264  DAEGKVVGG-YRVLLPDGRLMTVEYTVQGDSGF 359
            + +G VV G Y ++ PDG + TV+Y    ++GF
Sbjct: 1187 ERDGDVVKGEYSLVEPDGNVRTVKYYADWETGF 1219


>AE014296-2717|AAF49476.1|  429|Drosophila melanogaster CG4784-PA
           protein.
          Length = 429

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 17/47 (36%), Positives = 22/47 (46%)
 Frame = +3

Query: 270 EGKVVGGYRVLLPDGRLMTVEYTVQGDSGFVPKISFDSNANPFGQGK 410
           +G   G Y  +  DG+L TV Y   G  GF  + S    A P  +GK
Sbjct: 57  DGTSRGFYSYVDADGKLQTVRYEANGVQGFKAEASNQPQA-PVDKGK 102


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,181,199
Number of Sequences: 53049
Number of extensions: 569477
Number of successful extensions: 1665
Number of sequences better than 10.0: 55
Number of HSP's better than 10.0 without gapping: 1589
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1665
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3293648160
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -