SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20001
         (745 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L01500-1|AAB59186.1|  651|Drosophila melanogaster heat shock pro...   209   3e-54
BT023894-1|ABA81828.1|  651|Drosophila melanogaster LP19893p pro...   209   3e-54
AY084193-1|AAL89931.1|  651|Drosophila melanogaster RH04426p pro...   209   3e-54
AE014297-1972|AAO41568.1|  651|Drosophila melanogaster CG4264-PF...   209   3e-54
AE014297-1971|AAO41567.1|  651|Drosophila melanogaster CG4264-PE...   209   3e-54
AE014297-1970|AAN13639.1|  651|Drosophila melanogaster CG4264-PD...   209   3e-54
AE014297-1969|AAN13638.1|  651|Drosophila melanogaster CG4264-PC...   209   3e-54
AE014297-1968|AAN13637.1|  651|Drosophila melanogaster CG4264-PB...   209   3e-54
AE014297-1967|AAF55150.1|  651|Drosophila melanogaster CG4264-PA...   209   3e-54
M36114-1|AAA28627.1|  651|Drosophila melanogaster protein ( D.me...   204   1e-52
BT001361-1|AAN71116.1|  680|Drosophila melanogaster AT28834p pro...   202   4e-52
L01501-1|AAA28625.1|  641|Drosophila melanogaster heat shock pro...   200   1e-51
AE014296-2330|AAF49782.1|  641|Drosophila melanogaster CG8937-PA...   200   1e-51
AY094878-1|AAM11231.1|  635|Drosophila melanogaster RE48592p pro...   193   2e-49
AF096275-1|AAD16140.1|  635|Drosophila melanogaster heat shock p...   193   2e-49
AE014297-3453|AAF56230.1|  635|Drosophila melanogaster CG5436-PA...   193   2e-49
AY846852-1|AAW34343.1|  609|Drosophila melanogaster hsp70Bb prot...   190   2e-48
AY846851-1|AAW34342.1|  609|Drosophila melanogaster hsp70Bb prot...   190   2e-48
AY846850-1|AAW34341.1|  609|Drosophila melanogaster hsp70Bb prot...   190   2e-48
AY846849-1|AAW34340.1|  609|Drosophila melanogaster hsp70Bb prot...   190   2e-48
AY846848-1|AAW34339.1|  609|Drosophila melanogaster hsp70Bb prot...   190   2e-48
AF295955-1|AAG26909.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
BT021339-1|AAX33487.1|  642|Drosophila melanogaster LP23554p pro...   190   2e-48
BT011541-1|AAS15677.1|  641|Drosophila melanogaster LP08776p pro...   190   2e-48
BT011379-1|AAR96171.1|  641|Drosophila melanogaster LP05233p pro...   190   2e-48
BT011058-1|AAR31129.1|  641|Drosophila melanogaster LP05203p pro...   190   2e-48
AY846865-1|AAW34356.1|  609|Drosophila melanogaster hsp70Bb prot...   190   2e-48
AY846864-1|AAW34355.1|  609|Drosophila melanogaster hsp70Bb prot...   190   2e-48
AY846863-1|AAW34354.1|  609|Drosophila melanogaster hsp70Bb prot...   190   2e-48
AY846862-1|AAW34353.1|  609|Drosophila melanogaster hsp70Bb prot...   190   2e-48
AY846861-1|AAW34352.1|  609|Drosophila melanogaster hsp70Bb prot...   190   2e-48
AY846860-1|AAW34351.1|  609|Drosophila melanogaster hsp70Bb prot...   190   2e-48
AY846859-1|AAW34350.1|  609|Drosophila melanogaster hsp70Bb prot...   190   2e-48
AY846858-1|AAW34349.1|  609|Drosophila melanogaster hsp70Bb prot...   190   2e-48
AY846857-1|AAW34348.1|  609|Drosophila melanogaster hsp70Bb prot...   190   2e-48
AY846856-1|AAW34347.1|  609|Drosophila melanogaster hsp70Bb prot...   190   2e-48
AY846855-1|AAW34346.1|  609|Drosophila melanogaster hsp70Bb prot...   190   2e-48
AY846854-1|AAW34345.1|  609|Drosophila melanogaster hsp70Bb prot...   190   2e-48
AY846853-1|AAW34344.1|  609|Drosophila melanogaster hsp70Bb prot...   190   2e-48
AF385408-1|AAK67157.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350491-1|AAK30248.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350490-1|AAK30247.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350488-1|AAK30245.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350487-1|AAK30244.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350486-1|AAK30243.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350485-1|AAK30242.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350484-1|AAK30241.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350483-1|AAK30240.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350482-1|AAK30239.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350481-1|AAK30238.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350479-1|AAK30236.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350478-1|AAK30235.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350477-1|AAK30234.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350476-1|AAK30233.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350475-1|AAK30232.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350474-1|AAK30231.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350473-1|AAK30230.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350471-1|AAK30228.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350470-1|AAK30227.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350468-1|AAK30225.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF350467-1|AAK30224.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF350466-1|AAK30223.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF350465-1|AAK30222.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF350464-1|AAK30221.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF350463-1|AAK30220.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF350462-1|AAK30219.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF350461-1|AAK30218.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF350460-1|AAK30217.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF350459-1|AAK30216.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF350458-1|AAK30215.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF350457-1|AAK30214.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF350456-1|AAK30213.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF350455-1|AAK30212.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF350454-1|AAK30211.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF350453-1|AAK30210.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF350452-1|AAK30209.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF295962-1|AAG26916.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF295961-1|AAG26915.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF295960-1|AAG26914.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF295959-1|AAG26913.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF295958-1|AAG26912.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF295954-1|AAG26908.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF295953-1|AAG26907.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF295952-1|AAG26906.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF295951-1|AAG26905.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF295949-1|AAG26903.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF295948-1|AAG26902.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF295947-1|AAG26901.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF295946-1|AAG26900.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AF295945-1|AAG26899.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF295944-1|AAG26898.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF295943-1|AAG26897.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF295940-1|AAG26894.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF295939-1|AAG26893.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF295938-1|AAG26892.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF295937-1|AAG26891.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF295936-1|AAG26890.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF295935-1|AAG26889.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF295934-1|AAG26888.1|  642|Drosophila melanogaster heat shock p...   190   2e-48
AF295933-1|AAG26887.1|  641|Drosophila melanogaster heat shock p...   190   2e-48
AE014297-1542|AAG22149.2|  641|Drosophila melanogaster CG6489-PA...   190   2e-48
AE014297-1541|AAN13546.1|  641|Drosophila melanogaster CG31359-P...   190   2e-48
AE014297-1539|AAN13545.1|  641|Drosophila melanogaster CG31449-P...   190   2e-48
AE014297-1409|AAG22148.2|  642|Drosophila melanogaster CG18743-P...   190   2e-48
AE014297-1408|AAN13535.1|  642|Drosophila melanogaster CG31366-P...   190   2e-48
AY032740-1|AAK62472.1|  641|Drosophila melanogaster heat shock p...   188   7e-48
AF350480-1|AAK30237.1|  641|Drosophila melanogaster heat shock p...   188   7e-48
J01103-1|AAA28640.1|  643|Drosophila melanogaster protein ( D.me...   188   9e-48
AF350489-1|AAK30246.1|  641|Drosophila melanogaster heat shock p...   187   1e-47
AF295957-1|AAG26911.1|  641|Drosophila melanogaster heat shock p...   187   1e-47
AF295950-1|AAG26904.1|  641|Drosophila melanogaster heat shock p...   187   1e-47
AF385407-1|AAK67156.1|  641|Drosophila melanogaster heat shock p...   187   2e-47
AF385406-1|AAK67155.1|  641|Drosophila melanogaster heat shock p...   187   2e-47
AF295942-1|AAG26896.1|  642|Drosophila melanogaster heat shock p...   187   2e-47
AF295941-1|AAG26895.1|  642|Drosophila melanogaster heat shock p...   187   2e-47
AE014297-1540|AAF54830.2|  641|Drosophila melanogaster CG5834-PA...   187   2e-47
AF295956-1|AAG26910.1|  641|Drosophila melanogaster heat shock p...   186   2e-47
BT016141-1|AAV37026.1|  633|Drosophila melanogaster AT28983p pro...   185   5e-47
AF385405-1|AAK67154.1|  641|Drosophila melanogaster heat shock p...   185   5e-47
AE014297-1626|AAF54899.1|  633|Drosophila melanogaster CG7756-PA...   185   5e-47
J01104-1|AAD15226.1|  641|Drosophila melanogaster hsp70 distal 1...   179   3e-45
L01498-1|AAA28626.1|  656|Drosophila melanogaster heat shock pro...   167   1e-41
BT004838-1|AAO45194.1|  655|Drosophila melanogaster RH21402p pro...   167   1e-41
AE014298-1692|AAN09301.1|  656|Drosophila melanogaster CG4147-PD...   167   1e-41
AE014298-1691|AAN09300.1|  656|Drosophila melanogaster CG4147-PC...   167   1e-41
AE014298-1690|AAN09299.1|  656|Drosophila melanogaster CG4147-PB...   167   1e-41
AE014298-1689|AAF48095.1|  656|Drosophila melanogaster CG4147-PA...   167   1e-41
AF350472-1|AAK30229.1|  641|Drosophila melanogaster heat shock p...   141   8e-34
AF350469-1|AAK30226.1|  641|Drosophila melanogaster heat shock p...   141   8e-34
J01085-1|AAA28629.1|   68|Drosophila melanogaster protein ( Dros...   125   6e-29
BT004836-1|AAO45192.1|   73|Drosophila melanogaster RH49358p pro...   125   6e-29
AY032741-1|AAK62473.1|   64|Drosophila melanogaster heat shock p...   120   2e-27
AF377953-1|AAK54836.1|   64|Drosophila melanogaster heat shock p...   120   2e-27
AF377341-1|AAK54833.1|   64|Drosophila melanogaster heat shock p...   120   2e-27
L01502-1|AAA28628.1|  687|Drosophila melanogaster heat shock pro...   120   3e-27
AY118844-1|AAM50704.1|  686|Drosophila melanogaster GM13788p pro...   120   3e-27
AE013599-1858|AAF58270.1|  686|Drosophila melanogaster CG8542-PA...   120   3e-27
K01297-1|AAA28630.1|   68|Drosophila melanogaster protein ( D.me...   113   3e-25
AY370940-1|AAQ75092.1|   55|Drosophila melanogaster heat shock p...   112   6e-25
V00213-1|CAA23495.1|  149|Drosophila melanogaster protein ( Dros...   106   4e-23
BT001277-1|AAN71033.1|  555|Drosophila melanogaster AT07372p pro...   103   3e-22
AE014296-2332|AAN11820.1|  555|Drosophila melanogaster CG8937-PD...   103   3e-22
AE014296-2331|AAN11819.1|  555|Drosophila melanogaster CG8937-PC...   103   3e-22
J02569-1|AAA28631.1|  104|Drosophila melanogaster protein ( D.me...    79   8e-15
AJ132829-1|CAB38172.2|  804|Drosophila melanogaster heatshock pr...    75   1e-13
AY058632-1|AAL13861.1|  804|Drosophila melanogaster LD32979p pro...    74   2e-13
AE014296-2350|AAN11823.1|  804|Drosophila melanogaster CG6603-PC...    74   2e-13
AE014296-2349|AAF49767.1|  804|Drosophila melanogaster CG6603-PB...    74   2e-13
AE014296-2348|AAF49766.1|  804|Drosophila melanogaster CG6603-PA...    74   2e-13
AY094705-1|AAM11058.1|  923|Drosophila melanogaster GH11566p pro...    50   3e-06
AL009196-3|CAA15711.1|  923|Drosophila melanogaster EG:25E8.1 pr...    50   3e-06
AE014298-378|AAF45769.1|  923|Drosophila melanogaster CG2918-PA ...    50   3e-06
AJ132811-1|CAA10789.1|   46|Drosophila melanogaster hsp70 protein.     36   0.044
AY058504-1|AAL13733.1|  513|Drosophila melanogaster LD21269p pro...    36   0.058
AE014296-1427|AAF50438.2|  513|Drosophila melanogaster CG7182-PA...    36   0.058
BT030114-1|ABN49253.1|  342|Drosophila melanogaster IP08073p pro...    31   1.7  
S61883-1|AAB26991.2| 2068|Drosophila melanogaster transcription ...    29   8.8  
BT024196-1|ABC86258.1| 1964|Drosophila melanogaster RE63802p pro...    29   8.8  
BT004888-1|AAO47866.1| 2096|Drosophila melanogaster RE74933p pro...    29   8.8  
AE014297-3612|AAN14014.1|  118|Drosophila melanogaster CG31172-P...    29   8.8  
AE014297-491|AAF54102.3| 2065|Drosophila melanogaster CG17603-PA...    29   8.8  
AE014297-490|AAS65117.1| 2098|Drosophila melanogaster CG17603-PC...    29   8.8  
AE014297-489|AAS65116.1| 2129|Drosophila melanogaster CG17603-PB...    29   8.8  
AE001572-25|AAD19815.1| 2065|Drosophila melanogaster transcripti...    29   8.8  

>L01500-1|AAB59186.1|  651|Drosophila melanogaster heat shock
           protein cognate 70 protein.
          Length = 651

 Score =  209 bits (511), Expect = 3e-54
 Identities = 120/202 (59%), Positives = 132/202 (65%), Gaps = 3/202 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRK 425
           M PT   ++ +    +  K                V+ A+ + +  +  K   K F P +
Sbjct: 61  MNPT--QTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118

Query: 426 SVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
                           L            AYFNDSQRQATKDAGTI+GLNVLRIINEPTA
Sbjct: 119 ISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTA 178

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AAIAYGLDKK  GERNVLIFDL
Sbjct: 179 AAIAYGLDKKAVGERNVLIFDL 200



 Score =  137 bits (332), Expect = 1e-32
 Identities = 63/76 (82%), Positives = 68/76 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+SS
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLGK
Sbjct: 122 MVLTKMKETAEAYLGK 137



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL+I+DGIFEVKSTAGDT
Sbjct: 202 GGTFDVSILSIDDGIFEVKSTAGDT 226


>BT023894-1|ABA81828.1|  651|Drosophila melanogaster LP19893p
           protein.
          Length = 651

 Score =  209 bits (511), Expect = 3e-54
 Identities = 120/202 (59%), Positives = 132/202 (65%), Gaps = 3/202 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRK 425
           M PT   ++ +    +  K                V+ A+ + +  +  K   K F P +
Sbjct: 61  MNPT--QTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118

Query: 426 SVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
                           L            AYFNDSQRQATKDAGTI+GLNVLRIINEPTA
Sbjct: 119 ISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTA 178

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AAIAYGLDKK  GERNVLIFDL
Sbjct: 179 AAIAYGLDKKAVGERNVLIFDL 200



 Score =  137 bits (332), Expect = 1e-32
 Identities = 63/76 (82%), Positives = 68/76 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+SS
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLGK
Sbjct: 122 MVLTKMKETAEAYLGK 137



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL+I+DGIFEVKSTAGDT
Sbjct: 202 GGTFDVSILSIDDGIFEVKSTAGDT 226


>AY084193-1|AAL89931.1|  651|Drosophila melanogaster RH04426p
           protein.
          Length = 651

 Score =  209 bits (511), Expect = 3e-54
 Identities = 120/202 (59%), Positives = 132/202 (65%), Gaps = 3/202 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRK 425
           M PT   ++ +    +  K                V+ A+ + +  +  K   K F P +
Sbjct: 61  MNPT--QTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118

Query: 426 SVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
                           L            AYFNDSQRQATKDAGTI+GLNVLRIINEPTA
Sbjct: 119 ISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTA 178

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AAIAYGLDKK  GERNVLIFDL
Sbjct: 179 AAIAYGLDKKAVGERNVLIFDL 200



 Score =  137 bits (332), Expect = 1e-32
 Identities = 63/76 (82%), Positives = 68/76 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+SS
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLGK
Sbjct: 122 MVLTKMKETAEAYLGK 137



 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 22/25 (88%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL+I+DGIFEV+STAGDT
Sbjct: 202 GGTFDVSILSIDDGIFEVQSTAGDT 226


>AE014297-1972|AAO41568.1|  651|Drosophila melanogaster CG4264-PF,
           isoform F protein.
          Length = 651

 Score =  209 bits (511), Expect = 3e-54
 Identities = 120/202 (59%), Positives = 132/202 (65%), Gaps = 3/202 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRK 425
           M PT   ++ +    +  K                V+ A+ + +  +  K   K F P +
Sbjct: 61  MNPT--QTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118

Query: 426 SVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
                           L            AYFNDSQRQATKDAGTI+GLNVLRIINEPTA
Sbjct: 119 ISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTA 178

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AAIAYGLDKK  GERNVLIFDL
Sbjct: 179 AAIAYGLDKKAVGERNVLIFDL 200



 Score =  137 bits (332), Expect = 1e-32
 Identities = 63/76 (82%), Positives = 68/76 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+SS
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLGK
Sbjct: 122 MVLTKMKETAEAYLGK 137



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL+I+DGIFEVKSTAGDT
Sbjct: 202 GGTFDVSILSIDDGIFEVKSTAGDT 226


>AE014297-1971|AAO41567.1|  651|Drosophila melanogaster CG4264-PE,
           isoform E protein.
          Length = 651

 Score =  209 bits (511), Expect = 3e-54
 Identities = 120/202 (59%), Positives = 132/202 (65%), Gaps = 3/202 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRK 425
           M PT   ++ +    +  K                V+ A+ + +  +  K   K F P +
Sbjct: 61  MNPT--QTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118

Query: 426 SVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
                           L            AYFNDSQRQATKDAGTI+GLNVLRIINEPTA
Sbjct: 119 ISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTA 178

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AAIAYGLDKK  GERNVLIFDL
Sbjct: 179 AAIAYGLDKKAVGERNVLIFDL 200



 Score =  137 bits (332), Expect = 1e-32
 Identities = 63/76 (82%), Positives = 68/76 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+SS
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLGK
Sbjct: 122 MVLTKMKETAEAYLGK 137



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL+I+DGIFEVKSTAGDT
Sbjct: 202 GGTFDVSILSIDDGIFEVKSTAGDT 226


>AE014297-1970|AAN13639.1|  651|Drosophila melanogaster CG4264-PD,
           isoform D protein.
          Length = 651

 Score =  209 bits (511), Expect = 3e-54
 Identities = 120/202 (59%), Positives = 132/202 (65%), Gaps = 3/202 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRK 425
           M PT   ++ +    +  K                V+ A+ + +  +  K   K F P +
Sbjct: 61  MNPT--QTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118

Query: 426 SVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
                           L            AYFNDSQRQATKDAGTI+GLNVLRIINEPTA
Sbjct: 119 ISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTA 178

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AAIAYGLDKK  GERNVLIFDL
Sbjct: 179 AAIAYGLDKKAVGERNVLIFDL 200



 Score =  137 bits (332), Expect = 1e-32
 Identities = 63/76 (82%), Positives = 68/76 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+SS
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLGK
Sbjct: 122 MVLTKMKETAEAYLGK 137



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL+I+DGIFEVKSTAGDT
Sbjct: 202 GGTFDVSILSIDDGIFEVKSTAGDT 226


>AE014297-1969|AAN13638.1|  651|Drosophila melanogaster CG4264-PC,
           isoform C protein.
          Length = 651

 Score =  209 bits (511), Expect = 3e-54
 Identities = 120/202 (59%), Positives = 132/202 (65%), Gaps = 3/202 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRK 425
           M PT   ++ +    +  K                V+ A+ + +  +  K   K F P +
Sbjct: 61  MNPT--QTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118

Query: 426 SVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
                           L            AYFNDSQRQATKDAGTI+GLNVLRIINEPTA
Sbjct: 119 ISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTA 178

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AAIAYGLDKK  GERNVLIFDL
Sbjct: 179 AAIAYGLDKKAVGERNVLIFDL 200



 Score =  137 bits (332), Expect = 1e-32
 Identities = 63/76 (82%), Positives = 68/76 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+SS
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLGK
Sbjct: 122 MVLTKMKETAEAYLGK 137



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL+I+DGIFEVKSTAGDT
Sbjct: 202 GGTFDVSILSIDDGIFEVKSTAGDT 226


>AE014297-1968|AAN13637.1|  651|Drosophila melanogaster CG4264-PB,
           isoform B protein.
          Length = 651

 Score =  209 bits (511), Expect = 3e-54
 Identities = 120/202 (59%), Positives = 132/202 (65%), Gaps = 3/202 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRK 425
           M PT   ++ +    +  K                V+ A+ + +  +  K   K F P +
Sbjct: 61  MNPT--QTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118

Query: 426 SVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
                           L            AYFNDSQRQATKDAGTI+GLNVLRIINEPTA
Sbjct: 119 ISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTA 178

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AAIAYGLDKK  GERNVLIFDL
Sbjct: 179 AAIAYGLDKKAVGERNVLIFDL 200



 Score =  137 bits (332), Expect = 1e-32
 Identities = 63/76 (82%), Positives = 68/76 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+SS
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLGK
Sbjct: 122 MVLTKMKETAEAYLGK 137



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL+I+DGIFEVKSTAGDT
Sbjct: 202 GGTFDVSILSIDDGIFEVKSTAGDT 226


>AE014297-1967|AAF55150.1|  651|Drosophila melanogaster CG4264-PA,
           isoform A protein.
          Length = 651

 Score =  209 bits (511), Expect = 3e-54
 Identities = 120/202 (59%), Positives = 132/202 (65%), Gaps = 3/202 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRK 425
           M PT   ++ +    +  K                V+ A+ + +  +  K   K F P +
Sbjct: 61  MNPT--QTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118

Query: 426 SVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
                           L            AYFNDSQRQATKDAGTI+GLNVLRIINEPTA
Sbjct: 119 ISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTA 178

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AAIAYGLDKK  GERNVLIFDL
Sbjct: 179 AAIAYGLDKKAVGERNVLIFDL 200



 Score =  137 bits (332), Expect = 1e-32
 Identities = 63/76 (82%), Positives = 68/76 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+SS
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLGK
Sbjct: 122 MVLTKMKETAEAYLGK 137



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL+I+DGIFEVKSTAGDT
Sbjct: 202 GGTFDVSILSIDDGIFEVKSTAGDT 226


>M36114-1|AAA28627.1|  651|Drosophila melanogaster protein (
           D.melanogaster heatshock cognate 4 (hsc4) gene, exon 2.
           ).
          Length = 651

 Score =  204 bits (497), Expect = 1e-52
 Identities = 118/202 (58%), Positives = 130/202 (64%), Gaps = 3/202 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRK 425
           M PT   ++ +    +  K                V+ A+ + +  +  K   K F P +
Sbjct: 61  MNPT--QTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEE 118

Query: 426 SVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
                           L            AYFNDSQRQATKDAGTI+G NV RIINEPTA
Sbjct: 119 ISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGPNVPRIINEPTA 178

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AAIAYGLDKK  GERNVLIFDL
Sbjct: 179 AAIAYGLDKKAVGERNVLIFDL 200



 Score =  137 bits (332), Expect = 1e-32
 Identities = 63/76 (82%), Positives = 68/76 (89%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+V YK E KTFFPEE+SS
Sbjct: 62  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLGK
Sbjct: 122 MVLTKMKETAEAYLGK 137



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL+I+DGIFEVKSTAGDT
Sbjct: 202 GGTFDVSILSIDDGIFEVKSTAGDT 226


>BT001361-1|AAN71116.1|  680|Drosophila melanogaster AT28834p
           protein.
          Length = 680

 Score =  202 bits (493), Expect = 4e-52
 Identities = 116/203 (57%), Positives = 129/203 (63%), Gaps = 3/203 (1%)
 Frame = +3

Query: 69  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV 248
           KM K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQV
Sbjct: 39  KMPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQV 98

Query: 249 AMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPR 422
           AM P    ++ +    +  +                V   N + R  +  K   K F P 
Sbjct: 99  AMNPNN--TIFDAKRLIGRRFDDATVQSDMKHWPFEVFAENGKPRIRVEYKGERKSFYPE 156

Query: 423 KSVPWCXXXXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPT 599
           +                L     +      AYFNDSQRQATKDAG I+GLNVLRIINEPT
Sbjct: 157 EVSSMVLTKMRETAEAYLGGTVTDAVVTIPAYFNDSQRQATKDAGAIAGLNVLRIINEPT 216

Query: 600 AAAIAYGLDKKGTGERNVLIFDL 668
           AAAIAYGLDK+GT ERNVLIFDL
Sbjct: 217 AAAIAYGLDKQGTSERNVLIFDL 239



 Score =  137 bits (332), Expect = 1e-32
 Identities = 60/75 (80%), Positives = 71/75 (94%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +PNNTIFDAKRLIGR+F+DATVQ+DMKHWPFEV ++ GKP+I+V YKGE K+F+PEEVSS
Sbjct: 101 NPNNTIFDAKRLIGRRFDDATVQSDMKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVSS 160

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKM+ETAEAYLG
Sbjct: 161 MVLTKMRETAEAYLG 175



 Score = 52.8 bits (121), Expect = 5e-07
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTIEDGIFEVK+TAGDT
Sbjct: 241 GGTFDVSVLTIEDGIFEVKATAGDT 265


>L01501-1|AAA28625.1|  641|Drosophila melanogaster heat shock
           protein cognate 70 protein.
          Length = 641

 Score =  200 bits (489), Expect = 1e-51
 Identities = 115/202 (56%), Positives = 128/202 (63%), Gaps = 3/202 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQVA
Sbjct: 1   MPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRK 425
           M P    ++ +    +  +                V   N + R  +  K   K F P +
Sbjct: 61  MNPNN--TIFDAKRLIGRRFDDATVQSDMKHWPFEVFAENGKPRIRVEYKGERKSFYPEE 118

Query: 426 SVPWCXXXXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
                           L     +      AYFNDSQRQATKDAG I+GLNVLRIINEPTA
Sbjct: 119 VSSMVLTKMRETAEAYLGGTVTDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA 178

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AAIAYGLDK+GT ERNVLIFDL
Sbjct: 179 AAIAYGLDKQGTSERNVLIFDL 200



 Score =  137 bits (332), Expect = 1e-32
 Identities = 60/75 (80%), Positives = 71/75 (94%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +PNNTIFDAKRLIGR+F+DATVQ+DMKHWPFEV ++ GKP+I+V YKGE K+F+PEEVSS
Sbjct: 62  NPNNTIFDAKRLIGRRFDDATVQSDMKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVSS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKM+ETAEAYLG
Sbjct: 122 MVLTKMRETAEAYLG 136



 Score = 52.8 bits (121), Expect = 5e-07
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTIEDGIFEVK+TAGDT
Sbjct: 202 GGTFDVSVLTIEDGIFEVKATAGDT 226


>AE014296-2330|AAF49782.1|  641|Drosophila melanogaster CG8937-PA,
           isoform A protein.
          Length = 641

 Score =  200 bits (489), Expect = 1e-51
 Identities = 115/202 (56%), Positives = 128/202 (63%), Gaps = 3/202 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQVA
Sbjct: 1   MPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRK 425
           M P    ++ +    +  +                V   N + R  +  K   K F P +
Sbjct: 61  MNPNN--TIFDAKRLIGRRFDDATVQSDMKHWPFEVFAENGKPRIRVEYKGERKSFYPEE 118

Query: 426 SVPWCXXXXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
                           L     +      AYFNDSQRQATKDAG I+GLNVLRIINEPTA
Sbjct: 119 VSSMVLTKMRETAEAYLGGTVTDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA 178

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AAIAYGLDK+GT ERNVLIFDL
Sbjct: 179 AAIAYGLDKQGTSERNVLIFDL 200



 Score =  137 bits (332), Expect = 1e-32
 Identities = 60/75 (80%), Positives = 71/75 (94%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +PNNTIFDAKRLIGR+F+DATVQ+DMKHWPFEV ++ GKP+I+V YKGE K+F+PEEVSS
Sbjct: 62  NPNNTIFDAKRLIGRRFDDATVQSDMKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVSS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKM+ETAEAYLG
Sbjct: 122 MVLTKMRETAEAYLG 136



 Score = 52.8 bits (121), Expect = 5e-07
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTIEDGIFEVK+TAGDT
Sbjct: 202 GGTFDVSVLTIEDGIFEVKATAGDT 226


>AY094878-1|AAM11231.1|  635|Drosophila melanogaster RE48592p
           protein.
          Length = 635

 Score =  193 bits (471), Expect = 2e-49
 Identities = 111/198 (56%), Positives = 128/198 (64%), Gaps = 3/198 (1%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGVFQ+GKVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP- 60

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKSVPW 437
            + S+ +    +  +    K           V+  N + +  +  K   K FSP +    
Sbjct: 61  -KNSVFDAKRLIGRRFDDSKIQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEISSM 119

Query: 438 CXXXXXXXXXXILANCA-ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIA 614
                       L     +      AYFNDSQRQATKDAG I+G+NVLRIINEPTAAA+A
Sbjct: 120 VLTKMKETAEAYLGTTVKDAVITVPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALA 179

Query: 615 YGLDKKGTGERNVLIFDL 668
           YGLDK   GERNVLIFDL
Sbjct: 180 YGLDKNLKGERNVLIFDL 197



 Score =  124 bits (298), Expect = 2e-28
 Identities = 52/75 (69%), Positives = 66/75 (88%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P N++FDAKRLIGR+F+D+ +Q D+KHWPF+V++D GKPKI V +KG +K F PEE+SS
Sbjct: 59  NPKNSVFDAKRLIGRRFDDSKIQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEISS 118

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKETAEAYLG
Sbjct: 119 MVLTKMKETAEAYLG 133



 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 21/26 (80%), Positives = 25/26 (96%), Gaps = 1/26 (3%)
 Frame = +2

Query: 671 GGTFDVSILTIEDG-IFEVKSTAGDT 745
           GGTFDVSILTI++G +FEV+STAGDT
Sbjct: 199 GGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF096275-1|AAD16140.1|  635|Drosophila melanogaster heat shock
           protein 68 protein.
          Length = 635

 Score =  193 bits (471), Expect = 2e-49
 Identities = 111/198 (56%), Positives = 128/198 (64%), Gaps = 3/198 (1%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGVFQ+GKVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP- 60

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKSVPW 437
            + S+ +    +  +    K           V+  N + +  +  K   K FSP +    
Sbjct: 61  -KNSVFDAKRLIGRRFDDSKIQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEISSM 119

Query: 438 CXXXXXXXXXXILANCA-ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIA 614
                       L     +      AYFNDSQRQATKDAG I+G+NVLRIINEPTAAA+A
Sbjct: 120 VLTKMKETAEAYLGTTVKDAVITVPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALA 179

Query: 615 YGLDKKGTGERNVLIFDL 668
           YGLDK   GERNVLIFDL
Sbjct: 180 YGLDKNLKGERNVLIFDL 197



 Score =  124 bits (298), Expect = 2e-28
 Identities = 52/75 (69%), Positives = 66/75 (88%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P N++FDAKRLIGR+F+D+ +Q D+KHWPF+V++D GKPKI V +KG +K F PEE+SS
Sbjct: 59  NPKNSVFDAKRLIGRRFDDSKIQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEISS 118

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKETAEAYLG
Sbjct: 119 MVLTKMKETAEAYLG 133



 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 21/26 (80%), Positives = 25/26 (96%), Gaps = 1/26 (3%)
 Frame = +2

Query: 671 GGTFDVSILTIEDG-IFEVKSTAGDT 745
           GGTFDVSILTI++G +FEV+STAGDT
Sbjct: 199 GGTFDVSILTIDEGSLFEVRSTAGDT 224


>AE014297-3453|AAF56230.1|  635|Drosophila melanogaster CG5436-PA
           protein.
          Length = 635

 Score =  193 bits (471), Expect = 2e-49
 Identities = 111/198 (56%), Positives = 128/198 (64%), Gaps = 3/198 (1%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGVFQ+GKVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVFQYGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP- 60

Query: 264 TQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRKSVPW 437
            + S+ +    +  +    K           V+  N + +  +  K   K FSP +    
Sbjct: 61  -KNSVFDAKRLIGRRFDDSKIQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEISSM 119

Query: 438 CXXXXXXXXXXILANCA-ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIA 614
                       L     +      AYFNDSQRQATKDAG I+G+NVLRIINEPTAAA+A
Sbjct: 120 VLTKMKETAEAYLGTTVKDAVITVPAYFNDSQRQATKDAGAIAGINVLRIINEPTAAALA 179

Query: 615 YGLDKKGTGERNVLIFDL 668
           YGLDK   GERNVLIFDL
Sbjct: 180 YGLDKNLKGERNVLIFDL 197



 Score =  124 bits (298), Expect = 2e-28
 Identities = 52/75 (69%), Positives = 66/75 (88%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P N++FDAKRLIGR+F+D+ +Q D+KHWPF+V++D GKPKI V +KG +K F PEE+SS
Sbjct: 59  NPKNSVFDAKRLIGRRFDDSKIQEDIKHWPFKVINDNGKPKISVEFKGANKCFSPEEISS 118

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKETAEAYLG
Sbjct: 119 MVLTKMKETAEAYLG 133



 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 21/26 (80%), Positives = 25/26 (96%), Gaps = 1/26 (3%)
 Frame = +2

Query: 671 GGTFDVSILTIEDG-IFEVKSTAGDT 745
           GGTFDVSILTI++G +FEV+STAGDT
Sbjct: 199 GGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY846852-1|AAW34343.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  190 bits (463), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLNGERNVLIFDL 197



 Score =  131 bits (316), Expect = 1e-30
 Identities = 58/76 (76%), Positives = 66/76 (86%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLG+
Sbjct: 119 MVLTKMKETAEAYLGE 134



 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 21/26 (80%), Positives = 25/26 (96%), Gaps = 1/26 (3%)
 Frame = +2

Query: 671 GGTFDVSILTIEDG-IFEVKSTAGDT 745
           GGTFDVSILTI++G +FEV+STAGDT
Sbjct: 199 GGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY846851-1|AAW34342.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  190 bits (463), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLNGERNVLIFDL 197



 Score =  131 bits (316), Expect = 1e-30
 Identities = 58/76 (76%), Positives = 66/76 (86%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLG+
Sbjct: 119 MVLTKMKETAEAYLGE 134



 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 21/26 (80%), Positives = 25/26 (96%), Gaps = 1/26 (3%)
 Frame = +2

Query: 671 GGTFDVSILTIEDG-IFEVKSTAGDT 745
           GGTFDVSILTI++G +FEV+STAGDT
Sbjct: 199 GGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY846850-1|AAW34341.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  190 bits (463), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLNGERNVLIFDL 197



 Score =  131 bits (316), Expect = 1e-30
 Identities = 58/76 (76%), Positives = 66/76 (86%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLG+
Sbjct: 119 MVLTKMKETAEAYLGE 134



 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 21/26 (80%), Positives = 25/26 (96%), Gaps = 1/26 (3%)
 Frame = +2

Query: 671 GGTFDVSILTIEDG-IFEVKSTAGDT 745
           GGTFDVSILTI++G +FEV+STAGDT
Sbjct: 199 GGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY846849-1|AAW34340.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  190 bits (463), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLNGERNVLIFDL 197



 Score =  131 bits (316), Expect = 1e-30
 Identities = 58/76 (76%), Positives = 66/76 (86%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLG+
Sbjct: 119 MVLTKMKETAEAYLGE 134



 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 21/26 (80%), Positives = 25/26 (96%), Gaps = 1/26 (3%)
 Frame = +2

Query: 671 GGTFDVSILTIEDG-IFEVKSTAGDT 745
           GGTFDVSILTI++G +FEV+STAGDT
Sbjct: 199 GGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY846848-1|AAW34339.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  190 bits (463), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLNGERNVLIFDL 197



 Score =  131 bits (316), Expect = 1e-30
 Identities = 58/76 (76%), Positives = 66/76 (86%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLG+
Sbjct: 119 MVLTKMKETAEAYLGE 134



 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 21/26 (80%), Positives = 25/26 (96%), Gaps = 1/26 (3%)
 Frame = +2

Query: 671 GGTFDVSILTIEDG-IFEVKSTAGDT 745
           GGTFDVSILTI++G +FEV+STAGDT
Sbjct: 199 GGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295955-1|AAG26909.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  190 bits (463), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLNGERNVLIFDL 197



 Score =  131 bits (316), Expect = 1e-30
 Identities = 58/76 (76%), Positives = 66/76 (86%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLG+
Sbjct: 119 MVLTKMKETAEAYLGE 134



 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 21/26 (80%), Positives = 25/26 (96%), Gaps = 1/26 (3%)
 Frame = +2

Query: 671 GGTFDVSILTIEDG-IFEVKSTAGDT 745
           GGTFDVSILTI++G +FEV+STAGDT
Sbjct: 199 GGTFDVSILTIDEGSLFEVRSTAGDT 224


>BT021339-1|AAX33487.1|  642|Drosophila melanogaster LP23554p
           protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>BT011541-1|AAS15677.1|  641|Drosophila melanogaster LP08776p
           protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>BT011379-1|AAR96171.1|  641|Drosophila melanogaster LP05233p
           protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>BT011058-1|AAR31129.1|  641|Drosophila melanogaster LP05203p
           protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY846865-1|AAW34356.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY846864-1|AAW34355.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY846863-1|AAW34354.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLTGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  140 bits (340), Expect = 1e-33
 Identities = 86/169 (50%), Positives = 104/169 (61%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRL GRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLTGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY846862-1|AAW34353.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY846861-1|AAW34352.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDPKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  140 bits (340), Expect = 1e-33
 Identities = 86/169 (50%), Positives = 104/169 (61%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FD KRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDPKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY846860-1|AAW34351.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY846859-1|AAW34350.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY846858-1|AAW34349.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY846857-1|AAW34348.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY846856-1|AAW34347.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY846855-1|AAW34346.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY846854-1|AAW34345.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY846853-1|AAW34344.1|  609|Drosophila melanogaster hsp70Bb
           protein.
          Length = 609

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF385408-1|AAK67157.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350491-1|AAK30248.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 129/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRRYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L     +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGEGITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLNGERNVLIFDL 197



 Score =  130 bits (313), Expect = 3e-30
 Identities = 57/76 (75%), Positives = 66/76 (86%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR+++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRRYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLG+
Sbjct: 119 MVLTKMKETAEAYLGE 134



 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 21/26 (80%), Positives = 25/26 (96%), Gaps = 1/26 (3%)
 Frame = +2

Query: 671 GGTFDVSILTIEDG-IFEVKSTAGDT 745
           GGTFDVSILTI++G +FEV+STAGDT
Sbjct: 199 GGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350490-1|AAK30247.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350488-1|AAK30245.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350487-1|AAK30244.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350486-1|AAK30243.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350485-1|AAK30242.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350484-1|AAK30241.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350483-1|AAK30240.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350482-1|AAK30239.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350481-1|AAK30238.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350479-1|AAK30236.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350478-1|AAK30235.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350477-1|AAK30234.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350476-1|AAK30233.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350475-1|AAK30232.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350474-1|AAK30231.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350473-1|AAK30230.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350471-1|AAK30228.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350470-1|AAK30227.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350468-1|AAK30225.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350467-1|AAK30224.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350466-1|AAK30223.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350465-1|AAK30222.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350464-1|AAK30221.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350463-1|AAK30220.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350462-1|AAK30219.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350461-1|AAK30218.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350460-1|AAK30217.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350459-1|AAK30216.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKGLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  140 bits (338), Expect = 2e-33
 Identities = 86/169 (50%), Positives = 104/169 (61%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAK LIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKGLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350458-1|AAK30215.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350457-1|AAK30214.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350456-1|AAK30213.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350455-1|AAK30212.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350454-1|AAK30211.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350453-1|AAK30210.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350452-1|AAK30209.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295962-1|AAG26916.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVIDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  140 bits (339), Expect = 2e-33
 Identities = 86/169 (50%), Positives = 104/169 (61%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VV DGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVIDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295961-1|AAG26915.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295960-1|AAG26914.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295959-1|AAG26913.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295958-1|AAG26912.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  141 bits (341), Expect = 1e-33
 Identities = 87/169 (51%), Positives = 104/169 (61%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI +G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIYEGSLFEVRSTAGDT 224


>AF295954-1|AAG26908.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295953-1|AAG26907.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295952-1|AAG26906.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295951-1|AAG26905.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295949-1|AAG26903.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295948-1|AAG26902.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295947-1|AAG26901.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295946-1|AAG26900.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295945-1|AAG26899.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295944-1|AAG26898.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295943-1|AAG26897.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295940-1|AAG26894.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295939-1|AAG26893.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295938-1|AAG26892.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295937-1|AAG26891.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295936-1|AAG26890.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295935-1|AAG26889.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295934-1|AAG26888.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295933-1|AAG26887.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Aa protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AE014297-1542|AAG22149.2|  641|Drosophila melanogaster CG6489-PA
           protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AE014297-1541|AAN13546.1|  641|Drosophila melanogaster CG31359-PA
           protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AE014297-1539|AAN13545.1|  641|Drosophila melanogaster CG31449-PA
           protein.
          Length = 641

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AE014297-1409|AAG22148.2|  642|Drosophila melanogaster CG18743-PA
           protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AE014297-1408|AAN13535.1|  642|Drosophila melanogaster CG31366-PA
           protein.
          Length = 642

 Score =  190 bits (462), Expect = 2e-48
 Identities = 112/207 (54%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AY032740-1|AAK62472.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  188 bits (458), Expect = 7e-48
 Identities = 111/207 (53%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFT++ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTESERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF350480-1|AAK30237.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  188 bits (458), Expect = 7e-48
 Identities = 111/207 (53%), Positives = 130/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFT++ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTESERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>J01103-1|AAA28640.1|  643|Drosophila melanogaster protein (
           D.melanogaster heatshock protein 70 genes, locus 87A7,
           seg. 2. (partial proximalgene, spacer region and
           complete distal gene). ).
          Length = 643

 Score =  188 bits (457), Expect = 9e-48
 Identities = 111/208 (53%), Positives = 132/208 (63%), Gaps = 13/208 (6%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIG+ AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGEPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRK--SVPWCXXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRI 584
           F+P +  S+             +  +  +      AYFNDSQRQATKDAG I+GLNVLRI
Sbjct: 111 FAPEEISSMVLTKMKETAAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRI 170

Query: 585 INEPTAAAIAYGLDKKGTGERNVLIFDL 668
           INEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 INEPTAAALAYGLDKNLKGERNVLIFDL 198



 Score =  138 bits (334), Expect = 7e-33
 Identities = 87/170 (51%), Positives = 105/170 (61%), Gaps = 6/170 (3%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKET-AEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDC 601
           MVLTKMKET AEAYLG+     +         S+    +   H   L + R  N      
Sbjct: 119 MVLTKMKETAAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAA 178

Query: 602 CCDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
               L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 LAYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 225


>AF350489-1|AAK30246.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bc protein.
          Length = 641

 Score =  187 bits (456), Expect = 1e-47
 Identities = 111/207 (53%), Positives = 129/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ RLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSARLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295957-1|AAG26911.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  187 bits (456), Expect = 1e-47
 Identities = 111/207 (53%), Positives = 129/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLI DL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLILDL 197



 Score =  147 bits (357), Expect = 1e-35
 Identities = 88/168 (52%), Positives = 104/168 (61%), Gaps = 4/168 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG        L   GGTFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG--ERNVLILDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295950-1|AAG26904.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  187 bits (456), Expect = 1e-47
 Identities = 111/207 (53%), Positives = 129/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLI DL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLILDL 197



 Score =  147 bits (357), Expect = 1e-35
 Identities = 88/168 (52%), Positives = 104/168 (61%), Gaps = 4/168 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG        L   GGTFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG--ERNVLILDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF385407-1|AAK67156.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  187 bits (455), Expect = 2e-47
 Identities = 111/206 (53%), Positives = 129/206 (62%), Gaps = 12/206 (5%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT 266
           A+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P  
Sbjct: 3   AIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPRN 62

Query: 267 -----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPF 413
                      +Y  P ++ D+  K    K     G  ++ V           + ++K F
Sbjct: 63  TVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKRF 111

Query: 414 SPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIIN 590
           +P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRIIN
Sbjct: 112 APEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIIN 171

Query: 591 EPTAAAIAYGLDKKGTGERNVLIFDL 668
           EPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 172 EPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF385406-1|AAK67155.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  187 bits (455), Expect = 2e-47
 Identities = 111/206 (53%), Positives = 129/206 (62%), Gaps = 12/206 (5%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT 266
           A+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P  
Sbjct: 3   AIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPRN 62

Query: 267 -----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPF 413
                      +Y  P ++ D+  K    K     G  ++ V           + ++K F
Sbjct: 63  TVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKRF 111

Query: 414 SPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIIN 590
           +P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRIIN
Sbjct: 112 APEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIIN 171

Query: 591 EPTAAAIAYGLDKKGTGERNVLIFDL 668
           EPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 172 EPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295942-1|AAG26896.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  187 bits (455), Expect = 2e-47
 Identities = 111/207 (53%), Positives = 129/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   G RNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGGRNVLIFDL 197



 Score =  131 bits (316), Expect = 1e-30
 Identities = 58/76 (76%), Positives = 66/76 (86%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLG+
Sbjct: 119 MVLTKMKETAEAYLGE 134



 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 21/26 (80%), Positives = 25/26 (96%), Gaps = 1/26 (3%)
 Frame = +2

Query: 671 GGTFDVSILTIEDG-IFEVKSTAGDT 745
           GGTFDVSILTI++G +FEV+STAGDT
Sbjct: 199 GGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295941-1|AAG26895.1|  642|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 642

 Score =  187 bits (455), Expect = 2e-47
 Identities = 111/207 (53%), Positives = 129/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVL FDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLNFDL 197



 Score =  131 bits (316), Expect = 1e-30
 Identities = 58/76 (76%), Positives = 66/76 (86%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLG+
Sbjct: 119 MVLTKMKETAEAYLGE 134



 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 21/26 (80%), Positives = 25/26 (96%), Gaps = 1/26 (3%)
 Frame = +2

Query: 671 GGTFDVSILTIEDG-IFEVKSTAGDT 745
           GGTFDVSILTI++G +FEV+STAGDT
Sbjct: 199 GGTFDVSILTIDEGSLFEVRSTAGDT 224


>AE014297-1540|AAF54830.2|  641|Drosophila melanogaster CG5834-PA
           protein.
          Length = 641

 Score =  187 bits (455), Expect = 2e-47
 Identities = 111/207 (53%), Positives = 129/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK    ERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKDERNVLIFDL 197



 Score =  131 bits (316), Expect = 1e-30
 Identities = 58/76 (76%), Positives = 66/76 (86%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLG+
Sbjct: 119 MVLTKMKETAEAYLGE 134



 Score = 45.2 bits (102), Expect = 1e-04
 Identities = 21/26 (80%), Positives = 25/26 (96%), Gaps = 1/26 (3%)
 Frame = +2

Query: 671 GGTFDVSILTIEDG-IFEVKSTAGDT 745
           GGTFDVSILTI++G +FEV+STAGDT
Sbjct: 199 GGTFDVSILTIDEGSLFEVRSTAGDT 224


>AF295956-1|AAG26910.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Bb protein.
          Length = 641

 Score =  186 bits (454), Expect = 2e-47
 Identities = 111/207 (53%), Positives = 129/207 (62%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM   
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNSR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  139 bits (337), Expect = 3e-33
 Identities = 86/166 (51%), Positives = 103/166 (62%), Gaps = 5/166 (3%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVL 442
           NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SSMVL
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVL 121

Query: 443 TKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCCCDC 613
           TKMKETAEAYLG+     +         S+    +   H   L + R  N          
Sbjct: 122 TKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYG 181

Query: 614 LRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
           L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 182 LDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>BT016141-1|AAV37026.1|  633|Drosophila melanogaster AT28983p
           protein.
          Length = 633

 Score =  185 bits (451), Expect = 5e-47
 Identities = 108/202 (53%), Positives = 127/202 (62%), Gaps = 3/202 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M K PA+GIDLGTTYSCVGV+Q+ KVEIIANDQGNRTTPSYVAF +TERLIGD AKNQVA
Sbjct: 1   MGKIPAIGIDLGTTYSCVGVWQNSKVEIIANDQGNRTTPSYVAFNETERLIGDPAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRK 425
           M    + ++ +    +  K    K      L    V+    + +  +  K   K F+P +
Sbjct: 61  M--NAKNTVFDAKRLIGRKFDDKKIQEDLKLWPFKVINEKGKPKIEVEFKGERKRFAPEE 118

Query: 426 SVPWCXXXXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
                           L     +      AYFNDSQRQATKDAG+I+GLNVLRIINEPTA
Sbjct: 119 ISSMVLTKMREIAEVYLGGKVKDAVVTVPAYFNDSQRQATKDAGSIAGLNVLRIINEPTA 178

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AA+AYGLDK   GERNVLIFDL
Sbjct: 179 AALAYGLDKNLKGERNVLIFDL 200



 Score =  124 bits (300), Expect = 1e-28
 Identities = 77/165 (46%), Positives = 100/165 (60%), Gaps = 4/165 (2%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVL 442
           NT+FDAKRLIGRKF+D  +Q D+K WPF+V+++ GKPKI+V +KGE K F PEE+SSMVL
Sbjct: 65  NTVFDAKRLIGRKFDDKKIQEDLKLWPFKVINEKGKPKIEVEFKGERKRFAPEEISSMVL 124

Query: 443 TKMKETAEAYL-GKLCRMQLSRFRVLQ*LSKTSHKRCRYHLWLE--RSPNHQ*TDCCCDC 613
           TKM+E AE YL GK+    ++         + + K       L   R  N          
Sbjct: 125 TKMREIAEVYLGGKVKDAVVTVPAYFNDSQRQATKDAGSIAGLNVLRIINEPTAAALAYG 184

Query: 614 LRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDG-IFEVKSTAGDT 745
           L    KG        L   GGTFDVS+L+I++G +FEVK+TAGDT
Sbjct: 185 LDKNLKGERNVLIFDL--GGGTFDVSVLSIDEGSLFEVKATAGDT 227


>AF385405-1|AAK67154.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  185 bits (451), Expect = 5e-47
 Identities = 110/206 (53%), Positives = 129/206 (62%), Gaps = 12/206 (5%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT 266
           A+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P  
Sbjct: 3   AIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPRN 62

Query: 267 -----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPF 413
                      +Y  P ++ D+  K    K     G  ++ V           + ++K F
Sbjct: 63  TVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKRF 111

Query: 414 SPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIIN 590
           +P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRIIN
Sbjct: 112 APEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIIN 171

Query: 591 EPTAAAIAYGLDKKGTGERNVLIFDL 668
           EPTAAA+AYGLDK   GERNVLIF+L
Sbjct: 172 EPTAAALAYGLDKNLKGERNVLIFEL 197



 Score =  147 bits (356), Expect = 2e-35
 Identities = 88/168 (52%), Positives = 104/168 (61%), Gaps = 4/168 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG        L   GGTFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKGERNVLIFEL--GGGTFDVSILTIDEGSLFEVRSTAGDT 224


>AE014297-1626|AAF54899.1|  633|Drosophila melanogaster CG7756-PA
           protein.
          Length = 633

 Score =  185 bits (451), Expect = 5e-47
 Identities = 108/202 (53%), Positives = 127/202 (62%), Gaps = 3/202 (1%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M K PA+GIDLGTTYSCVGV+Q+ KVEIIANDQGNRTTPSYVAF +TERLIGD AKNQVA
Sbjct: 1   MGKIPAIGIDLGTTYSCVGVWQNSKVEIIANDQGNRTTPSYVAFNETERLIGDPAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK--TKPFSPRK 425
           M    + ++ +    +  K    K      L    V+    + +  +  K   K F+P +
Sbjct: 61  M--NAKNTVFDAKRLIGRKFDDKKIQEDLKLWPFKVINEKGKPKIEVEFKGERKRFAPEE 118

Query: 426 SVPWCXXXXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
                           L     +      AYFNDSQRQATKDAG+I+GLNVLRIINEPTA
Sbjct: 119 ISSMVLTKMREIAEVYLGGKVKDAVVTVPAYFNDSQRQATKDAGSIAGLNVLRIINEPTA 178

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AA+AYGLDK   GERNVLIFDL
Sbjct: 179 AALAYGLDKNLKGERNVLIFDL 200



 Score =  124 bits (300), Expect = 1e-28
 Identities = 77/165 (46%), Positives = 100/165 (60%), Gaps = 4/165 (2%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVL 442
           NT+FDAKRLIGRKF+D  +Q D+K WPF+V+++ GKPKI+V +KGE K F PEE+SSMVL
Sbjct: 65  NTVFDAKRLIGRKFDDKKIQEDLKLWPFKVINEKGKPKIEVEFKGERKRFAPEEISSMVL 124

Query: 443 TKMKETAEAYL-GKLCRMQLSRFRVLQ*LSKTSHKRCRYHLWLE--RSPNHQ*TDCCCDC 613
           TKM+E AE YL GK+    ++         + + K       L   R  N          
Sbjct: 125 TKMREIAEVYLGGKVKDAVVTVPAYFNDSQRQATKDAGSIAGLNVLRIINEPTAAALAYG 184

Query: 614 LRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDG-IFEVKSTAGDT 745
           L    KG        L   GGTFDVS+L+I++G +FEVK+TAGDT
Sbjct: 185 LDKNLKGERNVLIFDL--GGGTFDVSVLSIDEGSLFEVKATAGDT 227


>J01104-1|AAD15226.1|  641|Drosophila melanogaster hsp70 distal 1
           protein protein.
          Length = 641

 Score =  179 bits (436), Expect = 3e-45
 Identities = 108/207 (52%), Positives = 127/207 (61%), Gaps = 12/207 (5%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPT 263
           PA+GIDLGTTYSCVGV+QHGKVEI A DQGNRTTPSYVAFTD+ERL G+ AKNQVAM P 
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEINAYDQGNRTTPSYVAFTDSERLNGEPAKNQVAMNPR 61

Query: 264 T-----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP 410
                       +Y  P ++ D+  K    K     G  ++ V           + ++K 
Sbjct: 62  NTVFDAKRLIGRKYDDPKIAEDM--KHWPFKVVSDGGKPKIGV---------EYKGESKR 110

Query: 411 FSPRKSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRII 587
           F+P +                L  +  +      AYFNDSQRQATKDAG I+GLNVLRII
Sbjct: 111 FAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRII 170

Query: 588 NEPTAAAIAYGLDKKGTGERNVLIFDL 668
           NEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 171 NEPTAAALAYGLDKNLKGERNVLIFDL 197



 Score =  142 bits (345), Expect = 3e-34
 Identities = 87/169 (51%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETAEAYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224


>L01498-1|AAA28626.1|  656|Drosophila melanogaster heat shock
           protein cognate 72 protein.
          Length = 656

 Score =  167 bits (406), Expect = 1e-41
 Identities = 102/199 (51%), Positives = 123/199 (61%), Gaps = 6/199 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTPTT 266
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+   P  
Sbjct: 32  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP-- 89

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKT----KPFSPRKSVP 434
           + ++ +    +  +                V+E N  S+ HI V T    K F+P +   
Sbjct: 90  ENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKN--SKPHISVDTSQGAKVFAPEEISA 147

Query: 435 WCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 611
                        L            AYFND+QRQATKDAG I+GL V+RIINEPTAAAI
Sbjct: 148 MVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAI 207

Query: 612 AYGLDKKGTGERNVLIFDL 668
           AYGLDKK  GE+NVL+FDL
Sbjct: 208 AYGLDKK-EGEKNVLVFDL 225



 Score = 96.3 bits (229), Expect = 4e-20
 Identities = 46/76 (60%), Positives = 55/76 (72%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR++ D  VQ D+K +PF+VV    KP I V      K F PEE+S+
Sbjct: 88  NPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISA 147

Query: 434 MVLTKMKETAEAYLGK 481
           MVL KMKETAEAYLGK
Sbjct: 148 MVLGKMKETAEAYLGK 163



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV +T GDT
Sbjct: 227 GGTFDVSLLTIDNGVFEVVATNGDT 251


>BT004838-1|AAO45194.1|  655|Drosophila melanogaster RH21402p
           protein.
          Length = 655

 Score =  167 bits (406), Expect = 1e-41
 Identities = 102/199 (51%), Positives = 123/199 (61%), Gaps = 6/199 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTPTT 266
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+   P  
Sbjct: 32  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP-- 89

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKT----KPFSPRKSVP 434
           + ++ +    +  +                V+E N  S+ HI V T    K F+P +   
Sbjct: 90  ENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKN--SKPHISVDTSQGAKVFAPEEISA 147

Query: 435 WCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 611
                        L            AYFND+QRQATKDAG I+GL V+RIINEPTAAAI
Sbjct: 148 MVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAI 207

Query: 612 AYGLDKKGTGERNVLIFDL 668
           AYGLDKK  GE+NVL+FDL
Sbjct: 208 AYGLDKK-EGEKNVLVFDL 225



 Score = 96.3 bits (229), Expect = 4e-20
 Identities = 46/76 (60%), Positives = 55/76 (72%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR++ D  VQ D+K +PF+VV    KP I V      K F PEE+S+
Sbjct: 88  NPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISA 147

Query: 434 MVLTKMKETAEAYLGK 481
           MVL KMKETAEAYLGK
Sbjct: 148 MVLGKMKETAEAYLGK 163



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV +T GDT
Sbjct: 227 GGTFDVSLLTIDNGVFEVVATNGDT 251


>AE014298-1692|AAN09301.1|  656|Drosophila melanogaster CG4147-PD,
           isoform D protein.
          Length = 656

 Score =  167 bits (406), Expect = 1e-41
 Identities = 102/199 (51%), Positives = 123/199 (61%), Gaps = 6/199 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTPTT 266
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+   P  
Sbjct: 32  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP-- 89

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKT----KPFSPRKSVP 434
           + ++ +    +  +                V+E N  S+ HI V T    K F+P +   
Sbjct: 90  ENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKN--SKPHISVDTSQGAKVFAPEEISA 147

Query: 435 WCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 611
                        L            AYFND+QRQATKDAG I+GL V+RIINEPTAAAI
Sbjct: 148 MVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAI 207

Query: 612 AYGLDKKGTGERNVLIFDL 668
           AYGLDKK  GE+NVL+FDL
Sbjct: 208 AYGLDKK-EGEKNVLVFDL 225



 Score = 96.3 bits (229), Expect = 4e-20
 Identities = 46/76 (60%), Positives = 55/76 (72%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR++ D  VQ D+K +PF+VV    KP I V      K F PEE+S+
Sbjct: 88  NPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISA 147

Query: 434 MVLTKMKETAEAYLGK 481
           MVL KMKETAEAYLGK
Sbjct: 148 MVLGKMKETAEAYLGK 163



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV +T GDT
Sbjct: 227 GGTFDVSLLTIDNGVFEVVATNGDT 251


>AE014298-1691|AAN09300.1|  656|Drosophila melanogaster CG4147-PC,
           isoform C protein.
          Length = 656

 Score =  167 bits (406), Expect = 1e-41
 Identities = 102/199 (51%), Positives = 123/199 (61%), Gaps = 6/199 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTPTT 266
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+   P  
Sbjct: 32  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP-- 89

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKT----KPFSPRKSVP 434
           + ++ +    +  +                V+E N  S+ HI V T    K F+P +   
Sbjct: 90  ENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKN--SKPHISVDTSQGAKVFAPEEISA 147

Query: 435 WCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 611
                        L            AYFND+QRQATKDAG I+GL V+RIINEPTAAAI
Sbjct: 148 MVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAI 207

Query: 612 AYGLDKKGTGERNVLIFDL 668
           AYGLDKK  GE+NVL+FDL
Sbjct: 208 AYGLDKK-EGEKNVLVFDL 225



 Score = 96.3 bits (229), Expect = 4e-20
 Identities = 46/76 (60%), Positives = 55/76 (72%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR++ D  VQ D+K +PF+VV    KP I V      K F PEE+S+
Sbjct: 88  NPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISA 147

Query: 434 MVLTKMKETAEAYLGK 481
           MVL KMKETAEAYLGK
Sbjct: 148 MVLGKMKETAEAYLGK 163



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV +T GDT
Sbjct: 227 GGTFDVSLLTIDNGVFEVVATNGDT 251


>AE014298-1690|AAN09299.1|  656|Drosophila melanogaster CG4147-PB,
           isoform B protein.
          Length = 656

 Score =  167 bits (406), Expect = 1e-41
 Identities = 102/199 (51%), Positives = 123/199 (61%), Gaps = 6/199 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTPTT 266
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+   P  
Sbjct: 32  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP-- 89

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKT----KPFSPRKSVP 434
           + ++ +    +  +                V+E N  S+ HI V T    K F+P +   
Sbjct: 90  ENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKN--SKPHISVDTSQGAKVFAPEEISA 147

Query: 435 WCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 611
                        L            AYFND+QRQATKDAG I+GL V+RIINEPTAAAI
Sbjct: 148 MVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAI 207

Query: 612 AYGLDKKGTGERNVLIFDL 668
           AYGLDKK  GE+NVL+FDL
Sbjct: 208 AYGLDKK-EGEKNVLVFDL 225



 Score = 96.3 bits (229), Expect = 4e-20
 Identities = 46/76 (60%), Positives = 55/76 (72%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR++ D  VQ D+K +PF+VV    KP I V      K F PEE+S+
Sbjct: 88  NPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISA 147

Query: 434 MVLTKMKETAEAYLGK 481
           MVL KMKETAEAYLGK
Sbjct: 148 MVLGKMKETAEAYLGK 163



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV +T GDT
Sbjct: 227 GGTFDVSLLTIDNGVFEVVATNGDT 251


>AE014298-1689|AAF48095.1|  656|Drosophila melanogaster CG4147-PA,
           isoform A protein.
          Length = 656

 Score =  167 bits (406), Expect = 1e-41
 Identities = 102/199 (51%), Positives = 123/199 (61%), Gaps = 6/199 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMTPTT 266
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+   P  
Sbjct: 32  IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTADGERLIGDAAKNQLTTNP-- 89

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKT----KPFSPRKSVP 434
           + ++ +    +  +                V+E N  S+ HI V T    K F+P +   
Sbjct: 90  ENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKN--SKPHISVDTSQGAKVFAPEEISA 147

Query: 435 WCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 611
                        L            AYFND+QRQATKDAG I+GL V+RIINEPTAAAI
Sbjct: 148 MVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQVMRIINEPTAAAI 207

Query: 612 AYGLDKKGTGERNVLIFDL 668
           AYGLDKK  GE+NVL+FDL
Sbjct: 208 AYGLDKK-EGEKNVLVFDL 225



 Score = 96.3 bits (229), Expect = 4e-20
 Identities = 46/76 (60%), Positives = 55/76 (72%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR++ D  VQ D+K +PF+VV    KP I V      K F PEE+S+
Sbjct: 88  NPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNSKPHISVDTSQGAKVFAPEEISA 147

Query: 434 MVLTKMKETAEAYLGK 481
           MVL KMKETAEAYLGK
Sbjct: 148 MVLGKMKETAEAYLGK 163



 Score = 43.6 bits (98), Expect = 3e-04
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV +T GDT
Sbjct: 227 GGTFDVSLLTIDNGVFEVVATNGDT 251


>AF350472-1|AAK30229.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  141 bits (342), Expect = 8e-34
 Identities = 86/169 (50%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETA+AYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETADAYLGESITGAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224



 Score =  118 bits (285), Expect = 6e-27
 Identities = 53/59 (89%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFT++ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTESERLIGDPAKNQVAMNP 60



 Score = 97.5 bits (232), Expect = 2e-20
 Identities = 47/53 (88%), Positives = 49/53 (92%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDL 197


>AF350469-1|AAK30226.1|  641|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 641

 Score =  141 bits (342), Expect = 8e-34
 Identities = 86/169 (50%), Positives = 105/169 (62%), Gaps = 5/169 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRK++D  +  DMKHWPF+VVSDGGKPKI V YKGE K F PEE+SS
Sbjct: 59  NPRNTVFDAKRLIGRKYDDPKIAEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISS 118

Query: 434 MVLTKMKETAEAYLGKLCRMQLSRFRVLQ*LSKTSHKRCRYH---LWLERSPNHQ*TDCC 604
           MVLTKMKETA+AYLG+     +         S+    +   H   L + R  N       
Sbjct: 119 MVLTKMKETADAYLGESITGAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL 178

Query: 605 CDCLRS*QKGYWRTKCTYL*PRGG-TFDVSILTIEDG-IFEVKSTAGDT 745
              L    KG    +   +   GG TFDVSILTI++G +FEV+STAGDT
Sbjct: 179 AYGLDKNLKG---ERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDT 224



 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60



 Score = 97.5 bits (232), Expect = 2e-20
 Identities = 47/53 (88%), Positives = 49/53 (92%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 145 AYFNDSQRQATKDAGHIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDL 197


>J01085-1|AAA28629.1|   68|Drosophila melanogaster protein (
           Drosophila melanogasterheat shock cognate (hsc70) gene
           (locus 70C), exon 1. ).
          Length = 68

 Score =  125 bits (302), Expect = 6e-29
 Identities = 58/63 (92%), Positives = 60/63 (95%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQVA
Sbjct: 1   MPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVA 60

Query: 252 MTP 260
           M P
Sbjct: 61  MNP 63


>BT004836-1|AAO45192.1|   73|Drosophila melanogaster RH49358p
           protein.
          Length = 73

 Score =  125 bits (302), Expect = 6e-29
 Identities = 58/63 (92%), Positives = 60/63 (95%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M K PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT++ERLIGDAAKNQVA
Sbjct: 1   MPKLPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVA 60

Query: 252 MTP 260
           M P
Sbjct: 61  MNP 63


>AY032741-1|AAK62473.1|   64|Drosophila melanogaster heat shock
           protein Hsp70Ab protein.
          Length = 64

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF377953-1|AAK54836.1|   64|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 64

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>AF377341-1|AAK54833.1|   64|Drosophila melanogaster heat shock
           protein Hsp70Ba protein.
          Length = 64

 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/59 (91%), Positives = 57/59 (96%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQVAM P
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNP 60


>L01502-1|AAA28628.1|  687|Drosophila melanogaster heat shock
           protein cognate 71 protein.
          Length = 687

 Score =  120 bits (288), Expect = 3e-27
 Identities = 82/200 (41%), Positives = 112/200 (56%), Gaps = 3/200 (1%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ-VA 251
           K   +GIDLGTT SC+ V +  + ++I N +G RTTPS+VAFT D ERL+G  AK Q V 
Sbjct: 51  KGAVIGIDLGTTNSCLAVMEGKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQAVT 110

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSV 431
            +  T Y+   +         + K    T LS   V++A+           K +SP +  
Sbjct: 111 NSANTFYATKRLIGRRFDDPEVKKDI--TNLS-YKVVKASNGDAWVSSTDGKVYSPSQIG 167

Query: 432 PWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
            +            L    + +     AYFNDSQRQATKDAG I+GLNVLR+INEPTAAA
Sbjct: 168 AFILMKMKETAEAYLNTPVKNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAA 227

Query: 609 IAYGLDKKGTGERNVLIFDL 668
           +AYG+DK  T ++ + ++DL
Sbjct: 228 LAYGMDK--TEDKIIAVYDL 245



 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 28/72 (38%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT +  KRLIGR+F+D  V+ D+ +  ++VV +  G   +      + K + P ++ + +
Sbjct: 114 NTFYATKRLIGRRFDDPEVKKDITNLSYKVVKASNGDAWVS---STDGKVYSPSQIGAFI 170

Query: 440 LTKMKETAEAYL 475
           L KMKETAEAYL
Sbjct: 171 LMKMKETAEAYL 182



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL I+ G+FEVKST GDT
Sbjct: 247 GGTFDISILEIQKGVFEVKSTNGDT 271


>AY118844-1|AAM50704.1|  686|Drosophila melanogaster GM13788p
           protein.
          Length = 686

 Score =  120 bits (288), Expect = 3e-27
 Identities = 82/200 (41%), Positives = 112/200 (56%), Gaps = 3/200 (1%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ-VA 251
           K   +GIDLGTT SC+ V +  + ++I N +G RTTPS+VAFT D ERL+G  AK Q V 
Sbjct: 51  KGAVIGIDLGTTNSCLAVMEGKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQAVT 110

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSV 431
            +  T Y+   +         + K    T LS   V++A+           K +SP +  
Sbjct: 111 NSANTFYATKRLIGRRFDDPEVKKDI--TNLS-YKVVKASNGDAWVSSTDGKVYSPSQIG 167

Query: 432 PWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
            +            L    + +     AYFNDSQRQATKDAG I+GLNVLR+INEPTAAA
Sbjct: 168 AFILMKMKETAEAYLNTPVKNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAA 227

Query: 609 IAYGLDKKGTGERNVLIFDL 668
           +AYG+DK  T ++ + ++DL
Sbjct: 228 LAYGMDK--TEDKIIAVYDL 245



 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 28/72 (38%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT +  KRLIGR+F+D  V+ D+ +  ++VV +  G   +      + K + P ++ + +
Sbjct: 114 NTFYATKRLIGRRFDDPEVKKDITNLSYKVVKASNGDAWVS---STDGKVYSPSQIGAFI 170

Query: 440 LTKMKETAEAYL 475
           L KMKETAEAYL
Sbjct: 171 LMKMKETAEAYL 182



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL I+ G+FEVKST GDT
Sbjct: 247 GGTFDISILEIQKGVFEVKSTNGDT 271


>AE013599-1858|AAF58270.1|  686|Drosophila melanogaster CG8542-PA
           protein.
          Length = 686

 Score =  120 bits (288), Expect = 3e-27
 Identities = 82/200 (41%), Positives = 112/200 (56%), Gaps = 3/200 (1%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQ-VA 251
           K   +GIDLGTT SC+ V +  + ++I N +G RTTPS+VAFT D ERL+G  AK Q V 
Sbjct: 51  KGAVIGIDLGTTNSCLAVMEGKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQAVT 110

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSV 431
            +  T Y+   +         + K    T LS   V++A+           K +SP +  
Sbjct: 111 NSANTFYATKRLIGRRFDDPEVKKDI--TNLS-YKVVKASNGDAWVSSTDGKVYSPSQIG 167

Query: 432 PWCXXXXXXXXXXILANCAECSYHG-SAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
            +            L    + +     AYFNDSQRQATKDAG I+GLNVLR+INEPTAAA
Sbjct: 168 AFILMKMKETAEAYLNTPVKNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAA 227

Query: 609 IAYGLDKKGTGERNVLIFDL 668
           +AYG+DK  T ++ + ++DL
Sbjct: 228 LAYGMDK--TEDKIIAVYDL 245



 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 28/72 (38%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT +  KRLIGR+F+D  V+ D+ +  ++VV +  G   +      + K + P ++ + +
Sbjct: 114 NTFYATKRLIGRRFDDPEVKKDITNLSYKVVKASNGDAWVS---STDGKVYSPSQIGAFI 170

Query: 440 LTKMKETAEAYL 475
           L KMKETAEAYL
Sbjct: 171 LMKMKETAEAYL 182



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 19/25 (76%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL I+ G+FEVKST GDT
Sbjct: 247 GGTFDISILEIQKGVFEVKSTNGDT 271


>K01297-1|AAA28630.1|   68|Drosophila melanogaster protein (
           D.melanogaster heatshock cognate 70 gene, locus 87D:
           exon 2. (partial). ).
          Length = 68

 Score =  113 bits (271), Expect = 3e-25
 Identities = 52/61 (85%), Positives = 56/61 (91%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M K PA+GIDLGTTYSCVGV+Q+ KVEIIANDQGNRTTPSYVAF +TERLIGD AKNQVA
Sbjct: 1   MGKIPAIGIDLGTTYSCVGVWQNSKVEIIANDQGNRTTPSYVAFNETERLIGDPAKNQVA 60

Query: 252 M 254
           M
Sbjct: 61  M 61


>AY370940-1|AAQ75092.1|   55|Drosophila melanogaster heat shock
           protein hsp70Bb protein.
          Length = 55

 Score =  112 bits (269), Expect = 6e-25
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQGNRTTPSYVAFTD+ERLIGD AKNQ
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQ 55


>V00213-1|CAA23495.1|  149|Drosophila melanogaster protein (
           Drosophila melanogastergene coding for heat shock
           protein 70. ).
          Length = 149

 Score =  106 bits (254), Expect = 4e-23
 Identities = 52/87 (59%), Positives = 64/87 (73%), Gaps = 1/87 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P+NT F AKRLIGRK++D  +  DMKHWPF+      K +I V YKGE K F PEE+SS
Sbjct: 58  NPSNTAFHAKRLIGRKYDDPKIAEDMKHWPFKAGKRRRKAQIGVEYKGESKRFAPEEISS 117

Query: 434 MVLTKMKET-AEAYLGKLCRMQLSRFR 511
           MVLTKMKET AEAYLG+  + Q S+F+
Sbjct: 118 MVLTKMKETAAEAYLGESPQTQSSQFQ 144



 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 27/29 (93%), Positives = 29/29 (100%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVGVFQHGKVEIIANDQ 170
           PA+GIDLGTTYSCVGV+QHGKVEIIANDQ
Sbjct: 2   PAIGIDLGTTYSCVGVYQHGKVEIIANDQ 30


>BT001277-1|AAN71033.1|  555|Drosophila melanogaster AT07372p
           protein.
          Length = 555

 Score =  103 bits (247), Expect = 3e-22
 Identities = 49/53 (92%), Positives = 51/53 (96%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK+GT ERNVLIFDL
Sbjct: 62  AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTSERNVLIFDL 114



 Score = 91.5 bits (217), Expect = 1e-18
 Identities = 39/50 (78%), Positives = 46/50 (92%)
 Frame = +2

Query: 329 MKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLG 478
           MKHWPFEV ++ GKP+I+V YKGE K+F+PEEVSSMVLTKM+ETAEAYLG
Sbjct: 1   MKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVSSMVLTKMRETAEAYLG 50



 Score = 52.8 bits (121), Expect = 5e-07
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTIEDGIFEVK+TAGDT
Sbjct: 116 GGTFDVSVLTIEDGIFEVKATAGDT 140


>AE014296-2332|AAN11820.1|  555|Drosophila melanogaster CG8937-PD,
           isoform D protein.
          Length = 555

 Score =  103 bits (247), Expect = 3e-22
 Identities = 49/53 (92%), Positives = 51/53 (96%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK+GT ERNVLIFDL
Sbjct: 62  AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTSERNVLIFDL 114



 Score = 91.5 bits (217), Expect = 1e-18
 Identities = 39/50 (78%), Positives = 46/50 (92%)
 Frame = +2

Query: 329 MKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLG 478
           MKHWPFEV ++ GKP+I+V YKGE K+F+PEEVSSMVLTKM+ETAEAYLG
Sbjct: 1   MKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVSSMVLTKMRETAEAYLG 50



 Score = 52.8 bits (121), Expect = 5e-07
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTIEDGIFEVK+TAGDT
Sbjct: 116 GGTFDVSVLTIEDGIFEVKATAGDT 140


>AE014296-2331|AAN11819.1|  555|Drosophila melanogaster CG8937-PC,
           isoform C protein.
          Length = 555

 Score =  103 bits (247), Expect = 3e-22
 Identities = 49/53 (92%), Positives = 51/53 (96%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDK+GT ERNVLIFDL
Sbjct: 62  AYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTSERNVLIFDL 114



 Score = 91.5 bits (217), Expect = 1e-18
 Identities = 39/50 (78%), Positives = 46/50 (92%)
 Frame = +2

Query: 329 MKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLG 478
           MKHWPFEV ++ GKP+I+V YKGE K+F+PEEVSSMVLTKM+ETAEAYLG
Sbjct: 1   MKHWPFEVFAENGKPRIRVEYKGERKSFYPEEVSSMVLTKMRETAEAYLG 50



 Score = 52.8 bits (121), Expect = 5e-07
 Identities = 23/25 (92%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTIEDGIFEVK+TAGDT
Sbjct: 116 GGTFDVSVLTIEDGIFEVKATAGDT 140


>J02569-1|AAA28631.1|  104|Drosophila melanogaster protein (
           D.melanogaster heatshock cognate 70 gene, locus 88E
           (partial). ).
          Length = 104

 Score = 78.6 bits (185), Expect = 8e-15
 Identities = 34/43 (79%), Positives = 38/43 (88%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIK 382
           +P  TIFDAKRLIGRKF+DA VQ+DMKHWPFEVVS  GKPKI+
Sbjct: 42  NPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIE 84



 Score = 70.1 bits (164), Expect = 3e-12
 Identities = 41/64 (64%), Positives = 43/64 (67%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M+KAPAVGIDLGTTYSCVGV                    YVAFTDTERLIGDAAKN+VA
Sbjct: 1   MSKAPAVGIDLGTTYSCVGV--------------------YVAFTDTERLIGDAAKNEVA 40

Query: 252 MTPT 263
           M PT
Sbjct: 41  MNPT 44


>AJ132829-1|CAB38172.2|  804|Drosophila melanogaster heatshock
           protein cognate 70Cb protein.
          Length = 804

 Score = 74.9 bits (176), Expect = 1e-13
 Identities = 57/197 (28%), Positives = 89/197 (45%), Gaps = 5/197 (2%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN-QVAMTPTT 266
           +GID G     V   + G++E +AND   R TPS+VAF   +R+IG AAKN QV     T
Sbjct: 4   IGIDFGNESCYVAAARSGEIETLANDYSLRATPSFVAFDGKKRIIGVAAKNQQVTNMKNT 63

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
                 +     +   +     S      +  + ++  + +   + + F P +       
Sbjct: 64  VGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAMLFT 123

Query: 447 XXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    +     +C      +F +++R+A  DA  I+GLNVLR++NE TA A+AYG 
Sbjct: 124 KLKETSAAAMQTQVNDCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNETTATALAYGF 183

Query: 624 DKKGTGE---RNVLIFD 665
            K    E   RNV+  D
Sbjct: 184 YKNDLFEDKPRNVIFVD 200



 Score = 62.9 bits (146), Expect = 4e-10
 Identities = 33/70 (47%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KRL+GRKF D  VQ ++   P  V + G G   IKV Y GED+ F PE++++M+
Sbjct: 62  NTVGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAML 121

Query: 440 LTKMKETAEA 469
            TK+KET+ A
Sbjct: 122 FTKLKETSAA 131


>AY058632-1|AAL13861.1|  804|Drosophila melanogaster LD32979p
           protein.
          Length = 804

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 57/197 (28%), Positives = 88/197 (44%), Gaps = 5/197 (2%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN-QVAMTPTT 266
           +GID G     V   + G +E +AND   R TPS+VAF   +R+IG AAKN QV     T
Sbjct: 4   IGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAFDGKKRIIGVAAKNQQVTNMKNT 63

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
                 +     +   +     S      +  + ++  + +   + + F P +       
Sbjct: 64  VGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAMLFT 123

Query: 447 XXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    +     +C      +F +++R+A  DA  I+GLNVLR++NE TA A+AYG 
Sbjct: 124 KLKETSAAAMQTQVNDCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNETTATALAYGF 183

Query: 624 DKKGTGE---RNVLIFD 665
            K    E   RNV+  D
Sbjct: 184 YKNDLFEDKPRNVIFVD 200



 Score = 62.9 bits (146), Expect = 4e-10
 Identities = 33/70 (47%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KRL+GRKF D  VQ ++   P  V + G G   IKV Y GED+ F PE++++M+
Sbjct: 62  NTVGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAML 121

Query: 440 LTKMKETAEA 469
            TK+KET+ A
Sbjct: 122 FTKLKETSAA 131


>AE014296-2350|AAN11823.1|  804|Drosophila melanogaster CG6603-PC,
           isoform C protein.
          Length = 804

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 57/197 (28%), Positives = 88/197 (44%), Gaps = 5/197 (2%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN-QVAMTPTT 266
           +GID G     V   + G +E +AND   R TPS+VAF   +R+IG AAKN QV     T
Sbjct: 4   IGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAFDGKKRIIGVAAKNQQVTNMKNT 63

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
                 +     +   +     S      +  + ++  + +   + + F P +       
Sbjct: 64  VGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAMLFT 123

Query: 447 XXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    +     +C      +F +++R+A  DA  I+GLNVLR++NE TA A+AYG 
Sbjct: 124 KLKETSAAAMQTQVNDCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNETTATALAYGF 183

Query: 624 DKKGTGE---RNVLIFD 665
            K    E   RNV+  D
Sbjct: 184 YKNDLFEDKPRNVIFVD 200



 Score = 62.9 bits (146), Expect = 4e-10
 Identities = 33/70 (47%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KRL+GRKF D  VQ ++   P  V + G G   IKV Y GED+ F PE++++M+
Sbjct: 62  NTVGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAML 121

Query: 440 LTKMKETAEA 469
            TK+KET+ A
Sbjct: 122 FTKLKETSAA 131


>AE014296-2349|AAF49767.1|  804|Drosophila melanogaster CG6603-PB,
           isoform B protein.
          Length = 804

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 57/197 (28%), Positives = 88/197 (44%), Gaps = 5/197 (2%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN-QVAMTPTT 266
           +GID G     V   + G +E +AND   R TPS+VAF   +R+IG AAKN QV     T
Sbjct: 4   IGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAFDGKKRIIGVAAKNQQVTNMKNT 63

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
                 +     +   +     S      +  + ++  + +   + + F P +       
Sbjct: 64  VGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAMLFT 123

Query: 447 XXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    +     +C      +F +++R+A  DA  I+GLNVLR++NE TA A+AYG 
Sbjct: 124 KLKETSAAAMQTQVNDCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNETTATALAYGF 183

Query: 624 DKKGTGE---RNVLIFD 665
            K    E   RNV+  D
Sbjct: 184 YKNDLFEDKPRNVIFVD 200



 Score = 62.9 bits (146), Expect = 4e-10
 Identities = 33/70 (47%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KRL+GRKF D  VQ ++   P  V + G G   IKV Y GED+ F PE++++M+
Sbjct: 62  NTVGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAML 121

Query: 440 LTKMKETAEA 469
            TK+KET+ A
Sbjct: 122 FTKLKETSAA 131


>AE014296-2348|AAF49766.1|  804|Drosophila melanogaster CG6603-PA,
           isoform A protein.
          Length = 804

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 57/197 (28%), Positives = 88/197 (44%), Gaps = 5/197 (2%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN-QVAMTPTT 266
           +GID G     V   + G +E +AND   R TPS+VAF   +R+IG AAKN QV     T
Sbjct: 4   IGIDFGNESCYVAAARSGGIETLANDYSLRATPSFVAFDGKKRIIGVAAKNQQVTNMKNT 63

Query: 267 QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSVPWCXX 446
                 +     +   +     S      +  + ++  + +   + + F P +       
Sbjct: 64  VGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAMLFT 123

Query: 447 XXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL 623
                    +     +C      +F +++R+A  DA  I+GLNVLR++NE TA A+AYG 
Sbjct: 124 KLKETSAAAMQTQVNDCVIACPVFFTNAERKALLDAAQIAGLNVLRLMNETTATALAYGF 183

Query: 624 DKKGTGE---RNVLIFD 665
            K    E   RNV+  D
Sbjct: 184 YKNDLFEDKPRNVIFVD 200



 Score = 62.9 bits (146), Expect = 4e-10
 Identities = 33/70 (47%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMV 439
           NT+   KRL+GRKF D  VQ ++   P  V + G G   IKV Y GED+ F PE++++M+
Sbjct: 62  NTVGGFKRLLGRKFNDPHVQHELTSIPARVEARGDGSIGIKVNYLGEDQHFGPEQLTAML 121

Query: 440 LTKMKETAEA 469
            TK+KET+ A
Sbjct: 122 FTKLKETSAA 131


>AY094705-1|AAM11058.1|  923|Drosophila melanogaster GH11566p
           protein.
          Length = 923

 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 50/221 (22%), Positives = 91/221 (41%), Gaps = 7/221 (3%)
 Frame = +3

Query: 81  APAVGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           A  + +DLG+ +  VGV   G  +EI  N +  R TP+ +AF D  R IG+ A+      
Sbjct: 20  AAVMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAFRDGTRTIGEDAQTIGIKD 79

Query: 258 PTTQ--YSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSV 431
           P +   Y +  +   + + ++          + +   E N       +  T  FS  + V
Sbjct: 80  PNSAYGYLLDLLGKTIDNPIVDLYRKRFPYYNIVGDPERNTVV--FRKSDTDEFSVEELV 137

Query: 432 PWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
                         +     EC      YF  ++R+A   A  ++ L VL++IN+  A A
Sbjct: 138 AQLLVKAKQFAQESVQQPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLINDYAAVA 197

Query: 609 IAYGLDKKGTGERNV---LIFDLAAVPSTCPSLPSRMVSSR 722
           + YG+  +G         L +D+ A  ++   +  ++V  +
Sbjct: 198 LNYGVFHRGEINETAQYFLFYDMGAYKTSAAVVSYQLVKDK 238



 Score = 29.9 bits (64), Expect = 3.8
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +2

Query: 236 QEPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWP-FEVVSDGGKPKIKVAYKGEDKTF 412
           Q  G  DPN+       L+G+  ++  V    K +P + +V D  +  + V  K +   F
Sbjct: 73  QTIGIKDPNSAYGYLLDLLGKTIDNPIVDLYRKRFPYYNIVGDPERNTV-VFRKSDTDEF 131

Query: 413 FPEEVSSMVLTKMKETAE 466
             EE+ + +L K K+ A+
Sbjct: 132 SVEELVAQLLVKAKQFAQ 149


>AL009196-3|CAA15711.1|  923|Drosophila melanogaster EG:25E8.1
           protein.
          Length = 923

 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 50/221 (22%), Positives = 91/221 (41%), Gaps = 7/221 (3%)
 Frame = +3

Query: 81  APAVGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           A  + +DLG+ +  VGV   G  +EI  N +  R TP+ +AF D  R IG+ A+      
Sbjct: 20  AAVMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAFRDGTRTIGEDAQTIGIKD 79

Query: 258 PTTQ--YSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSV 431
           P +   Y +  +   + + ++          + +   E N       +  T  FS  + V
Sbjct: 80  PNSAYGYLLDLLGKTIDNPIVDLYRKRFPYYNIVGDPERNTVV--FRKSDTDEFSVEELV 137

Query: 432 PWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
                         +     EC      YF  ++R+A   A  ++ L VL++IN+  A A
Sbjct: 138 AQLLVKAKQFAQESVQQPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLINDYAAVA 197

Query: 609 IAYGLDKKGTGERNV---LIFDLAAVPSTCPSLPSRMVSSR 722
           + YG+  +G         L +D+ A  ++   +  ++V  +
Sbjct: 198 LNYGVFHRGEINETAQYFLFYDMGAYKTSAAVVSYQLVKDK 238



 Score = 29.9 bits (64), Expect = 3.8
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +2

Query: 236 QEPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWP-FEVVSDGGKPKIKVAYKGEDKTF 412
           Q  G  DPN+       L+G+  ++  V    K +P + +V D  +  + V  K +   F
Sbjct: 73  QTIGIKDPNSAYGYLLDLLGKTIDNPIVDLYRKRFPYYNIVGDPERNTV-VFRKSDTDEF 131

Query: 413 FPEEVSSMVLTKMKETAE 466
             EE+ + +L K K+ A+
Sbjct: 132 SVEELVAQLLVKAKQFAQ 149


>AE014298-378|AAF45769.1|  923|Drosophila melanogaster CG2918-PA
           protein.
          Length = 923

 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 50/221 (22%), Positives = 91/221 (41%), Gaps = 7/221 (3%)
 Frame = +3

Query: 81  APAVGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           A  + +DLG+ +  VGV   G  +EI  N +  R TP+ +AF D  R IG+ A+      
Sbjct: 20  AAVMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAFRDGTRTIGEDAQTIGIKD 79

Query: 258 PTTQ--YSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRKSV 431
           P +   Y +  +   + + ++          + +   E N       +  T  FS  + V
Sbjct: 80  PNSAYGYLLDLLGKTIDNPIVDLYRKRFPYYNIVGDPERNTVV--FRKSDTDEFSVEELV 137

Query: 432 PWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
                         +     EC      YF  ++R+A   A  ++ L VL++IN+  A A
Sbjct: 138 AQLLVKAKQFAQESVQQPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLINDYAAVA 197

Query: 609 IAYGLDKKGTGERNV---LIFDLAAVPSTCPSLPSRMVSSR 722
           + YG+  +G         L +D+ A  ++   +  ++V  +
Sbjct: 198 LNYGVFHRGEINETAQYFLFYDMGAYKTSAAVVSYQLVKDK 238



 Score = 29.9 bits (64), Expect = 3.8
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +2

Query: 236 QEPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWP-FEVVSDGGKPKIKVAYKGEDKTF 412
           Q  G  DPN+       L+G+  ++  V    K +P + +V D  +  + V  K +   F
Sbjct: 73  QTIGIKDPNSAYGYLLDLLGKTIDNPIVDLYRKRFPYYNIVGDPERNTV-VFRKSDTDEF 131

Query: 413 FPEEVSSMVLTKMKETAE 466
             EE+ + +L K K+ A+
Sbjct: 132 SVEELVAQLLVKAKQFAQ 149


>AJ132811-1|CAA10789.1|   46|Drosophila melanogaster hsp70 protein.
          Length = 46

 Score = 36.3 bits (80), Expect = 0.044
 Identities = 17/43 (39%), Positives = 24/43 (55%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTER 218
           +GID G     V   + G++E +AND   R T S+VAF   +R
Sbjct: 4   IGIDFGNESCYVAARRSGEIETLANDYSLRATRSFVAFDGKKR 46


>AY058504-1|AAL13733.1|  513|Drosophila melanogaster LD21269p
           protein.
          Length = 513

 Score = 35.9 bits (79), Expect = 0.058
 Identities = 16/46 (34%), Positives = 27/46 (58%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGER 647
           +Y+  S  +   DA   +G +V +II EPTAA + Y + ++ T +R
Sbjct: 161 SYYPASAYKLLADAAQTAGFHVAQIITEPTAAVLGYSIGEEQTEQR 206



 Score = 35.1 bits (77), Expect = 0.10
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 2/61 (3%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVAMT 257
           P  GI +G +  C+  V   GK E+IAN QG+R + + + +     +  G  AK ++A  
Sbjct: 3   PRFGIKIGNSTLCIAHVRADGKAEVIANKQGDRVSQACLLWDGASEIECGLTAKQKMANR 62

Query: 258 P 260
           P
Sbjct: 63  P 63


>AE014296-1427|AAF50438.2|  513|Drosophila melanogaster CG7182-PA
           protein.
          Length = 513

 Score = 35.9 bits (79), Expect = 0.058
 Identities = 16/46 (34%), Positives = 27/46 (58%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGER 647
           +Y+  S  +   DA   +G +V +II EPTAA + Y + ++ T +R
Sbjct: 161 SYYPASAYKLLADAAQTAGFHVAQIITEPTAAVLGYSIGEEQTEQR 206



 Score = 35.1 bits (77), Expect = 0.10
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 2/61 (3%)
 Frame = +3

Query: 84  PAVGIDLGTTYSCVG-VFQHGKVEIIANDQGNRTTPSYVAFTDTERL-IGDAAKNQVAMT 257
           P  GI +G +  C+  V   GK E+IAN QG+R + + + +     +  G  AK ++A  
Sbjct: 3   PRFGIKIGNSTLCIAHVRADGKAEVIANKQGDRVSQACLLWDGASEIECGLTAKQKMANR 62

Query: 258 P 260
           P
Sbjct: 63  P 63


>BT030114-1|ABN49253.1|  342|Drosophila melanogaster IP08073p
           protein.
          Length = 342

 Score = 31.1 bits (67), Expect = 1.7
 Identities = 12/38 (31%), Positives = 21/38 (55%)
 Frame = -3

Query: 221 ETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARVRG 108
           +T  + +  +   GP  +V+  DLH P++ DTN  + G
Sbjct: 125 DTENLIKNTLPPEGPSKIVLPGDLHTPIIPDTNEVING 162


>S61883-1|AAB26991.2| 2068|Drosophila melanogaster transcription
           factor TFIID 230kda subunit protein.
          Length = 2068

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +2

Query: 305 EDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKT 409
           +DA +     HW  +VV DG   K KV  K   KT
Sbjct: 411 DDAFLMVSQLHWEDDVVWDGNDIKAKVLQKLNSKT 445


>BT024196-1|ABC86258.1| 1964|Drosophila melanogaster RE63802p
           protein.
          Length = 1964

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +2

Query: 305 EDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKT 409
           +DA +     HW  +VV DG   K KV  K   KT
Sbjct: 408 DDAFLMVSQLHWEDDVVWDGNDIKAKVLQKLNSKT 442


>BT004888-1|AAO47866.1| 2096|Drosophila melanogaster RE74933p
           protein.
          Length = 2096

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +2

Query: 305 EDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKT 409
           +DA +     HW  +VV DG   K KV  K   KT
Sbjct: 408 DDAFLMVSQLHWEDDVVWDGNDIKAKVLQKLNSKT 442


>AE014297-3612|AAN14014.1|  118|Drosophila melanogaster CG31172-PA
           protein.
          Length = 118

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 18/65 (27%), Positives = 28/65 (43%)
 Frame = -3

Query: 281 WHRILCCWGHRHLVLGGISDETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARVRGTQ 102
           WHR+ C W  + L + G  D T   C       G +++ +  D H+P     N+   G Q
Sbjct: 58  WHRVDCAW--KLLQMQG--DGTFASCNDG---QGHLSVFLATDNHIPTRSLNNSSAFGIQ 110

Query: 101 IDSYC 87
            +  C
Sbjct: 111 RNGTC 115


>AE014297-491|AAF54102.3| 2065|Drosophila melanogaster CG17603-PA,
           isoform A protein.
          Length = 2065

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +2

Query: 305 EDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKT 409
           +DA +     HW  +VV DG   K KV  K   KT
Sbjct: 408 DDAFLMVSQLHWEDDVVWDGNDIKAKVLQKLNSKT 442


>AE014297-490|AAS65117.1| 2098|Drosophila melanogaster CG17603-PC,
           isoform C protein.
          Length = 2098

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +2

Query: 305 EDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKT 409
           +DA +     HW  +VV DG   K KV  K   KT
Sbjct: 408 DDAFLMVSQLHWEDDVVWDGNDIKAKVLQKLNSKT 442


>AE014297-489|AAS65116.1| 2129|Drosophila melanogaster CG17603-PB,
           isoform B protein.
          Length = 2129

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +2

Query: 305 EDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKT 409
           +DA +     HW  +VV DG   K KV  K   KT
Sbjct: 408 DDAFLMVSQLHWEDDVVWDGNDIKAKVLQKLNSKT 442


>AE001572-25|AAD19815.1| 2065|Drosophila melanogaster transcription
           factor protein.
          Length = 2065

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = +2

Query: 305 EDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKT 409
           +DA +     HW  +VV DG   K KV  K   KT
Sbjct: 408 DDAFLMVSQLHWEDDVVWDGNDIKAKVLQKLNSKT 442


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 37,501,494
Number of Sequences: 53049
Number of extensions: 868575
Number of successful extensions: 3036
Number of sequences better than 10.0: 164
Number of HSP's better than 10.0 without gapping: 2311
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2905
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3375989364
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -