SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30166.Seq
         (892 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U18973-1|AAA86480.1|  496|Drosophila melanogaster protein disulf...   126   4e-29
BT003181-1|AAO24936.1|  389|Drosophila melanogaster RH09122p pro...   126   4e-29
BT001544-1|AAN71299.1|  496|Drosophila melanogaster RE10429p pro...   126   4e-29
AE014296-2484|AAF49659.1|  496|Drosophila melanogaster CG6988-PA...   126   4e-29
DQ062786-1|AAY56659.1|  489|Drosophila melanogaster Erp60 protein.     69   1e-11
AE013599-1355|AAF58609.2|  489|Drosophila melanogaster CG8983-PA...    69   1e-11
AY061349-1|AAL28897.1|  433|Drosophila melanogaster LD28038p pro...    62   8e-10
AE014134-2713|AAF53532.1|  433|Drosophila melanogaster CG5809-PA...    62   8e-10
BT012439-1|AAS93710.1|  190|Drosophila melanogaster RH14470p pro...    60   5e-09
BT011488-1|AAR99146.1|  190|Drosophila melanogaster LD08219p pro...    60   5e-09
AE014296-2485|AAN11793.1|  190|Drosophila melanogaster CG6988-PD...    60   5e-09
AY058697-1|AAL13926.1|  412|Drosophila melanogaster LD41494p pro...    58   2e-08
AY052131-1|AAK93555.1|  510|Drosophila melanogaster SD08104p pro...    58   2e-08
AE014298-2355|AAN09391.1|  375|Drosophila melanogaster CG9911-PC...    58   2e-08
AE014298-2354|AAF48579.2|  412|Drosophila melanogaster CG9911-PD...    58   2e-08
AE014298-2353|AAN09390.1|  412|Drosophila melanogaster CG9911-PB...    58   2e-08
AE014298-2352|AAF48580.2|  412|Drosophila melanogaster CG9911-PA...    58   2e-08
AE014134-2339|AAF53293.1|  510|Drosophila melanogaster CG9302-PA...    58   2e-08
AY060296-1|AAL25335.1|  364|Drosophila melanogaster GH13982p pro...    56   5e-08
AE013599-1356|AAM68697.1|  364|Drosophila melanogaster CG8983-PB...    56   5e-08
AY051696-1|AAK93120.1|  430|Drosophila melanogaster LD24073p pro...    54   2e-07
AE014296-2661|AAF49525.3|  430|Drosophila melanogaster CG5027-PA...    54   2e-07
AY051709-1|AAK93133.1|  416|Drosophila melanogaster LD24756p pro...    50   4e-06
AE014298-1673|AAF48082.2|  416|Drosophila melanogaster CG1837-PA...    50   4e-06
AE014297-599|AAF54029.1|  410|Drosophila melanogaster CG10029-PA...    46   5e-05
AF216975-1|AAF34749.1|  857|Drosophila melanogaster l(2)01289 H9...    43   7e-04
AF216973-2|AAF34747.1|  857|Drosophila melanogaster l(2)01289 H9...    43   7e-04
AF216973-1|AAF34746.1| 1703|Drosophila melanogaster l(2)01289 lo...    43   7e-04
AE013599-216|AAM70821.2|  857|Drosophila melanogaster CG9432-PA,...    43   7e-04
AE013599-215|ABI31026.1| 1855|Drosophila melanogaster CG9432-PD,...    43   7e-04
AE013599-214|AAN16126.1| 1703|Drosophila melanogaster CG9432-PB,...    43   7e-04
BT004854-1|AAO45210.1|  637|Drosophila melanogaster RE62692p pro...    42   9e-04
AE013599-1673|AAF58400.1|  637|Drosophila melanogaster CG4670-PA...    42   9e-04
BT023024-1|AAY55440.1|  139|Drosophila melanogaster IP04051p pro...    42   0.002
BT022989-1|AAY55405.1|  139|Drosophila melanogaster IP04151p pro...    42   0.002
AE014296-2414|AAF49714.1|  139|Drosophila melanogaster CG13473-P...    42   0.002
AF216977-1|AAF34751.1|  432|Drosophila melanogaster l(2)01289 lo...    40   0.003
AF216976-1|AAF34750.1|  758|Drosophila melanogaster l(2)01289 lo...    40   0.003
AE013599-213|ABI31025.1|  884|Drosophila melanogaster CG9432-PE,...    40   0.003
AY089550-1|AAL90288.1|  287|Drosophila melanogaster LD26837p pro...    39   0.008
AF143404-1|AAF66635.1|  287|Drosophila melanogaster thioredoxin-...    39   0.008
AE014296-996|AAF50750.1|  287|Drosophila melanogaster CG5495-PA ...    39   0.008
BT001615-1|AAN71370.1|  729|Drosophila melanogaster RE34119p pro...    39   0.011
AY071406-1|AAL49028.1|  142|Drosophila melanogaster RE49388p pro...    38   0.025
AE014296-444|AAF47638.1|  142|Drosophila melanogaster CG8993-PA ...    38   0.025
AF220362-1|AAF37263.1|  106|Drosophila melanogaster thioredoxin ...    37   0.033
AE014298-718|AAF46018.2|  157|Drosophila melanogaster CG3315-PA ...    37   0.033
AE014134-1667|AAN10701.1|  106|Drosophila melanogaster CG31884-P...    37   0.033
AE014134-1666|AAN10700.1|  106|Drosophila melanogaster CG31884-P...    37   0.033
AJ507731-1|CAD45644.1|  157|Drosophila melanogaster thioredoxinT...    37   0.043
AF216974-1|AAF34748.1|  566|Drosophila melanogaster l(2)01289 lo...    37   0.043
AY118750-1|AAM50610.1|  323|Drosophila melanogaster GH07506p pro...    36   0.057
AY070811-1|AAL48433.1|  145|Drosophila melanogaster AT22380p pro...    36   0.057
AE013599-3698|AAF47072.1|  323|Drosophila melanogaster CG5554-PA...    36   0.057
AE013599-2952|AAF57518.2|  145|Drosophila melanogaster CG8517-PA...    36   0.057
AY060458-1|AAL25497.1|  114|Drosophila melanogaster SD03042p pro...    36   0.075
BT012482-1|AAS93753.1|  245|Drosophila melanogaster RE10237p pro...    33   0.53 
AY095006-1|AAM11334.1|  302|Drosophila melanogaster GH08893p pro...    33   0.53 
AE014297-3697|AAN14034.1|  245|Drosophila melanogaster CG11790-P...    33   0.53 
AE014297-3696|AAF56385.2|  302|Drosophila melanogaster CG11790-P...    33   0.53 
AY119573-1|AAM50227.1|  160|Drosophila melanogaster LD03613p pro...    33   0.70 
AL023893-3|CAA19652.1|  160|Drosophila melanogaster EG:132E8.3 p...    33   0.70 
AE014298-194|AAF45615.1|  160|Drosophila melanogaster CG3719-PA ...    33   0.70 
AE014296-2483|AAN11792.1|  175|Drosophila melanogaster CG6988-PB...    32   1.2  
L27072-1|AAA28937.1|  107|Drosophila melanogaster thioredoxin-li...    31   2.1  
AE014298-719|AAF46019.1|  107|Drosophila melanogaster CG4193-PA ...    31   2.1  
M30413-1|AAA28459.1|  742|Drosophila melanogaster protein ( D.me...    30   4.9  
M30149-1|AAA28454.1|  934|Drosophila melanogaster protein ( D.me...    30   4.9  
M30148-1|AAA28458.1|  894|Drosophila melanogaster protein ( D.me...    30   4.9  
M30147-1|AAA28456.1|  894|Drosophila melanogaster protein ( D.me...    30   4.9  
M27124-1|AAA28457.1|  894|Drosophila melanogaster protein ( D.me...    30   4.9  
M27120-1|AAA28455.1| 1088|Drosophila melanogaster protein ( D.me...    30   4.9  
BT004881-1|AAO45237.1|  894|Drosophila melanogaster GH10421p pro...    30   4.9  
AY061514-1|AAL29062.1| 1088|Drosophila melanogaster LD46758p pro...    30   4.9  
AF132175-1|AAD34763.2|  894|Drosophila melanogaster LD21570p pro...    30   4.9  
AE014134-647|AAX52650.1|  934|Drosophila melanogaster CG10033-PJ...    30   4.9  
AE014134-646|AAG22254.1|  934|Drosophila melanogaster CG10033-PE...    30   4.9  
AE014134-645|AAS64616.1|  894|Drosophila melanogaster CG10033-PG...    30   4.9  
AE014134-644|AAS64615.1|  894|Drosophila melanogaster CG10033-PF...    30   4.9  
AE014134-643|AAG22253.1|  894|Drosophila melanogaster CG10033-PD...    30   4.9  
AE014134-642|AAG22252.2|  894|Drosophila melanogaster CG10033-PC...    30   4.9  
AE014134-641|AAG22251.1|  742|Drosophila melanogaster CG10033-PB...    30   4.9  
AE014134-640|AAS64614.1| 1088|Drosophila melanogaster CG10033-PI...    30   4.9  
AE014134-639|AAS64613.1| 1088|Drosophila melanogaster CG10033-PH...    30   4.9  
AE014134-638|AAF51082.2| 1088|Drosophila melanogaster CG10033-PA...    30   4.9  
AE014298-2895|AAF48986.1|  606|Drosophila melanogaster CG14221-P...    29   6.5  

>U18973-1|AAA86480.1|  496|Drosophila melanogaster protein disulfide
           isomerase protein.
          Length = 496

 Score =  126 bits (304), Expect = 4e-29
 Identities = 57/95 (60%), Positives = 71/95 (74%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 429
           + SPIKLAKVDAT E +LAE Y VRGYPTLKFFR+GSP++YSGGRQA DII+W+ KKTGP
Sbjct: 76  KESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGP 135

Query: 430 PAVEVTSAEQAKELIDANTVIVFGFFWTRAQPEPK 534
           PA ++TS   A++ +  N + + GFF      E K
Sbjct: 136 PAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAK 170



 Score = 86.6 bits (205), Expect = 4e-17
 Identities = 38/70 (54%), Positives = 51/70 (72%)
 Frame = +2

Query: 47  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 226
           +F A + +  +   EV  EE VLV +  NF+ +I   E++LVEFYAPWCGHCK+LAPEYA
Sbjct: 8   LFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYA 67

Query: 227 KAATKLAEED 256
           KAA +LAE++
Sbjct: 68  KAAQQLAEKE 77



 Score = 59.7 bits (138), Expect = 5e-09
 Identities = 36/86 (41%), Positives = 51/86 (59%), Gaps = 5/86 (5%)
 Frame = +2

Query: 20  ADNIEMRVLIFTAIALLGLALGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAP 187
           A+ IE  +  F    L    L  E+P + +   V VL  +NFE+V +  ++ +LVEFYAP
Sbjct: 336 AETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAP 395

Query: 188 WCGHCKSLAPEYAKAATKLAE-EDLL 262
           WCGHCK LAP Y + A K  + ED++
Sbjct: 396 WCGHCKQLAPIYDQLAEKYKDNEDIV 421



 Score = 56.0 bits (129), Expect = 7e-08
 Identities = 31/78 (39%), Positives = 44/78 (56%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYX 674
           I F  D  S  AKTF   A  +D  VF + S+  VI + EA+D  VVLFK F++K+  + 
Sbjct: 158 IGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKDNGVVLFKPFDDKKSVF- 216

Query: 675 DEEITEDLLNALGVVQSM 728
           + E+ E+ L     VQS+
Sbjct: 217 EGELNEENLKKFAQVQSL 234



 Score = 34.3 bits (75), Expect = 0.23
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 2/52 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFR--NGSPIDYSGGRQADDIISWL 411
           I +AK+D+T  +   ES  +  +PT+K+FR  +   ID++  R  DD + +L
Sbjct: 420 IVIAKMDSTANE--LESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFL 469


>BT003181-1|AAO24936.1|  389|Drosophila melanogaster RH09122p
           protein.
          Length = 389

 Score =  126 bits (304), Expect = 4e-29
 Identities = 57/95 (60%), Positives = 71/95 (74%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 429
           + SPIKLAKVDAT E +LAE Y VRGYPTLKFFR+GSP++YSGGRQA DII+W+ KKTGP
Sbjct: 76  KESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGP 135

Query: 430 PAVEVTSAEQAKELIDANTVIVFGFFWTRAQPEPK 534
           PA ++TS   A++ +  N + + GFF      E K
Sbjct: 136 PAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAK 170



 Score = 86.6 bits (205), Expect = 4e-17
 Identities = 38/70 (54%), Positives = 51/70 (72%)
 Frame = +2

Query: 47  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 226
           +F A + +  +   EV  EE VLV +  NF+ +I   E++LVEFYAPWCGHCK+LAPEYA
Sbjct: 8   LFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYA 67

Query: 227 KAATKLAEED 256
           KAA +LAE++
Sbjct: 68  KAAQQLAEKE 77



 Score = 56.0 bits (129), Expect = 7e-08
 Identities = 31/78 (39%), Positives = 44/78 (56%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYX 674
           I F  D  S  AKTF   A  +D  VF + S+  VI + EA+D  VVLFK F++K+  + 
Sbjct: 158 IGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKDNGVVLFKPFDDKKSVF- 216

Query: 675 DEEITEDLLNALGVVQSM 728
           + E+ E+ L     VQS+
Sbjct: 217 EGELNEENLKKFAQVQSL 234


>BT001544-1|AAN71299.1|  496|Drosophila melanogaster RE10429p
           protein.
          Length = 496

 Score =  126 bits (304), Expect = 4e-29
 Identities = 57/95 (60%), Positives = 71/95 (74%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 429
           + SPIKLAKVDAT E +LAE Y VRGYPTLKFFR+GSP++YSGGRQA DII+W+ KKTGP
Sbjct: 76  KESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGP 135

Query: 430 PAVEVTSAEQAKELIDANTVIVFGFFWTRAQPEPK 534
           PA ++TS   A++ +  N + + GFF      E K
Sbjct: 136 PAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAK 170



 Score = 86.6 bits (205), Expect = 4e-17
 Identities = 38/70 (54%), Positives = 51/70 (72%)
 Frame = +2

Query: 47  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 226
           +F A + +  +   EV  EE VLV +  NF+ +I   E++LVEFYAPWCGHCK+LAPEYA
Sbjct: 8   LFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYA 67

Query: 227 KAATKLAEED 256
           KAA +LAE++
Sbjct: 68  KAAQQLAEKE 77



 Score = 59.7 bits (138), Expect = 5e-09
 Identities = 36/86 (41%), Positives = 51/86 (59%), Gaps = 5/86 (5%)
 Frame = +2

Query: 20  ADNIEMRVLIFTAIALLGLALGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAP 187
           A+ IE  +  F    L    L  E+P + +   V VL  +NFE+V +  ++ +LVEFYAP
Sbjct: 336 AETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAP 395

Query: 188 WCGHCKSLAPEYAKAATKLAE-EDLL 262
           WCGHCK LAP Y + A K  + ED++
Sbjct: 396 WCGHCKQLAPIYDQLAEKYKDNEDIV 421



 Score = 56.0 bits (129), Expect = 7e-08
 Identities = 31/78 (39%), Positives = 44/78 (56%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYX 674
           I F  D  S  AKTF   A  +D  VF + S+  VI + EA+D  VVLFK F++K+  + 
Sbjct: 158 IGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKDNGVVLFKPFDDKKSVF- 216

Query: 675 DEEITEDLLNALGVVQSM 728
           + E+ E+ L     VQS+
Sbjct: 217 EGELNEENLKKFAQVQSL 234



 Score = 34.3 bits (75), Expect = 0.23
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 2/52 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFR--NGSPIDYSGGRQADDIISWL 411
           I +AK+D+T  +   ES  +  +PT+K+FR  +   ID++  R  DD + +L
Sbjct: 420 IVIAKMDSTANE--LESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFL 469


>AE014296-2484|AAF49659.1|  496|Drosophila melanogaster CG6988-PA,
           isoform A protein.
          Length = 496

 Score =  126 bits (304), Expect = 4e-29
 Identities = 57/95 (60%), Positives = 71/95 (74%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 429
           + SPIKLAKVDAT E +LAE Y VRGYPTLKFFR+GSP++YSGGRQA DII+W+ KKTGP
Sbjct: 76  KESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGP 135

Query: 430 PAVEVTSAEQAKELIDANTVIVFGFFWTRAQPEPK 534
           PA ++TS   A++ +  N + + GFF      E K
Sbjct: 136 PAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAK 170



 Score = 86.6 bits (205), Expect = 4e-17
 Identities = 38/70 (54%), Positives = 51/70 (72%)
 Frame = +2

Query: 47  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 226
           +F A + +  +   EV  EE VLV +  NF+ +I   E++LVEFYAPWCGHCK+LAPEYA
Sbjct: 8   LFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYA 67

Query: 227 KAATKLAEED 256
           KAA +LAE++
Sbjct: 68  KAAQQLAEKE 77



 Score = 59.7 bits (138), Expect = 5e-09
 Identities = 36/86 (41%), Positives = 51/86 (59%), Gaps = 5/86 (5%)
 Frame = +2

Query: 20  ADNIEMRVLIFTAIALLGLALGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAP 187
           A+ IE  +  F    L    L  E+P + +   V VL  +NFE+V +  ++ +LVEFYAP
Sbjct: 336 AETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAP 395

Query: 188 WCGHCKSLAPEYAKAATKLAE-EDLL 262
           WCGHCK LAP Y + A K  + ED++
Sbjct: 396 WCGHCKQLAPIYDQLAEKYKDNEDIV 421



 Score = 56.0 bits (129), Expect = 7e-08
 Identities = 31/78 (39%), Positives = 44/78 (56%)
 Frame = +3

Query: 495 IWFLLDQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYX 674
           I F  D  S  AKTF   A  +D  VF + S+  VI + EA+D  VVLFK F++K+  + 
Sbjct: 158 IGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKDNGVVLFKPFDDKKSVF- 216

Query: 675 DEEITEDLLNALGVVQSM 728
           + E+ E+ L     VQS+
Sbjct: 217 EGELNEENLKKFAQVQSL 234



 Score = 34.3 bits (75), Expect = 0.23
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 2/52 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFR--NGSPIDYSGGRQADDIISWL 411
           I +AK+D+T  +   ES  +  +PT+K+FR  +   ID++  R  DD + +L
Sbjct: 420 IVIAKMDSTANE--LESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFL 469


>DQ062786-1|AAY56659.1|  489|Drosophila melanogaster Erp60 protein.
          Length = 489

 Score = 68.5 bits (160), Expect = 1e-11
 Identities = 33/85 (38%), Positives = 49/85 (57%), Gaps = 2/85 (2%)
 Frame = +1

Query: 259 PIKLAKVDATQE-QDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPP 432
           PIKLAKVD T+  ++    Y V GYPTLK FR      DY+G R+A  I  +++ + GP 
Sbjct: 74  PIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREASGIAKYMRAQVGPA 133

Query: 433 AVEVTSAEQAKELIDANTVIVFGFF 507
           +  V +  + K+ +D     +FG+F
Sbjct: 134 SKTVRTVAELKKFLDTKDTTLFGYF 158



 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 28/52 (53%), Positives = 35/52 (67%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           E++VL L   +F T +   E  LV FYAPWCGHCK L PEYAKAA  + ++D
Sbjct: 21  EQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKDDD 72



 Score = 56.4 bits (130), Expect = 5e-08
 Identities = 26/51 (50%), Positives = 33/51 (64%), Gaps = 1/51 (1%)
 Frame = +2

Query: 110 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           V V    NF+  VI   +  L+EFYAPWCGHCK L+P Y + A KL +ED+
Sbjct: 366 VKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDV 416



 Score = 43.2 bits (97), Expect = 5e-04
 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 3/56 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKK 420
           + + K+DAT   D+   + VRG+PTL +        P+ Y+GGR+ DD + ++ K+
Sbjct: 416 VAIVKMDATAN-DVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKE 470


>AE013599-1355|AAF58609.2|  489|Drosophila melanogaster CG8983-PA,
           isoform A protein.
          Length = 489

 Score = 68.5 bits (160), Expect = 1e-11
 Identities = 33/85 (38%), Positives = 49/85 (57%), Gaps = 2/85 (2%)
 Frame = +1

Query: 259 PIKLAKVDATQE-QDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPP 432
           PIKLAKVD T+  ++    Y V GYPTLK FR      DY+G R+A  I  +++ + GP 
Sbjct: 74  PIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREASGIAKYMRAQVGPA 133

Query: 433 AVEVTSAEQAKELIDANTVIVFGFF 507
           +  V +  + K+ +D     +FG+F
Sbjct: 134 SKTVRTVAELKKFLDTKDTTLFGYF 158



 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 28/52 (53%), Positives = 35/52 (67%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           E++VL L   +F T +   E  LV FYAPWCGHCK L PEYAKAA  + ++D
Sbjct: 21  EQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKDDD 72



 Score = 56.4 bits (130), Expect = 5e-08
 Identities = 26/51 (50%), Positives = 33/51 (64%), Gaps = 1/51 (1%)
 Frame = +2

Query: 110 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           V V    NF+  VI   +  L+EFYAPWCGHCK L+P Y + A KL +ED+
Sbjct: 366 VKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDV 416



 Score = 43.2 bits (97), Expect = 5e-04
 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 3/56 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKK 420
           + + K+DAT   D+   + VRG+PTL +        P+ Y+GGR+ DD + ++ K+
Sbjct: 416 VAIVKMDATAN-DVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKE 470


>AY061349-1|AAL28897.1|  433|Drosophila melanogaster LD28038p
           protein.
          Length = 433

 Score = 62.5 bits (145), Expect = 8e-10
 Identities = 26/48 (54%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query: 104 ENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 244
           ++V+ L++ NF+ ++  ++ I LVEF+APWCGHCK+LAPE+AKAA +L
Sbjct: 156 DDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKEL 203



 Score = 58.8 bits (136), Expect = 9e-09
 Identities = 29/61 (47%), Positives = 35/61 (57%), Gaps = 5/61 (8%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS-----PIDYSGGRQADDIISWLKK 417
           +  +KL  +DAT  Q  A  Y VRGYPT+KFF  GS       +Y GGR A DI+SW   
Sbjct: 204 KGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASD 263

Query: 418 K 420
           K
Sbjct: 264 K 264



 Score = 55.6 bits (128), Expect = 9e-08
 Identities = 24/48 (50%), Positives = 33/48 (68%), Gaps = 1/48 (2%)
 Frame = +2

Query: 104 ENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 244
           + V+ L+ +NF+  +   + I +VEFYAPWCGHC+SL PEY K A  L
Sbjct: 25  DGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKAL 72



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 2/48 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDI 399
           +K+  V+A  +  L+  +GVRG+PT+K F     SP DY+G R A  I
Sbjct: 76  VKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAI 123


>AE014134-2713|AAF53532.1|  433|Drosophila melanogaster CG5809-PA
           protein.
          Length = 433

 Score = 62.5 bits (145), Expect = 8e-10
 Identities = 26/48 (54%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query: 104 ENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 244
           ++V+ L++ NF+ ++  ++ I LVEF+APWCGHCK+LAPE+AKAA +L
Sbjct: 156 DDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKEL 203



 Score = 58.8 bits (136), Expect = 9e-09
 Identities = 29/61 (47%), Positives = 35/61 (57%), Gaps = 5/61 (8%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS-----PIDYSGGRQADDIISWLKK 417
           +  +KL  +DAT  Q  A  Y VRGYPT+KFF  GS       +Y GGR A DI+SW   
Sbjct: 204 KGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASD 263

Query: 418 K 420
           K
Sbjct: 264 K 264



 Score = 55.6 bits (128), Expect = 9e-08
 Identities = 24/48 (50%), Positives = 33/48 (68%), Gaps = 1/48 (2%)
 Frame = +2

Query: 104 ENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 244
           + V+ L+ +NF+  +   + I +VEFYAPWCGHC+SL PEY K A  L
Sbjct: 25  DGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKAL 72



 Score = 41.9 bits (94), Expect = 0.001
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 2/48 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDI 399
           +K+  V+A  +  L+  +GVRG+PT+K F     SP DY+G R A  I
Sbjct: 76  VKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAI 123


>BT012439-1|AAS93710.1|  190|Drosophila melanogaster RH14470p
           protein.
          Length = 190

 Score = 59.7 bits (138), Expect = 5e-09
 Identities = 36/86 (41%), Positives = 51/86 (59%), Gaps = 5/86 (5%)
 Frame = +2

Query: 20  ADNIEMRVLIFTAIALLGLALGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAP 187
           A+ IE  +  F    L    L  E+P + +   V VL  +NFE+V +  ++ +LVEFYAP
Sbjct: 30  AETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAP 89

Query: 188 WCGHCKSLAPEYAKAATKLAE-EDLL 262
           WCGHCK LAP Y + A K  + ED++
Sbjct: 90  WCGHCKQLAPIYDQLAEKYKDNEDIV 115



 Score = 34.3 bits (75), Expect = 0.23
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 2/52 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFR--NGSPIDYSGGRQADDIISWL 411
           I +AK+D+T  +   ES  +  +PT+K+FR  +   ID++  R  DD + +L
Sbjct: 114 IVIAKMDSTANE--LESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFL 163


>BT011488-1|AAR99146.1|  190|Drosophila melanogaster LD08219p
           protein.
          Length = 190

 Score = 59.7 bits (138), Expect = 5e-09
 Identities = 36/86 (41%), Positives = 51/86 (59%), Gaps = 5/86 (5%)
 Frame = +2

Query: 20  ADNIEMRVLIFTAIALLGLALGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAP 187
           A+ IE  +  F    L    L  E+P + +   V VL  +NFE+V +  ++ +LVEFYAP
Sbjct: 30  AETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAP 89

Query: 188 WCGHCKSLAPEYAKAATKLAE-EDLL 262
           WCGHCK LAP Y + A K  + ED++
Sbjct: 90  WCGHCKQLAPIYDQLAEKYKDNEDIV 115



 Score = 34.3 bits (75), Expect = 0.23
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 2/52 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFR--NGSPIDYSGGRQADDIISWL 411
           I +AK+D+T  +   ES  +  +PT+K+FR  +   ID++  R  DD + +L
Sbjct: 114 IVIAKMDSTANE--LESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFL 163


>AE014296-2485|AAN11793.1|  190|Drosophila melanogaster CG6988-PD,
           isoform D protein.
          Length = 190

 Score = 59.7 bits (138), Expect = 5e-09
 Identities = 36/86 (41%), Positives = 51/86 (59%), Gaps = 5/86 (5%)
 Frame = +2

Query: 20  ADNIEMRVLIFTAIALLGLALGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAP 187
           A+ IE  +  F    L    L  E+P + +   V VL  +NFE+V +  ++ +LVEFYAP
Sbjct: 30  AETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAP 89

Query: 188 WCGHCKSLAPEYAKAATKLAE-EDLL 262
           WCGHCK LAP Y + A K  + ED++
Sbjct: 90  WCGHCKQLAPIYDQLAEKYKDNEDIV 115



 Score = 34.3 bits (75), Expect = 0.23
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 2/52 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFR--NGSPIDYSGGRQADDIISWL 411
           I +AK+D+T  +   ES  +  +PT+K+FR  +   ID++  R  DD + +L
Sbjct: 114 IVIAKMDSTANE--LESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFL 163


>AY058697-1|AAL13926.1|  412|Drosophila melanogaster LD41494p
           protein.
          Length = 412

 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 32/91 (35%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPA 435
           + L KVD  +E  +A  + +  YPTLK  RNG  S  +Y G R A+  + ++KK+   P 
Sbjct: 89  VVLGKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPI 148

Query: 436 VEVTSAEQAKELIDANTVIVFGFFWTRAQPE 528
            E  S +  + L D+   ++ G+F  R QPE
Sbjct: 149 QEFKSLKDLENL-DSKKRLILGYFDRRDQPE 178



 Score = 42.3 bits (95), Expect = 9e-04
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           +A+L L    +       + ++  N +  + + E + + FYA WC     LAP +A+AA 
Sbjct: 18  VAILQLLQYTQPADAAGAVPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAAD 77

Query: 239 KLAEE 253
           K+ EE
Sbjct: 78  KIKEE 82


>AY052131-1|AAK93555.1|  510|Drosophila melanogaster SD08104p
           protein.
          Length = 510

 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 24/56 (42%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           +E    + VL L   NF + +   ++ LV FYAPWCGHCK   PE+  AAT L ++
Sbjct: 390 EEEEDSKEVLFLDDDNFSSTLKRKKHALVMFYAPWCGHCKHTKPEFTAAATALQDD 445



 Score = 56.8 bits (131), Expect = 4e-08
 Identities = 22/54 (40%), Positives = 33/54 (61%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           T   ++ L+   FE  +   +  LV FYAPWCGHCK + PEY KAA ++ ++ +
Sbjct: 269 TNSEIVHLTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKI 322



 Score = 52.0 bits (119), Expect = 1e-06
 Identities = 25/61 (40%), Positives = 37/61 (60%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 429
           ++ P  LA +DAT+E  +AE Y V+GYPT+KFF NG        R+A  I+ +++    P
Sbjct: 320 KKIPGLLAALDATKEPSIAEKYKVKGYPTVKFFSNGVFKFEVNVREASKIVEFMRDPKEP 379

Query: 430 P 432
           P
Sbjct: 380 P 380



 Score = 46.0 bits (104), Expect = 7e-05
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEY--ILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +E P  ++VL  S A   T     +   +LV FY PWCG CK + P+Y KA+T+L
Sbjct: 137 EEDPAGKDVLHFSDAASFTKHLRKDIRPMLVMFYVPWCGFCKKMKPDYGKASTEL 191



 Score = 42.3 bits (95), Expect = 9e-04
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 1/51 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRN-GSPIDYSGGRQADDIISWL 411
           I    +D T+   L   Y VRGYPT+ +F    + +DY+GGR + D I+++
Sbjct: 448 IAFVAIDCTKLAALCAKYNVRGYPTILYFSYLKTKLDYNGGRTSKDFIAYM 498



 Score = 30.7 bits (66), Expect = 2.8
 Identities = 17/74 (22%), Positives = 33/74 (44%), Gaps = 1/74 (1%)
 Frame = +1

Query: 277 VDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKTGPPAVEVTSA 453
           V+  +   + + + + G+PTL +F NG     Y G    + ++S++      P  +    
Sbjct: 204 VERQENAPIRKMFNITGFPTLIYFENGKLRFTYEGENNKEALVSFMLNPNAKPTPKPKEP 263

Query: 454 EQAKELIDANTVIV 495
           E +    D N+ IV
Sbjct: 264 EWS---ADTNSEIV 274


>AE014298-2355|AAN09391.1|  375|Drosophila melanogaster CG9911-PC,
           isoform C protein.
          Length = 375

 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 32/91 (35%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPA 435
           + L KVD  +E  +A  + +  YPTLK  RNG  S  +Y G R A+  + ++KK+   P 
Sbjct: 52  VVLGKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPI 111

Query: 436 VEVTSAEQAKELIDANTVIVFGFFWTRAQPE 528
            E  S +  + L D+   ++ G+F  R QPE
Sbjct: 112 QEFKSLKDLENL-DSKKRLILGYFDRRDQPE 141



 Score = 41.1 bits (92), Expect = 0.002
 Identities = 16/45 (35%), Positives = 26/45 (57%)
 Frame = +2

Query: 119 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           ++  N +  + + E + + FYA WC     LAP +A+AA K+ EE
Sbjct: 1   MTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAADKIKEE 45


>AE014298-2354|AAF48579.2|  412|Drosophila melanogaster CG9911-PD,
           isoform D protein.
          Length = 412

 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 32/91 (35%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPA 435
           + L KVD  +E  +A  + +  YPTLK  RNG  S  +Y G R A+  + ++KK+   P 
Sbjct: 89  VVLGKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPI 148

Query: 436 VEVTSAEQAKELIDANTVIVFGFFWTRAQPE 528
            E  S +  + L D+   ++ G+F  R QPE
Sbjct: 149 QEFKSLKDLENL-DSKKRLILGYFDRRDQPE 178



 Score = 42.3 bits (95), Expect = 9e-04
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           +A+L L    +       + ++  N +  + + E + + FYA WC     LAP +A+AA 
Sbjct: 18  VAILQLLQYTQPADAAGAVPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAAD 77

Query: 239 KLAEE 253
           K+ EE
Sbjct: 78  KIKEE 82


>AE014298-2353|AAN09390.1|  412|Drosophila melanogaster CG9911-PB,
           isoform B protein.
          Length = 412

 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 32/91 (35%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPA 435
           + L KVD  +E  +A  + +  YPTLK  RNG  S  +Y G R A+  + ++KK+   P 
Sbjct: 89  VVLGKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPI 148

Query: 436 VEVTSAEQAKELIDANTVIVFGFFWTRAQPE 528
            E  S +  + L D+   ++ G+F  R QPE
Sbjct: 149 QEFKSLKDLENL-DSKKRLILGYFDRRDQPE 178



 Score = 42.3 bits (95), Expect = 9e-04
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           +A+L L    +       + ++  N +  + + E + + FYA WC     LAP +A+AA 
Sbjct: 18  VAILQLLQYTQPADAAGAVPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAAD 77

Query: 239 KLAEE 253
           K+ EE
Sbjct: 78  KIKEE 82


>AE014298-2352|AAF48580.2|  412|Drosophila melanogaster CG9911-PA,
           isoform A protein.
          Length = 412

 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 32/91 (35%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPA 435
           + L KVD  +E  +A  + +  YPTLK  RNG  S  +Y G R A+  + ++KK+   P 
Sbjct: 89  VVLGKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPI 148

Query: 436 VEVTSAEQAKELIDANTVIVFGFFWTRAQPE 528
            E  S +  + L D+   ++ G+F  R QPE
Sbjct: 149 QEFKSLKDLENL-DSKKRLILGYFDRRDQPE 178



 Score = 42.3 bits (95), Expect = 9e-04
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +2

Query: 59  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           +A+L L    +       + ++  N +  + + E + + FYA WC     LAP +A+AA 
Sbjct: 18  VAILQLLQYTQPADAAGAVPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAAD 77

Query: 239 KLAEE 253
           K+ EE
Sbjct: 78  KIKEE 82


>AE014134-2339|AAF53293.1|  510|Drosophila melanogaster CG9302-PA
           protein.
          Length = 510

 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 24/56 (42%), Positives = 33/56 (58%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           +E    + VL L   NF + +   ++ LV FYAPWCGHCK   PE+  AAT L ++
Sbjct: 390 EEEEDSKEVLFLDDDNFSSTLKRKKHALVMFYAPWCGHCKHTKPEFTAAATALQDD 445



 Score = 56.8 bits (131), Expect = 4e-08
 Identities = 22/54 (40%), Positives = 33/54 (61%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           T   ++ L+   FE  +   +  LV FYAPWCGHCK + PEY KAA ++ ++ +
Sbjct: 269 TNSEIVHLTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKI 322



 Score = 52.0 bits (119), Expect = 1e-06
 Identities = 25/61 (40%), Positives = 37/61 (60%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 429
           ++ P  LA +DAT+E  +AE Y V+GYPT+KFF NG        R+A  I+ +++    P
Sbjct: 320 KKIPGLLAALDATKEPSIAEKYKVKGYPTVKFFSNGVFKFEVNVREASKIVEFMRDPKEP 379

Query: 430 P 432
           P
Sbjct: 380 P 380



 Score = 47.2 bits (107), Expect = 3e-05
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEY--ILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +E P  ++VL  S A   T     +   +LV FY PWCG CK + PEY KA+T+L
Sbjct: 137 EEDPAGKDVLHFSDAASFTKHLRKDIRPMLVMFYVPWCGFCKKMKPEYGKASTEL 191



 Score = 42.3 bits (95), Expect = 9e-04
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 1/51 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRN-GSPIDYSGGRQADDIISWL 411
           I    +D T+   L   Y VRGYPT+ +F    + +DY+GGR + D I+++
Sbjct: 448 IAFVAIDCTKLAALCAKYNVRGYPTILYFSYLKTKLDYNGGRTSKDFIAYM 498



 Score = 30.7 bits (66), Expect = 2.8
 Identities = 17/74 (22%), Positives = 33/74 (44%), Gaps = 1/74 (1%)
 Frame = +1

Query: 277 VDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKTGPPAVEVTSA 453
           V+  +   + + + + G+PTL +F NG     Y G    + ++S++      P  +    
Sbjct: 204 VERQENAPIRKMFNITGFPTLIYFENGKLRFTYEGENNKEALVSFMLNPNAKPTPKPKEP 263

Query: 454 EQAKELIDANTVIV 495
           E +    D N+ IV
Sbjct: 264 EWS---ADTNSEIV 274


>AY060296-1|AAL25335.1|  364|Drosophila melanogaster GH13982p
           protein.
          Length = 364

 Score = 56.4 bits (130), Expect = 5e-08
 Identities = 26/51 (50%), Positives = 33/51 (64%), Gaps = 1/51 (1%)
 Frame = +2

Query: 110 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           V V    NF+  VI   +  L+EFYAPWCGHCK L+P Y + A KL +ED+
Sbjct: 241 VKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDV 291



 Score = 43.2 bits (97), Expect = 5e-04
 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 3/56 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKK 420
           + + K+DAT   D+   + VRG+PTL +        P+ Y+GGR+ DD + ++ K+
Sbjct: 291 VAIVKMDATAN-DVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKE 345


>AE013599-1356|AAM68697.1|  364|Drosophila melanogaster CG8983-PB,
           isoform B protein.
          Length = 364

 Score = 56.4 bits (130), Expect = 5e-08
 Identities = 26/51 (50%), Positives = 33/51 (64%), Gaps = 1/51 (1%)
 Frame = +2

Query: 110 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           V V    NF+  VI   +  L+EFYAPWCGHCK L+P Y + A KL +ED+
Sbjct: 241 VKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDV 291



 Score = 43.2 bits (97), Expect = 5e-04
 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 3/56 (5%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKK 420
           + + K+DAT   D+   + VRG+PTL +        P+ Y+GGR+ DD + ++ K+
Sbjct: 291 VAIVKMDATAN-DVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKE 345


>AY051696-1|AAK93120.1|  430|Drosophila melanogaster LD24073p
           protein.
          Length = 430

 Score = 54.4 bits (125), Expect = 2e-07
 Identities = 22/76 (28%), Positives = 42/76 (55%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +++ ++D T+    A+ + VRGYPT+ F +      Y+G R  D+++ +  + +GPP   
Sbjct: 75  VRVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNMEFTYNGDRGRDELVDYALRMSGPPVQL 134

Query: 442 VTSAEQAKELIDANTV 489
           VT  E    L  ++T+
Sbjct: 135 VTRTESVDMLKGSHTI 150



 Score = 39.9 bits (89), Expect = 0.005
 Identities = 28/66 (42%), Positives = 33/66 (50%)
 Frame = +2

Query: 47  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 226
           IF  I+ L L LG        VL LS   F  V    ++ LV FYAPWCG+CK   P +A
Sbjct: 8   IFGLISALLLTLGS-TGLSSKVLELSD-RFIDVRHEGQW-LVMFYAPWCGYCKKTEPIFA 64

Query: 227 KAATKL 244
             A  L
Sbjct: 65  LVAQAL 70


>AE014296-2661|AAF49525.3|  430|Drosophila melanogaster CG5027-PA
           protein.
          Length = 430

 Score = 54.4 bits (125), Expect = 2e-07
 Identities = 22/76 (28%), Positives = 42/76 (55%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +++ ++D T+    A+ + VRGYPT+ F +      Y+G R  D+++ +  + +GPP   
Sbjct: 75  VRVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNMEFTYNGDRGRDELVDYALRMSGPPVQL 134

Query: 442 VTSAEQAKELIDANTV 489
           VT  E    L  ++T+
Sbjct: 135 VTRTESVDMLKGSHTI 150



 Score = 39.9 bits (89), Expect = 0.005
 Identities = 28/66 (42%), Positives = 33/66 (50%)
 Frame = +2

Query: 47  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 226
           IF  I+ L L LG        VL LS   F  V    ++ LV FYAPWCG+CK   P +A
Sbjct: 8   IFGLISALLLTLGS-TGLSSKVLELSD-RFIDVRHEGQW-LVMFYAPWCGYCKKTEPIFA 64

Query: 227 KAATKL 244
             A  L
Sbjct: 65  LVAQAL 70


>AY051709-1|AAK93133.1|  416|Drosophila melanogaster LD24756p
           protein.
          Length = 416

 Score = 50.0 bits (114), Expect = 4e-06
 Identities = 23/72 (31%), Positives = 43/72 (59%), Gaps = 1/72 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 438
           + ++K+D TQ + + + + V+GYPTL +  +G  I+ YSG R    + ++++K  G P +
Sbjct: 217 VTISKIDCTQFRSICQDFEVKGYPTLLWIEDGKKIEKYSGARDLSTLKTYVEKMVGVP-L 275

Query: 439 EVTSAEQAKELI 474
           E T+ E   E +
Sbjct: 276 EKTAGEAGDEKV 287



 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 2/72 (2%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +AKVD T+ Q L  ++ V GYPTL+ F+ G    + + G R    I  ++ K+   PA E
Sbjct: 91  IAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELSAPA-E 149

Query: 442 VTSAEQAKELID 477
               E  +E ++
Sbjct: 150 ADLGEVKREQVE 161



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 18/48 (37%), Positives = 30/48 (62%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           V+ L++  F   ++T  +  V+F+APWC HC+ LAP +   A +L +E
Sbjct: 168 VVDLTEDTFAKHVSTGNHF-VKFFAPWCSHCQRLAPTWEDLAKELIKE 214



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 3/61 (4%)
 Frame = +1

Query: 253 RSPIKLAKVDAT--QEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKT 423
           +S +K+AKVD T  + + +     V GYPTL  ++NG    +Y G R   ++ ++LKK  
Sbjct: 352 QSSVKIAKVDCTAPENKQVCIDQQVEGYPTLFLYKNGQRQNEYEGSRSLPELQAYLKKFL 411

Query: 424 G 426
           G
Sbjct: 412 G 412



 Score = 41.1 bits (92), Expect = 0.002
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAATK 241
           ++FYAPWCGHC+ L P + + AT+
Sbjct: 324 IKFYAPWCGHCQKLQPTWEQLATE 347



 Score = 39.9 bits (89), Expect = 0.005
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +2

Query: 119 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           L    F+T I     + V+F+APWCGHCK + P + + A
Sbjct: 42  LDPETFDTAIAGGN-VFVKFFAPWCGHCKRIQPLWEQLA 79


>AE014298-1673|AAF48082.2|  416|Drosophila melanogaster CG1837-PA
           protein.
          Length = 416

 Score = 50.0 bits (114), Expect = 4e-06
 Identities = 23/72 (31%), Positives = 43/72 (59%), Gaps = 1/72 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 438
           + ++K+D TQ + + + + V+GYPTL +  +G  I+ YSG R    + ++++K  G P +
Sbjct: 217 VTISKIDCTQFRSICQDFEVKGYPTLLWIEDGKKIEKYSGARDLSTLKTYVEKMVGVP-L 275

Query: 439 EVTSAEQAKELI 474
           E T+ E   E +
Sbjct: 276 EKTAGEAGDEKV 287



 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 2/72 (2%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPAVE 441
           +AKVD T+ Q L  ++ V GYPTL+ F+ G    + + G R    I  ++ K+   PA E
Sbjct: 91  IAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELSAPA-E 149

Query: 442 VTSAEQAKELID 477
               E  +E ++
Sbjct: 150 ADLGEVKREQVE 161



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 18/48 (37%), Positives = 30/48 (62%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           V+ L++  F   ++T  +  V+F+APWC HC+ LAP +   A +L +E
Sbjct: 168 VVDLTEDTFAKHVSTGNHF-VKFFAPWCSHCQRLAPTWEDLAKELIKE 214



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 3/61 (4%)
 Frame = +1

Query: 253 RSPIKLAKVDAT--QEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKT 423
           +S +K+AKVD T  + + +     V GYPTL  ++NG    +Y G R   ++ ++LKK  
Sbjct: 352 QSSVKIAKVDCTAPENKQVCIDQQVEGYPTLFLYKNGQRQNEYEGSRSLPELQAYLKKFL 411

Query: 424 G 426
           G
Sbjct: 412 G 412



 Score = 41.1 bits (92), Expect = 0.002
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAATK 241
           ++FYAPWCGHC+ L P + + AT+
Sbjct: 324 IKFYAPWCGHCQKLQPTWEQLATE 347



 Score = 39.9 bits (89), Expect = 0.005
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +2

Query: 119 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           L    F+T I     + V+F+APWCGHCK + P + + A
Sbjct: 42  LDPETFDTAIAGGN-VFVKFFAPWCGHCKRIQPLWEQLA 79


>AE014297-599|AAF54029.1|  410|Drosophila melanogaster CG10029-PA
           protein.
          Length = 410

 Score = 46.4 bits (105), Expect = 5e-05
 Identities = 26/89 (29%), Positives = 44/89 (49%), Gaps = 2/89 (2%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPAVE 441
           L KV+   E  LA+ + +  YPT+K  RNG     +Y G R  + +  +++K+   P  E
Sbjct: 85  LGKVNCDTEDILADQFDILKYPTIKIVRNGLIGNQEYRGQRSVEALFQFVEKELSDPIKE 144

Query: 442 VTSAEQAKELIDANTVIVFGFFWTRAQPE 528
             + +  K  +D    IV G+F ++   E
Sbjct: 145 FHNIDDLKN-VDVGYGIVIGYFISKDHAE 172



 Score = 40.3 bits (90), Expect = 0.003
 Identities = 19/69 (27%), Positives = 39/69 (56%)
 Frame = +2

Query: 47  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 226
           I  ++A+L ++L   V    +V+ ++  N + +I + E +L+ FY  WC   + L P + 
Sbjct: 9   ILYSLAIL-VSLHSLVAGNSSVVAVTHENLQGIIDSNELVLLSFYTDWCRFSQILQPIFE 67

Query: 227 KAATKLAEE 253
           +AA K+ ++
Sbjct: 68  EAAAKVIQK 76


>AF216975-1|AAF34749.1|  857|Drosophila melanogaster l(2)01289 H9
           form protein.
          Length = 857

 Score = 42.7 bits (96), Expect = 7e-04
 Identities = 20/78 (25%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 286 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSA 453
           T++  +A+ Y V+ YP L FFRN  P+ ++G     D++++W+        P  +E  + 
Sbjct: 423 TEDTGIAKKYNVKTYPRLVFFRNRDPLHFTGDLDDEDEVLAWITDDETLEIPGKIEEVNV 482

Query: 454 EQAKELIDANTVIVFGFF 507
           +   +++  N  +V  F+
Sbjct: 483 KMLDKILAENDHVVVFFY 500



 Score = 37.9 bits (84), Expect = 0.019
 Identities = 19/76 (25%), Positives = 39/76 (51%), Gaps = 4/76 (5%)
 Frame = +1

Query: 292 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD----DIISWLKKKTGPPAVEVTSAEQ 459
           ++ LA+ YG++ +P L +FR   PI Y G    +    D ++ L+    P  +E  +A+ 
Sbjct: 105 DKRLAKQYGIKNFPALTYFREKEPIIYDGDLMDEEGVLDFLTSLEAMDLPDRIEEVNAKI 164

Query: 460 AKELIDANTVIVFGFF 507
            +++I+    +   F+
Sbjct: 165 LQKIIEDTDFVAVLFY 180



 Score = 34.7 bits (76), Expect = 0.17
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 1/89 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAV 438
           I + ++D   E   A+ YG+   P L +F N  P  Y G     D+++ WL  +     +
Sbjct: 311 IVIVRIDNAAE---AKEYGLDHLPALIYFENKIPALYEGDLMNEDEVLEWLLVQKKTATI 367

Query: 439 EVTSAEQAKELIDANTVIVFGFFWTRAQP 525
           E  + E    LI+ +  +V  FF    +P
Sbjct: 368 EEVTDEILVTLINEHEYVVV-FFTGPCEP 395



 Score = 29.1 bits (62), Expect = 8.6
 Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +1

Query: 286 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWL 411
           T + D+ + Y + G P L F+R+     Y+G   + ++I+ W+
Sbjct: 531 TSDDDIDKEYDLPGLPALAFYRHKFRTIYTGDLMKEEEILEWV 573


>AF216973-2|AAF34747.1|  857|Drosophila melanogaster l(2)01289 H9
           form protein.
          Length = 857

 Score = 42.7 bits (96), Expect = 7e-04
 Identities = 20/78 (25%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 286 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSA 453
           T++  +A+ Y V+ YP L FFRN  P+ ++G     D++++W+        P  +E  + 
Sbjct: 423 TEDTGIAKKYNVKTYPRLVFFRNRDPLHFTGDLDDEDEVLAWITDDETLEIPGKIEEVNV 482

Query: 454 EQAKELIDANTVIVFGFF 507
           +   +++  N  +V  F+
Sbjct: 483 KMLDKILAENDHVVVFFY 500



 Score = 37.9 bits (84), Expect = 0.019
 Identities = 19/76 (25%), Positives = 39/76 (51%), Gaps = 4/76 (5%)
 Frame = +1

Query: 292 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD----DIISWLKKKTGPPAVEVTSAEQ 459
           ++ LA+ YG++ +P L +FR   PI Y G    +    D ++ L+    P  +E  +A+ 
Sbjct: 105 DKRLAKQYGIKNFPALTYFREKEPIIYDGDLMDEEGVLDFLTSLEAMDLPDRIEEVNAKI 164

Query: 460 AKELIDANTVIVFGFF 507
            +++I+    +   F+
Sbjct: 165 LQKIIEDTDFVAVLFY 180



 Score = 34.7 bits (76), Expect = 0.17
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 1/89 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAV 438
           I + ++D   E   A+ YG+   P L +F N  P  Y G     D+++ WL  +     +
Sbjct: 311 IVIVRIDNAAE---AKEYGLDHLPALIYFENKIPALYEGDLMNEDEVLEWLLVQKKTATI 367

Query: 439 EVTSAEQAKELIDANTVIVFGFFWTRAQP 525
           E  + E    LI+ +  +V  FF    +P
Sbjct: 368 EEVTDEILVTLINEHEYVVV-FFTGPCEP 395



 Score = 29.1 bits (62), Expect = 8.6
 Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +1

Query: 286 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWL 411
           T + D+ + Y + G P L F+R+     Y+G   + ++I+ W+
Sbjct: 531 TSDDDIDKEYDLPGLPALAFYRHKFRTIYTGDLMKEEEILEWV 573


>AF216973-1|AAF34746.1| 1703|Drosophila melanogaster l(2)01289 long
           form protein.
          Length = 1703

 Score = 42.7 bits (96), Expect = 7e-04
 Identities = 20/78 (25%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 286 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSA 453
           T++  +A+ Y V+ YP L FFRN  P+ ++G     D++++W+        P  +E  + 
Sbjct: 754 TEDTGIAKKYNVKTYPRLVFFRNRDPLHFTGDLDDEDEVLAWITDDETLEIPGKIEEVNV 813

Query: 454 EQAKELIDANTVIVFGFF 507
           +   +++  N  +V  F+
Sbjct: 814 KMLDKILAENDHVVVFFY 831



 Score = 40.3 bits (90), Expect = 0.003
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 4/77 (5%)
 Frame = +1

Query: 289  QEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD-DIISWL---KKKTGPPAVEVTSAE 456
            Q+  LA+ Y ++ +P L +FRNG+P+ + G  Q +  ++ WL     +     +E  +  
Sbjct: 1397 QDPQLAKRYSIKTFPALVYFRNGNPLLFEGDLQNEQSVLEWLIDDDNRELADEIEEVNER 1456

Query: 457  QAKELIDANTVIVFGFF 507
                L+  +T++V  F+
Sbjct: 1457 MLDRLMAESTLLVVFFY 1473



 Score = 39.5 bits (88), Expect = 0.006
 Identities = 16/75 (21%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +1

Query: 286  TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVTSAEQA 462
            T++  +A+ YGV  YP L +F  G P  + G   + ++++ WL  +     +E+ + +  
Sbjct: 1291 TRDFSVADGYGVHEYPALVYFEGGIPNVFEGELSEEEEVLQWLITQKTEDRIELITRQML 1350

Query: 463  KELIDANTVIVFGFF 507
            + +++    +   F+
Sbjct: 1351 ETMVEETQYLAVYFY 1365



 Score = 36.7 bits (81), Expect = 0.043
 Identities = 18/66 (27%), Positives = 36/66 (54%), Gaps = 4/66 (6%)
 Frame = +1

Query: 292 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD----DIISWLKKKTGPPAVEVTSAEQ 459
           ++ LA+ YG++ +P L +FR   PI Y G    +    D ++ L+    P  +E  +A+ 
Sbjct: 105 DKRLAKQYGIKNFPALTYFREKEPIIYDGDLMDEEGVLDFLTSLEAMDLPDRIEEVNAKI 164

Query: 460 AKELID 477
            +++I+
Sbjct: 165 LQKIIE 170



 Score = 36.3 bits (80), Expect = 0.057
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 7/76 (9%)
 Frame = +1

Query: 292 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQ-ADDIISWL--KKKTG--PPAVEVTSAE 456
           ++ LA+ Y +   P L ++R+ +PI Y G  Q  +D++ WL   K TG     +E  +++
Sbjct: 225 DEALADEYNLGNLPALVYYRHQTPIIYEGELQREEDVLEWLVQNKSTGDEDDVIEDVTSK 284

Query: 457 QAKELID--ANTVIVF 498
               LI    N V++F
Sbjct: 285 TLSTLISNIDNLVVLF 300



 Score = 35.9 bits (79), Expect = 0.075
 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 1/73 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADD-IISWLKKKTGPPAV 438
           I   K+D  +E   A  YG+   P L +F  G P  Y G  + ++ ++ WL  +T    +
Sbjct: 432 ITFVKIDNPEE---AVEYGINKVPKLIYFEKGIPTIYEGNLEDEEKLLKWLTDQTSSDQI 488

Query: 439 EVTSAEQAKELID 477
           E  + E    +I+
Sbjct: 489 EDITDEMLDLIIE 501



 Score = 35.9 bits (79), Expect = 0.075
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 301  LAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVT 447
            +A+ YG R  P L +FR G  I+Y G     ++++ WL   T P  +E+T
Sbjct: 1079 MAKKYGFRNPPGLTYFRKGKYINYDGDIDDEEEVLDWL---TSPANMEMT 1125



 Score = 34.7 bits (76), Expect = 0.17
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 1/89 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAV 438
           I + ++D   E   A+ YG+   P L +F N  P  Y G     D+++ WL  +     +
Sbjct: 642 IVIVRIDNAAE---AKEYGLDHLPALIYFENKIPALYEGDLMNEDEVLEWLLVQKKTATI 698

Query: 439 EVTSAEQAKELIDANTVIVFGFFWTRAQP 525
           E  + E    LI+ +  +V  FF    +P
Sbjct: 699 EEVTDEILVTLINEHEYVVV-FFTGPCEP 726



 Score = 34.7 bits (76), Expect = 0.17
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 5/90 (5%)
 Frame = +1

Query: 253  RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGG-RQADDIISWL--KK 417
            ++ I   K+D   ++ +A+ YGV   P + FF+  S  P+ Y+G   + + I++WL  +K
Sbjct: 1174 KAGIDFVKID---DKQMAKEYGVFALPAIVFFKPTSKEPVIYAGDLYEEEQILTWLITQK 1230

Query: 418  KTGPPAVEVTSAEQAKELIDANTVIVFGFF 507
                  +E    E+   LI+ +  I   F+
Sbjct: 1231 DPSGDVIEDLEGERLVHLIEESGSIAVYFY 1260



 Score = 34.7 bits (76), Expect = 0.17
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 4/79 (5%)
 Frame = +1

Query: 304  AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSAEQAKEL 471
            A+ Y +   P+L +FR   P+ Y G   Q D +I+WL  +        +E  + +   +L
Sbjct: 1510 AKKYEIVNIPSLVYFRKQVPVLYDGDLHQHDKVITWLTSQDVFEIKNEIEEVNRKMLDKL 1569

Query: 472  IDANTVIVFGFFWTRAQPE 528
            ++ N  +   FF+   QP+
Sbjct: 1570 LEENEFLAV-FFYEHNQPD 1587



 Score = 30.3 bits (65), Expect = 3.7
 Identities = 20/83 (24%), Positives = 33/83 (39%), Gaps = 1/83 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAV 438
           I+  K+D   +   A  YG+   P + +F    P  Y G     + I+ WL  +     +
Sbjct: 327 IQFVKID---DAKAAADYGIDSIPAIVYFEKEIPNVYDGDLMDEEQILKWLLGQLERDEI 383

Query: 439 EVTSAEQAKELIDANTVIVFGFF 507
           E  + E    +I    VI   F+
Sbjct: 384 EDVTDEMLDTMIKEGRVIAVLFY 406



 Score = 30.3 bits (65), Expect = 3.7
 Identities = 11/38 (28%), Positives = 22/38 (57%)
 Frame = +2

Query: 98   TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 211
            TE+ + ++++   ET++  T+Y+ V FY   C  C  +
Sbjct: 1338 TEDRIELITRQMLETMVEETQYLAVYFYKINCNICDQI 1375



 Score = 29.9 bits (64), Expect = 4.9
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +1

Query: 304  AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKK 417
            A+ +GV   P + +FR   P  Y G     D+++ WL+K
Sbjct: 1618 AKKWGVTKLPAMVYFRRRFPSIYRGDLLSEDEVLEWLRK 1656



 Score = 29.1 bits (62), Expect = 8.6
 Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +1

Query: 286 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWL 411
           T + D+ + Y + G P L F+R+     Y+G   + ++I+ W+
Sbjct: 862 TSDDDIDKEYDLPGLPALAFYRHKFRTIYTGDLMKEEEILEWV 904


>AE013599-216|AAM70821.2|  857|Drosophila melanogaster CG9432-PA,
           isoform A protein.
          Length = 857

 Score = 42.7 bits (96), Expect = 7e-04
 Identities = 20/78 (25%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 286 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSA 453
           T++  +A+ Y V+ YP L FFRN  P+ ++G     D++++W+        P  +E  + 
Sbjct: 423 TEDTGIAKKYNVKTYPRLVFFRNRDPLHFTGDLDDEDEVLAWITDDETLEIPGKIEEVNV 482

Query: 454 EQAKELIDANTVIVFGFF 507
           +   +++  N  +V  F+
Sbjct: 483 KMLDKILAENDHVVVFFY 500



 Score = 37.9 bits (84), Expect = 0.019
 Identities = 19/76 (25%), Positives = 39/76 (51%), Gaps = 4/76 (5%)
 Frame = +1

Query: 292 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD----DIISWLKKKTGPPAVEVTSAEQ 459
           ++ LA+ YG++ +P L +FR   PI Y G    +    D ++ L+    P  +E  +A+ 
Sbjct: 105 DKRLAKQYGIKNFPALTYFREKEPIIYDGDLMDEEGVLDFLTSLEAMDLPDRIEEVNAKI 164

Query: 460 AKELIDANTVIVFGFF 507
            +++I+    +   F+
Sbjct: 165 LQKIIEDTDFVAVLFY 180



 Score = 34.7 bits (76), Expect = 0.17
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 1/89 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAV 438
           I + ++D   E   A+ YG+   P L +F N  P  Y G     D+++ WL  +     +
Sbjct: 311 IVIVRIDNAAE---AKEYGLDHLPALIYFENKIPALYEGDLMNEDEVLEWLLVQKKTATI 367

Query: 439 EVTSAEQAKELIDANTVIVFGFFWTRAQP 525
           E  + E    LI+ +  +V  FF    +P
Sbjct: 368 EEVTDEILVTLINEHEYVVV-FFTGPCEP 395



 Score = 29.1 bits (62), Expect = 8.6
 Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +1

Query: 286 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWL 411
           T + D+ + Y + G P L F+R+     Y+G   + ++I+ W+
Sbjct: 531 TSDDDIDKEYDLPGLPALAFYRHKFRTIYTGDLMKEEEILEWV 573


>AE013599-215|ABI31026.1| 1855|Drosophila melanogaster CG9432-PD,
           isoform D protein.
          Length = 1855

 Score = 42.7 bits (96), Expect = 7e-04
 Identities = 20/78 (25%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 286 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSA 453
           T++  +A+ Y V+ YP L FFRN  P+ ++G     D++++W+        P  +E  + 
Sbjct: 754 TEDTGIAKKYNVKTYPRLVFFRNRDPLHFTGDLDDEDEVLAWITDDETLEIPGKIEEVNV 813

Query: 454 EQAKELIDANTVIVFGFF 507
           +   +++  N  +V  F+
Sbjct: 814 KMLDKILAENDHVVVFFY 831



 Score = 40.3 bits (90), Expect = 0.003
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 4/77 (5%)
 Frame = +1

Query: 289  QEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD-DIISWL---KKKTGPPAVEVTSAE 456
            Q+  LA+ Y ++ +P L +FRNG+P+ + G  Q +  ++ WL     +     +E  +  
Sbjct: 1549 QDPQLAKRYSIKTFPALVYFRNGNPLLFEGDLQNEQSVLEWLIDDDNRELADEIEEVNER 1608

Query: 457  QAKELIDANTVIVFGFF 507
                L+  +T++V  F+
Sbjct: 1609 MLDRLMAESTLLVVFFY 1625



 Score = 37.1 bits (82), Expect = 0.033
 Identities = 25/95 (26%), Positives = 48/95 (50%), Gaps = 5/95 (5%)
 Frame = +1

Query: 253  RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGG-RQADDIISWL--KK 417
            ++ I   K+D   ++ +A+ YGV   P + FF+  S  P+ Y+G   + + I++WL  +K
Sbjct: 1174 KAGIDFVKID---DKQMAKEYGVFALPAIVFFKPTSKEPVIYAGDLYEEEQILTWLITQK 1230

Query: 418  KTGPPAVEVTSAEQAKELIDANTVIVFGFFWTRAQ 522
                  +E    E+   LI+ +  I   +FW + +
Sbjct: 1231 DPSGDVIEDLEGERLVHLIEESGSIAV-YFWNKTK 1264



 Score = 36.7 bits (81), Expect = 0.043
 Identities = 18/66 (27%), Positives = 36/66 (54%), Gaps = 4/66 (6%)
 Frame = +1

Query: 292 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD----DIISWLKKKTGPPAVEVTSAEQ 459
           ++ LA+ YG++ +P L +FR   PI Y G    +    D ++ L+    P  +E  +A+ 
Sbjct: 105 DKRLAKQYGIKNFPALTYFREKEPIIYDGDLMDEEGVLDFLTSLEAMDLPDRIEEVNAKI 164

Query: 460 AKELID 477
            +++I+
Sbjct: 165 LQKIIE 170



 Score = 36.3 bits (80), Expect = 0.057
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 7/76 (9%)
 Frame = +1

Query: 292 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQ-ADDIISWL--KKKTG--PPAVEVTSAE 456
           ++ LA+ Y +   P L ++R+ +PI Y G  Q  +D++ WL   K TG     +E  +++
Sbjct: 225 DEALADEYNLGNLPALVYYRHQTPIIYEGELQREEDVLEWLVQNKSTGDEDDVIEDVTSK 284

Query: 457 QAKELID--ANTVIVF 498
               LI    N V++F
Sbjct: 285 TLSTLISNIDNLVVLF 300



 Score = 35.9 bits (79), Expect = 0.075
 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 1/73 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADD-IISWLKKKTGPPAV 438
           I   K+D  +E   A  YG+   P L +F  G P  Y G  + ++ ++ WL  +T    +
Sbjct: 432 ITFVKIDNPEE---AVEYGINKVPKLIYFEKGIPTIYEGNLEDEEKLLKWLTDQTSSDQI 488

Query: 439 EVTSAEQAKELID 477
           E  + E    +I+
Sbjct: 489 EDITDEMLDLIIE 501



 Score = 35.9 bits (79), Expect = 0.075
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 301  LAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVT 447
            +A+ YG R  P L +FR G  I+Y G     ++++ WL   T P  +E+T
Sbjct: 1079 MAKKYGFRNPPGLTYFRKGKYINYDGDIDDEEEVLDWL---TSPANMEMT 1125



 Score = 34.7 bits (76), Expect = 0.17
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 1/89 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAV 438
           I + ++D   E   A+ YG+   P L +F N  P  Y G     D+++ WL  +     +
Sbjct: 642 IVIVRIDNAAE---AKEYGLDHLPALIYFENKIPALYEGDLMNEDEVLEWLLVQKKTATI 698

Query: 439 EVTSAEQAKELIDANTVIVFGFFWTRAQP 525
           E  + E    LI+ +  +V  FF    +P
Sbjct: 699 EEVTDEILVTLINEHEYVVV-FFTGPCEP 726



 Score = 34.7 bits (76), Expect = 0.17
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 4/79 (5%)
 Frame = +1

Query: 304  AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSAEQAKEL 471
            A+ Y +   P+L +FR   P+ Y G   Q D +I+WL  +        +E  + +   +L
Sbjct: 1662 AKKYEIVNIPSLVYFRKQVPVLYDGDLHQHDKVITWLTSQDVFEIKNEIEEVNRKMLDKL 1721

Query: 472  IDANTVIVFGFFWTRAQPE 528
            ++ N  +   FF+   QP+
Sbjct: 1722 LEENEFLAV-FFYEHNQPD 1739



 Score = 30.3 bits (65), Expect = 3.7
 Identities = 20/83 (24%), Positives = 33/83 (39%), Gaps = 1/83 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAV 438
           I+  K+D   +   A  YG+   P + +F    P  Y G     + I+ WL  +     +
Sbjct: 327 IQFVKID---DAKAAADYGIDSIPAIVYFEKEIPNVYDGDLMDEEQILKWLLGQLERDEI 383

Query: 439 EVTSAEQAKELIDANTVIVFGFF 507
           E  + E    +I    VI   F+
Sbjct: 384 EDVTDEMLDTMIKEGRVIAVLFY 406



 Score = 29.9 bits (64), Expect = 4.9
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +1

Query: 304  AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKK 417
            A+ +GV   P + +FR   P  Y G     D+++ WL+K
Sbjct: 1770 AKKWGVTKLPAMVYFRRRFPSIYRGDLLSEDEVLEWLRK 1808



 Score = 29.5 bits (63), Expect = 6.5
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +1

Query: 286  TQEQDLAESYGVRGYPTLKFFRNGSP 363
            T++  +A+ YGV  YP L +F  G P
Sbjct: 1374 TRDFSVADGYGVHEYPALVYFEGGIP 1399



 Score = 29.1 bits (62), Expect = 8.6
 Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +1

Query: 286 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWL 411
           T + D+ + Y + G P L F+R+     Y+G   + ++I+ W+
Sbjct: 862 TSDDDIDKEYDLPGLPALAFYRHKFRTIYTGDLMKEEEILEWV 904


>AE013599-214|AAN16126.1| 1703|Drosophila melanogaster CG9432-PB,
           isoform B protein.
          Length = 1703

 Score = 42.7 bits (96), Expect = 7e-04
 Identities = 20/78 (25%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 286 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSA 453
           T++  +A+ Y V+ YP L FFRN  P+ ++G     D++++W+        P  +E  + 
Sbjct: 754 TEDTGIAKKYNVKTYPRLVFFRNRDPLHFTGDLDDEDEVLAWITDDETLEIPGKIEEVNV 813

Query: 454 EQAKELIDANTVIVFGFF 507
           +   +++  N  +V  F+
Sbjct: 814 KMLDKILAENDHVVVFFY 831



 Score = 40.3 bits (90), Expect = 0.003
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 4/77 (5%)
 Frame = +1

Query: 289  QEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD-DIISWL---KKKTGPPAVEVTSAE 456
            Q+  LA+ Y ++ +P L +FRNG+P+ + G  Q +  ++ WL     +     +E  +  
Sbjct: 1397 QDPQLAKRYSIKTFPALVYFRNGNPLLFEGDLQNEQSVLEWLIDDDNRELADEIEEVNER 1456

Query: 457  QAKELIDANTVIVFGFF 507
                L+  +T++V  F+
Sbjct: 1457 MLDRLMAESTLLVVFFY 1473



 Score = 39.5 bits (88), Expect = 0.006
 Identities = 16/75 (21%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +1

Query: 286  TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVTSAEQA 462
            T++  +A+ YGV  YP L +F  G P  + G   + ++++ WL  +     +E+ + +  
Sbjct: 1291 TRDFSVADGYGVHEYPALVYFEGGIPNVFEGELSEEEEVLQWLITQKTEDRIELITRQML 1350

Query: 463  KELIDANTVIVFGFF 507
            + +++    +   F+
Sbjct: 1351 ETMVEETQYLAVYFY 1365



 Score = 36.7 bits (81), Expect = 0.043
 Identities = 18/66 (27%), Positives = 36/66 (54%), Gaps = 4/66 (6%)
 Frame = +1

Query: 292 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD----DIISWLKKKTGPPAVEVTSAEQ 459
           ++ LA+ YG++ +P L +FR   PI Y G    +    D ++ L+    P  +E  +A+ 
Sbjct: 105 DKRLAKQYGIKNFPALTYFREKEPIIYDGDLMDEEGVLDFLTSLEAMDLPDRIEEVNAKI 164

Query: 460 AKELID 477
            +++I+
Sbjct: 165 LQKIIE 170



 Score = 36.3 bits (80), Expect = 0.057
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 7/76 (9%)
 Frame = +1

Query: 292 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQ-ADDIISWL--KKKTG--PPAVEVTSAE 456
           ++ LA+ Y +   P L ++R+ +PI Y G  Q  +D++ WL   K TG     +E  +++
Sbjct: 225 DEALADEYNLGNLPALVYYRHQTPIIYEGELQREEDVLEWLVQNKSTGDEDDVIEDVTSK 284

Query: 457 QAKELID--ANTVIVF 498
               LI    N V++F
Sbjct: 285 TLSTLISNIDNLVVLF 300



 Score = 35.9 bits (79), Expect = 0.075
 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 1/73 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADD-IISWLKKKTGPPAV 438
           I   K+D  +E   A  YG+   P L +F  G P  Y G  + ++ ++ WL  +T    +
Sbjct: 432 ITFVKIDNPEE---AVEYGINKVPKLIYFEKGIPTIYEGNLEDEEKLLKWLTDQTSSDQI 488

Query: 439 EVTSAEQAKELID 477
           E  + E    +I+
Sbjct: 489 EDITDEMLDLIIE 501



 Score = 35.9 bits (79), Expect = 0.075
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 301  LAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVT 447
            +A+ YG R  P L +FR G  I+Y G     ++++ WL   T P  +E+T
Sbjct: 1079 MAKKYGFRNPPGLTYFRKGKYINYDGDIDDEEEVLDWL---TSPANMEMT 1125



 Score = 34.7 bits (76), Expect = 0.17
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 1/89 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAV 438
           I + ++D   E   A+ YG+   P L +F N  P  Y G     D+++ WL  +     +
Sbjct: 642 IVIVRIDNAAE---AKEYGLDHLPALIYFENKIPALYEGDLMNEDEVLEWLLVQKKTATI 698

Query: 439 EVTSAEQAKELIDANTVIVFGFFWTRAQP 525
           E  + E    LI+ +  +V  FF    +P
Sbjct: 699 EEVTDEILVTLINEHEYVVV-FFTGPCEP 726



 Score = 34.7 bits (76), Expect = 0.17
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 5/90 (5%)
 Frame = +1

Query: 253  RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGG-RQADDIISWL--KK 417
            ++ I   K+D   ++ +A+ YGV   P + FF+  S  P+ Y+G   + + I++WL  +K
Sbjct: 1174 KAGIDFVKID---DKQMAKEYGVFALPAIVFFKPTSKEPVIYAGDLYEEEQILTWLITQK 1230

Query: 418  KTGPPAVEVTSAEQAKELIDANTVIVFGFF 507
                  +E    E+   LI+ +  I   F+
Sbjct: 1231 DPSGDVIEDLEGERLVHLIEESGSIAVYFY 1260



 Score = 34.7 bits (76), Expect = 0.17
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 4/79 (5%)
 Frame = +1

Query: 304  AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSAEQAKEL 471
            A+ Y +   P+L +FR   P+ Y G   Q D +I+WL  +        +E  + +   +L
Sbjct: 1510 AKKYEIVNIPSLVYFRKQVPVLYDGDLHQHDKVITWLTSQDVFEIKNEIEEVNRKMLDKL 1569

Query: 472  IDANTVIVFGFFWTRAQPE 528
            ++ N  +   FF+   QP+
Sbjct: 1570 LEENEFLAV-FFYEHNQPD 1587



 Score = 30.3 bits (65), Expect = 3.7
 Identities = 20/83 (24%), Positives = 33/83 (39%), Gaps = 1/83 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAV 438
           I+  K+D   +   A  YG+   P + +F    P  Y G     + I+ WL  +     +
Sbjct: 327 IQFVKID---DAKAAADYGIDSIPAIVYFEKEIPNVYDGDLMDEEQILKWLLGQLERDEI 383

Query: 439 EVTSAEQAKELIDANTVIVFGFF 507
           E  + E    +I    VI   F+
Sbjct: 384 EDVTDEMLDTMIKEGRVIAVLFY 406



 Score = 30.3 bits (65), Expect = 3.7
 Identities = 11/38 (28%), Positives = 22/38 (57%)
 Frame = +2

Query: 98   TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 211
            TE+ + ++++   ET++  T+Y+ V FY   C  C  +
Sbjct: 1338 TEDRIELITRQMLETMVEETQYLAVYFYKINCNICDQI 1375



 Score = 29.9 bits (64), Expect = 4.9
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +1

Query: 304  AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKK 417
            A+ +GV   P + +FR   P  Y G     D+++ WL+K
Sbjct: 1618 AKKWGVTKLPAMVYFRRRFPSIYRGDLLSEDEVLEWLRK 1656



 Score = 29.1 bits (62), Expect = 8.6
 Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +1

Query: 286 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWL 411
           T + D+ + Y + G P L F+R+     Y+G   + ++I+ W+
Sbjct: 862 TSDDDIDKEYDLPGLPALAFYRHKFRTIYTGDLMKEEEILEWV 904


>BT004854-1|AAO45210.1|  637|Drosophila melanogaster RE62692p
           protein.
          Length = 637

 Score = 42.3 bits (95), Expect = 9e-04
 Identities = 21/48 (43%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +2

Query: 104 ENVLVLSKANFE-TVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           + V+ LS  NF  TV+      LVEFY  +CGHC+  AP Y   A  L
Sbjct: 49  DKVIRLSVDNFNATVLDQNRGALVEFYNTYCGHCRRFAPTYKSVAEHL 96


>AE013599-1673|AAF58400.1|  637|Drosophila melanogaster CG4670-PA
           protein.
          Length = 637

 Score = 42.3 bits (95), Expect = 9e-04
 Identities = 21/48 (43%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +2

Query: 104 ENVLVLSKANFE-TVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           + V+ LS  NF  TV+      LVEFY  +CGHC+  AP Y   A  L
Sbjct: 49  DKVIRLSVDNFNATVLDQNRGALVEFYNTYCGHCRRFAPTYKSVAEHL 96


>BT023024-1|AAY55440.1|  139|Drosophila melanogaster IP04051p
           protein.
          Length = 139

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 3/46 (6%)
 Frame = +2

Query: 110 VLVLSKANFETVIT---TTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           ++V SK+ F+ +I    T +Y+LVEF+A WCG C  + P   + A+
Sbjct: 9   IIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLAS 54



 Score = 31.9 bits (69), Expect = 1.2
 Identities = 18/65 (27%), Positives = 31/65 (47%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 453
           K+D  + +DLA  Y V   PT    +N   +    G   + ++S ++K  G   VE +  
Sbjct: 64  KIDVDENEDLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFVG--KVEDSKE 121

Query: 454 EQAKE 468
            ++KE
Sbjct: 122 HKSKE 126


>BT022989-1|AAY55405.1|  139|Drosophila melanogaster IP04151p
           protein.
          Length = 139

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 3/46 (6%)
 Frame = +2

Query: 110 VLVLSKANFETVIT---TTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           ++V SK+ F+ +I    T +Y+LVEF+A WCG C  + P   + A+
Sbjct: 9   IIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLAS 54



 Score = 31.9 bits (69), Expect = 1.2
 Identities = 18/65 (27%), Positives = 31/65 (47%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 453
           K+D  + +DLA  Y V   PT    +N   +    G   + ++S ++K  G   VE +  
Sbjct: 64  KIDVDENEDLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFVG--KVEDSKE 121

Query: 454 EQAKE 468
            ++KE
Sbjct: 122 HKSKE 126


>AE014296-2414|AAF49714.1|  139|Drosophila melanogaster CG13473-PA
           protein.
          Length = 139

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 3/46 (6%)
 Frame = +2

Query: 110 VLVLSKANFETVIT---TTEYILVEFYAPWCGHCKSLAPEYAKAAT 238
           ++V SK+ F+ +I    T +Y+LVEF+A WCG C  + P   + A+
Sbjct: 9   IIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLAS 54



 Score = 31.9 bits (69), Expect = 1.2
 Identities = 18/65 (27%), Positives = 31/65 (47%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 453
           K+D  + +DLA  Y V   PT    +N   +    G   + ++S ++K  G   VE +  
Sbjct: 64  KIDVDENEDLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFVG--KVEDSKE 121

Query: 454 EQAKE 468
            ++KE
Sbjct: 122 HKSKE 126


>AF216977-1|AAF34751.1|  432|Drosophila melanogaster l(2)01289 long
           form protein.
          Length = 432

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 4/77 (5%)
 Frame = +1

Query: 289 QEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD-DIISWL---KKKTGPPAVEVTSAE 456
           Q+  LA+ Y ++ +P L +FRNG+P+ + G  Q +  ++ WL     +     +E  +  
Sbjct: 126 QDPQLAKRYSIKTFPALVYFRNGNPLLFEGDLQNEQSVLEWLIDDDNRELADEIEEVNER 185

Query: 457 QAKELIDANTVIVFGFF 507
               L+  +T++V  F+
Sbjct: 186 MLDRLMAESTLLVVFFY 202



 Score = 34.7 bits (76), Expect = 0.17
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 4/79 (5%)
 Frame = +1

Query: 304 AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSAEQAKEL 471
           A+ Y +   P+L +FR   P+ Y G   Q D +I+WL  +        +E  + +   +L
Sbjct: 239 AKKYEIVNIPSLVYFRKQVPVLYDGDLHQHDKVITWLTSQDVFEIKNEIEEVNRKMLDKL 298

Query: 472 IDANTVIVFGFFWTRAQPE 528
           ++ N  +   FF+   QP+
Sbjct: 299 LEENEFLAV-FFYEHNQPD 316



 Score = 29.9 bits (64), Expect = 4.9
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +1

Query: 304 AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKK 417
           A+ +GV   P + +FR   P  Y G     D+++ WL+K
Sbjct: 347 AKKWGVTKLPAMVYFRRRFPSIYRGDLLSEDEVLEWLRK 385


>AF216976-1|AAF34750.1|  758|Drosophila melanogaster l(2)01289 long
           form protein.
          Length = 758

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 4/77 (5%)
 Frame = +1

Query: 289 QEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD-DIISWL---KKKTGPPAVEVTSAE 456
           Q+  LA+ Y ++ +P L +FRNG+P+ + G  Q +  ++ WL     +     +E  +  
Sbjct: 584 QDPQLAKRYSIKTFPALVYFRNGNPLLFEGDLQNEQSVLEWLIDDDNRELADEIEEVNER 643

Query: 457 QAKELIDANTVIVFGFF 507
               L+  +T++V  F+
Sbjct: 644 MLDRLMAESTLLVVFFY 660



 Score = 39.5 bits (88), Expect = 0.006
 Identities = 16/75 (21%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +1

Query: 286 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVTSAEQA 462
           T++  +A+ YGV  YP L +F  G P  + G   + ++++ WL  +     +E+ + +  
Sbjct: 478 TRDFSVADGYGVHEYPALVYFEGGIPNVFEGELSEEEEVLQWLITQKTEDRIELITRQML 537

Query: 463 KELIDANTVIVFGFF 507
           + +++    +   F+
Sbjct: 538 ETMVEETQYLAVYFY 552



 Score = 35.9 bits (79), Expect = 0.075
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 301 LAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVT 447
           +A+ YG R  P L +FR G  I+Y G     ++++ WL   T P  +E+T
Sbjct: 266 MAKKYGFRNPPGLTYFRKGKYINYDGDIDDEEEVLDWL---TSPANMEMT 312



 Score = 34.7 bits (76), Expect = 0.17
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 5/90 (5%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGG-RQADDIISWL--KK 417
           ++ I   K+D   ++ +A+ YGV   P + FF+  S  P+ Y+G   + + I++WL  +K
Sbjct: 361 KAGIDFVKID---DKQMAKEYGVFALPAIVFFKPTSKEPVIYAGDLYEEEQILTWLITQK 417

Query: 418 KTGPPAVEVTSAEQAKELIDANTVIVFGFF 507
                 +E    E+   LI+ +  I   F+
Sbjct: 418 DPSGDVIEDLEGERLVHLIEESGSIAVYFY 447



 Score = 31.1 bits (67), Expect = 2.1
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
 Frame = +1

Query: 304 AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWL 411
           A+ Y +   P+L +FR   P+ Y G   Q D +I+WL
Sbjct: 697 AKKYEIVNIPSLVYFRKQVPVLYDGDLHQHDKVITWL 733



 Score = 30.3 bits (65), Expect = 3.7
 Identities = 11/38 (28%), Positives = 22/38 (57%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 211
           TE+ + ++++   ET++  T+Y+ V FY   C  C  +
Sbjct: 525 TEDRIELITRQMLETMVEETQYLAVYFYKINCNICDQI 562



 Score = 29.1 bits (62), Expect = 8.6
 Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +1

Query: 286 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWL 411
           T + D+ + Y + G P L F+R+     Y+G   + ++I+ W+
Sbjct: 49  TSDDDIDKEYDLPGLPALAFYRHKFRTIYTGDLMKEEEILEWV 91


>AE013599-213|ABI31025.1|  884|Drosophila melanogaster CG9432-PE,
           isoform E protein.
          Length = 884

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 4/77 (5%)
 Frame = +1

Query: 289 QEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD-DIISWL---KKKTGPPAVEVTSAE 456
           Q+  LA+ Y ++ +P L +FRNG+P+ + G  Q +  ++ WL     +     +E  +  
Sbjct: 578 QDPQLAKRYSIKTFPALVYFRNGNPLLFEGDLQNEQSVLEWLIDDDNRELADEIEEVNER 637

Query: 457 QAKELIDANTVIVFGFF 507
               L+  +T++V  F+
Sbjct: 638 MLDRLMAESTLLVVFFY 654



 Score = 39.5 bits (88), Expect = 0.006
 Identities = 16/75 (21%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +1

Query: 286 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVTSAEQA 462
           T++  +A+ YGV  YP L +F  G P  + G   + ++++ WL  +     +E+ + +  
Sbjct: 472 TRDFSVADGYGVHEYPALVYFEGGIPNVFEGELSEEEEVLQWLITQKTEDRIELITRQML 531

Query: 463 KELIDANTVIVFGFF 507
           + +++    +   F+
Sbjct: 532 ETMVEETQYLAVYFY 546



 Score = 36.7 bits (81), Expect = 0.043
 Identities = 18/66 (27%), Positives = 36/66 (54%), Gaps = 4/66 (6%)
 Frame = +1

Query: 292 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD----DIISWLKKKTGPPAVEVTSAEQ 459
           ++ LA+ YG++ +P L +FR   PI Y G    +    D ++ L+    P  +E  +A+ 
Sbjct: 105 DKRLAKQYGIKNFPALTYFREKEPIIYDGDLMDEEGVLDFLTSLEAMDLPDRIEEVNAKI 164

Query: 460 AKELID 477
            +++I+
Sbjct: 165 LQKIIE 170



 Score = 35.9 bits (79), Expect = 0.075
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 301 LAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVT 447
           +A+ YG R  P L +FR G  I+Y G     ++++ WL   T P  +E+T
Sbjct: 260 MAKKYGFRNPPGLTYFRKGKYINYDGDIDDEEEVLDWL---TSPANMEMT 306



 Score = 34.7 bits (76), Expect = 0.17
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 5/90 (5%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGG-RQADDIISWL--KK 417
           ++ I   K+D   ++ +A+ YGV   P + FF+  S  P+ Y+G   + + I++WL  +K
Sbjct: 355 KAGIDFVKID---DKQMAKEYGVFALPAIVFFKPTSKEPVIYAGDLYEEEQILTWLITQK 411

Query: 418 KTGPPAVEVTSAEQAKELIDANTVIVFGFF 507
                 +E    E+   LI+ +  I   F+
Sbjct: 412 DPSGDVIEDLEGERLVHLIEESGSIAVYFY 441



 Score = 34.7 bits (76), Expect = 0.17
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 4/79 (5%)
 Frame = +1

Query: 304 AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSAEQAKEL 471
           A+ Y +   P+L +FR   P+ Y G   Q D +I+WL  +        +E  + +   +L
Sbjct: 691 AKKYEIVNIPSLVYFRKQVPVLYDGDLHQHDKVITWLTSQDVFEIKNEIEEVNRKMLDKL 750

Query: 472 IDANTVIVFGFFWTRAQPE 528
           ++ N  +   FF+   QP+
Sbjct: 751 LEENEFLAV-FFYEHNQPD 768



 Score = 30.3 bits (65), Expect = 3.7
 Identities = 11/38 (28%), Positives = 22/38 (57%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 211
           TE+ + ++++   ET++  T+Y+ V FY   C  C  +
Sbjct: 519 TEDRIELITRQMLETMVEETQYLAVYFYKINCNICDQI 556



 Score = 29.9 bits (64), Expect = 4.9
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +1

Query: 304 AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKK 417
           A+ +GV   P + +FR   P  Y G     D+++ WL+K
Sbjct: 799 AKKWGVTKLPAMVYFRRRFPSIYRGDLLSEDEVLEWLRK 837


>AY089550-1|AAL90288.1|  287|Drosophila melanogaster LD26837p
           protein.
          Length = 287

 Score = 39.1 bits (87), Expect = 0.008
 Identities = 22/73 (30%), Positives = 35/73 (47%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 453
           KVD  + QD A   GV   PT  F+RN + ID   G   + + + +++  G    E    
Sbjct: 57  KVDVDKCQDTAAGQGVSAMPTFIFYRNRTKIDRVQGADVNGLEAKIQEHIGTSGGEEGGE 116

Query: 454 EQAKELIDANTVI 492
           +  + L++ NT I
Sbjct: 117 DYGQGLMELNTFI 129



 Score = 33.5 bits (73), Expect = 0.40
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = +2

Query: 158 EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           + ++V+F A WCG CK +AP +    TK
Sbjct: 22  QLVVVDFTASWCGPCKRIAPIFETFPTK 49


>AF143404-1|AAF66635.1|  287|Drosophila melanogaster
           thioredoxin-like protein TXL protein.
          Length = 287

 Score = 39.1 bits (87), Expect = 0.008
 Identities = 22/73 (30%), Positives = 35/73 (47%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 453
           KVD  + QD A   GV   PT  F+RN + ID   G   + + + +++  G    E    
Sbjct: 57  KVDVDKCQDTAAGQGVSAMPTFIFYRNRTKIDRVQGADVNGLEAKIQEHIGTSGGEEGGE 116

Query: 454 EQAKELIDANTVI 492
           +  + L++ NT I
Sbjct: 117 DYGQGLMELNTFI 129



 Score = 33.5 bits (73), Expect = 0.40
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = +2

Query: 158 EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           + ++V+F A WCG CK +AP +    TK
Sbjct: 22  QLVVVDFTASWCGPCKRIAPIFETFPTK 49


>AE014296-996|AAF50750.1|  287|Drosophila melanogaster CG5495-PA
           protein.
          Length = 287

 Score = 39.1 bits (87), Expect = 0.008
 Identities = 22/73 (30%), Positives = 35/73 (47%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 453
           KVD  + QD A   GV   PT  F+RN + ID   G   + + + +++  G    E    
Sbjct: 57  KVDVDKCQDTAAGQGVSAMPTFIFYRNRTKIDRVQGADVNGLEAKIQEHIGTSGGEEGGE 116

Query: 454 EQAKELIDANTVI 492
           +  + L++ NT I
Sbjct: 117 DYGQGLMELNTFI 129



 Score = 33.5 bits (73), Expect = 0.40
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = +2

Query: 158 EYILVEFYAPWCGHCKSLAPEYAKAATK 241
           + ++V+F A WCG CK +AP +    TK
Sbjct: 22  QLVVVDFTASWCGPCKRIAPIFETFPTK 49


>BT001615-1|AAN71370.1|  729|Drosophila melanogaster RE34119p
           protein.
          Length = 729

 Score = 38.7 bits (86), Expect = 0.011
 Identities = 19/78 (24%), Positives = 39/78 (50%), Gaps = 4/78 (5%)
 Frame = +1

Query: 286 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSA 453
           T+   +A+ Y V+ YP L  FRN  P+ ++G     D++++W+        P  +E  + 
Sbjct: 423 TEVTGIAKKYNVKTYPRLVLFRNRDPLHFTGDLDDEDEVLAWITDDETLEIPGKIEEVNV 482

Query: 454 EQAKELIDANTVIVFGFF 507
           +   +++  N  +V  F+
Sbjct: 483 KMLDKILAENDHVVVFFY 500



 Score = 37.9 bits (84), Expect = 0.019
 Identities = 19/76 (25%), Positives = 39/76 (51%), Gaps = 4/76 (5%)
 Frame = +1

Query: 292 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD----DIISWLKKKTGPPAVEVTSAEQ 459
           ++ LA+ YG++ +P L +FR   PI Y G    +    D ++ L+    P  +E  +A+ 
Sbjct: 105 DKRLAKQYGIKNFPALTYFREKEPIIYDGDLMDEEGVLDFLTSLEAMDLPDRIEEVNAKI 164

Query: 460 AKELIDANTVIVFGFF 507
            +++I+    +   F+
Sbjct: 165 LQKIIEDTDFVAVLFY 180



 Score = 34.3 bits (75), Expect = 0.23
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 1/89 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAV 438
           I + ++D   E   A+ YG+   P L +F N  P  Y G     D+++ WL  +     +
Sbjct: 311 IVIVRIDNAAE---AKEYGLDHLPALIYFENKIPALYEGDLMNEDEVLEWLLVQKKTANI 367

Query: 439 EVTSAEQAKELIDANTVIVFGFFWTRAQP 525
           E  + E    LI+ +  +V  FF    +P
Sbjct: 368 EEVTDEILVTLINEHEYVVV-FFTGACEP 395



 Score = 29.1 bits (62), Expect = 8.6
 Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +1

Query: 286 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWL 411
           T + D+ + Y + G P L F+R+     Y+G   + ++I+ W+
Sbjct: 531 TSDDDIDKEYDLPGLPALAFYRHKFRTIYTGDLMKEEEILEWV 573


>AY071406-1|AAL49028.1|  142|Drosophila melanogaster RE49388p
           protein.
          Length = 142

 Score = 37.5 bits (83), Expect = 0.025
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = +1

Query: 244 G*RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADD-IISWL 411
           G +   IKLAKVD  +  +LA  Y V   P L   +NG  +    G Q +D I +W+
Sbjct: 78  GEQAGSIKLAKVDIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWV 134



 Score = 34.3 bits (75), Expect = 0.23
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = +2

Query: 80  LGDEVPTEENVLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAP 217
           L    P +E   V S  +F+  +  ++  ++V+F+A WC  CK L P
Sbjct: 25  LSVSAPRQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTP 71


>AE014296-444|AAF47638.1|  142|Drosophila melanogaster CG8993-PA
           protein.
          Length = 142

 Score = 37.5 bits (83), Expect = 0.025
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = +1

Query: 244 G*RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADD-IISWL 411
           G +   IKLAKVD  +  +LA  Y V   P L   +NG  +    G Q +D I +W+
Sbjct: 78  GEQAGSIKLAKVDIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWV 134



 Score = 34.3 bits (75), Expect = 0.23
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = +2

Query: 80  LGDEVPTEENVLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAP 217
           L    P +E   V S  +F+  +  ++  ++V+F+A WC  CK L P
Sbjct: 25  LSVSAPRQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTP 71


>AF220362-1|AAF37263.1|  106|Drosophila melanogaster thioredoxin
           protein.
          Length = 106

 Score = 37.1 bits (82), Expect = 0.033
 Identities = 14/47 (29%), Positives = 30/47 (63%), Gaps = 2/47 (4%)
 Frame = +2

Query: 116 VLSKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           V  KA+ +  +T    + ++++F+A WCG CK ++P+  + +T+ A+
Sbjct: 5   VKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFAD 51



 Score = 32.3 bits (70), Expect = 0.93
 Identities = 13/43 (30%), Positives = 22/43 (51%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQA 390
           + + KVD  + +D+A  Y +   PT  F +NG  ++   G  A
Sbjct: 53  VVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANA 95


>AE014298-718|AAF46018.2|  157|Drosophila melanogaster CG3315-PA
           protein.
          Length = 157

 Score = 37.1 bits (82), Expect = 0.033
 Identities = 11/38 (28%), Positives = 25/38 (65%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           + ++   + ++++FYA WCG CK +AP+  + A + ++
Sbjct: 14  QLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSD 51


>AE014134-1667|AAN10701.1|  106|Drosophila melanogaster CG31884-PB,
           isoform B protein.
          Length = 106

 Score = 37.1 bits (82), Expect = 0.033
 Identities = 14/47 (29%), Positives = 30/47 (63%), Gaps = 2/47 (4%)
 Frame = +2

Query: 116 VLSKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           V  KA+ +  +T    + ++++F+A WCG CK ++P+  + +T+ A+
Sbjct: 5   VKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFAD 51



 Score = 32.3 bits (70), Expect = 0.93
 Identities = 13/43 (30%), Positives = 22/43 (51%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQA 390
           + + KVD  + +D+A  Y +   PT  F +NG  ++   G  A
Sbjct: 53  VVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANA 95


>AE014134-1666|AAN10700.1|  106|Drosophila melanogaster CG31884-PA,
           isoform A protein.
          Length = 106

 Score = 37.1 bits (82), Expect = 0.033
 Identities = 14/47 (29%), Positives = 30/47 (63%), Gaps = 2/47 (4%)
 Frame = +2

Query: 116 VLSKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           V  KA+ +  +T    + ++++F+A WCG CK ++P+  + +T+ A+
Sbjct: 5   VKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFAD 51



 Score = 32.3 bits (70), Expect = 0.93
 Identities = 13/43 (30%), Positives = 22/43 (51%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQA 390
           + + KVD  + +D+A  Y +   PT  F +NG  ++   G  A
Sbjct: 53  VVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANA 95


>AJ507731-1|CAD45644.1|  157|Drosophila melanogaster thioredoxinT
           protein.
          Length = 157

 Score = 36.7 bits (81), Expect = 0.043
 Identities = 11/38 (28%), Positives = 25/38 (65%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           + ++   + ++++FYA WCG CK +AP+  + A + ++
Sbjct: 14  QLILAEDKLVVIDFYADWCGPCKIIAPKLDELAHEYSD 51


>AF216974-1|AAF34748.1|  566|Drosophila melanogaster l(2)01289 long
           form protein.
          Length = 566

 Score = 36.7 bits (81), Expect = 0.043
 Identities = 18/66 (27%), Positives = 36/66 (54%), Gaps = 4/66 (6%)
 Frame = +1

Query: 292 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD----DIISWLKKKTGPPAVEVTSAEQ 459
           ++ LA+ YG++ +P L +FR   PI Y G    +    D ++ L+    P  +E  +A+ 
Sbjct: 105 DKRLAKQYGIKNFPALTYFREKEPIIYDGDLMDEEGVLDFLTSLEAMDLPDRIEEVNAKI 164

Query: 460 AKELID 477
            +++I+
Sbjct: 165 LQKIIE 170



 Score = 36.3 bits (80), Expect = 0.057
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 7/76 (9%)
 Frame = +1

Query: 292 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQ-ADDIISWL--KKKTG--PPAVEVTSAE 456
           ++ LA+ Y +   P L ++R+ +PI Y G  Q  +D++ WL   K TG     +E  +++
Sbjct: 225 DEALADEYNLGNLPALVYYRHQTPIIYEGELQREEDVLEWLVQNKSTGDEDDVIEDVTSK 284

Query: 457 QAKELID--ANTVIVF 498
               LI    N V++F
Sbjct: 285 TLSTLISNIDNLVVLF 300



 Score = 35.9 bits (79), Expect = 0.075
 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 1/73 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADD-IISWLKKKTGPPAV 438
           I   K+D  +E   A  YG+   P L +F  G P  Y G  + ++ ++ WL  +T    +
Sbjct: 432 ITFVKIDNPEE---AVEYGINKVPKLIYFEKGIPTIYEGNLEDEEKLLKWLTDQTSSDQI 488

Query: 439 EVTSAEQAKELID 477
           E  + E    +I+
Sbjct: 489 EDITDEMLDLIIE 501



 Score = 30.3 bits (65), Expect = 3.7
 Identities = 20/83 (24%), Positives = 33/83 (39%), Gaps = 1/83 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAV 438
           I+  K+D   +   A  YG+   P + +F    P  Y G     + I+ WL  +     +
Sbjct: 327 IQFVKID---DAKAAADYGIDSIPAIVYFEKEIPNVYDGDLMDEEQILKWLLGQLERDEI 383

Query: 439 EVTSAEQAKELIDANTVIVFGFF 507
           E  + E    +I    VI   F+
Sbjct: 384 EDVTDEMLDTMIKEGRVIAVLFY 406


>AY118750-1|AAM50610.1|  323|Drosophila melanogaster GH07506p
           protein.
          Length = 323

 Score = 36.3 bits (80), Expect = 0.057
 Identities = 12/23 (52%), Positives = 18/23 (78%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAA 235
           ++EF+APWC  CK+LAP + + A
Sbjct: 55  MIEFFAPWCPACKNLAPTWERFA 77



 Score = 35.5 bits (78), Expect = 0.099
 Identities = 15/53 (28%), Positives = 29/53 (54%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKK 420
           +++AK+D T    L+  + V   PT+   ++G    Y G R  D ++ ++KK+
Sbjct: 85  VQVAKIDVTTSPSLSGRFFVTALPTIYHVKDGEFRQYRGARDGDALLYFVKKQ 137


>AY070811-1|AAL48433.1|  145|Drosophila melanogaster AT22380p
           protein.
          Length = 145

 Score = 36.3 bits (80), Expect = 0.057
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 1/63 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDII-SWLKKKTGPPAV 438
           ++LA+VD  +  +LA  Y V   P+L    NG  ++   G Q  + +  WL K    P  
Sbjct: 81  VRLARVDIDEHGELALDYNVGSVPSLVVISNGKVVNRMVGLQTSEYLRKWLHKAVPHPPP 140

Query: 439 EVT 447
           E T
Sbjct: 141 EDT 143



 Score = 33.9 bits (74), Expect = 0.30
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 1/35 (2%)
 Frame = +2

Query: 116 VLSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 217
           V ++ +FE  VI +   ++V+F+A WC  CK+LAP
Sbjct: 34  VETRKDFEQRVINSDRPVVVDFHASWCCPCKALAP 68


>AE013599-3698|AAF47072.1|  323|Drosophila melanogaster CG5554-PA
           protein.
          Length = 323

 Score = 36.3 bits (80), Expect = 0.057
 Identities = 12/23 (52%), Positives = 18/23 (78%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAKAA 235
           ++EF+APWC  CK+LAP + + A
Sbjct: 55  MIEFFAPWCPACKNLAPTWERFA 77



 Score = 35.5 bits (78), Expect = 0.099
 Identities = 15/53 (28%), Positives = 29/53 (54%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKK 420
           +++AK+D T    L+  + V   PT+   ++G    Y G R  D ++ ++KK+
Sbjct: 85  VQVAKIDVTTSPSLSGRFFVTALPTIYHVKDGEFRQYRGARDGDALLYFVKKQ 137


>AE013599-2952|AAF57518.2|  145|Drosophila melanogaster CG8517-PA
           protein.
          Length = 145

 Score = 36.3 bits (80), Expect = 0.057
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 1/63 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDII-SWLKKKTGPPAV 438
           ++LA+VD  +  +LA  Y V   P+L    NG  ++   G Q  + +  WL K    P  
Sbjct: 81  VRLARVDIDEHGELALDYNVGSVPSLVVISNGKVVNRMVGLQTSEYLRKWLHKAVPHPPP 140

Query: 439 EVT 447
           E T
Sbjct: 141 EDT 143



 Score = 33.9 bits (74), Expect = 0.30
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 1/35 (2%)
 Frame = +2

Query: 116 VLSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 217
           V ++ +FE  VI +   ++V+F+A WC  CK+LAP
Sbjct: 34  VETRKDFEQRVINSDRPVVVDFHASWCCPCKALAP 68


>AY060458-1|AAL25497.1|  114|Drosophila melanogaster SD03042p
           protein.
          Length = 114

 Score = 35.9 bits (79), Expect = 0.075
 Identities = 10/29 (34%), Positives = 22/29 (75%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           ++++F+A WCG CK ++P+  + +T+ A+
Sbjct: 31  VVLDFFATWCGPCKMISPKLVELSTQFAD 59



 Score = 32.3 bits (70), Expect = 0.93
 Identities = 13/43 (30%), Positives = 22/43 (51%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQA 390
           + + KVD  + +D+A  Y +   PT  F +NG  ++   G  A
Sbjct: 61  VVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANA 103


>BT012482-1|AAS93753.1|  245|Drosophila melanogaster RE10237p
           protein.
          Length = 245

 Score = 33.1 bits (72), Expect = 0.53
 Identities = 20/65 (30%), Positives = 30/65 (46%)
 Frame = +1

Query: 292 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKEL 471
           + +L   Y     P L FFR G PI Y G    D+I+ +       PAV+  S +  + L
Sbjct: 22  DSNLVSIYDPSKEPALVFFRRGIPILYHGEINDDEILDFFNDNL-EPAVKELSDDNFEHL 80

Query: 472 IDANT 486
             A++
Sbjct: 81  TQASS 85


>AY095006-1|AAM11334.1|  302|Drosophila melanogaster GH08893p
           protein.
          Length = 302

 Score = 33.1 bits (72), Expect = 0.53
 Identities = 20/65 (30%), Positives = 30/65 (46%)
 Frame = +1

Query: 292 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKEL 471
           + +L   Y     P L FFR G PI Y G    D+I+ +       PAV+  S +  + L
Sbjct: 79  DSNLVSIYDPSKEPALVFFRRGIPILYHGEINDDEILDFFNDNL-EPAVKELSDDNFEHL 137

Query: 472 IDANT 486
             A++
Sbjct: 138 TQASS 142


>AE014297-3697|AAN14034.1|  245|Drosophila melanogaster CG11790-PB,
           isoform B protein.
          Length = 245

 Score = 33.1 bits (72), Expect = 0.53
 Identities = 20/65 (30%), Positives = 30/65 (46%)
 Frame = +1

Query: 292 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKEL 471
           + +L   Y     P L FFR G PI Y G    D+I+ +       PAV+  S +  + L
Sbjct: 22  DSNLVSIYDPSKEPALVFFRRGIPILYHGEINDDEILDFFNDNL-EPAVKELSDDNFEHL 80

Query: 472 IDANT 486
             A++
Sbjct: 81  TQASS 85


>AE014297-3696|AAF56385.2|  302|Drosophila melanogaster CG11790-PA,
           isoform A protein.
          Length = 302

 Score = 33.1 bits (72), Expect = 0.53
 Identities = 20/65 (30%), Positives = 30/65 (46%)
 Frame = +1

Query: 292 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKEL 471
           + +L   Y     P L FFR G PI Y G    D+I+ +       PAV+  S +  + L
Sbjct: 79  DSNLVSIYDPSKEPALVFFRRGIPILYHGEINDDEILDFFNDNL-EPAVKELSDDNFEHL 137

Query: 472 IDANT 486
             A++
Sbjct: 138 TQASS 142


>AY119573-1|AAM50227.1|  160|Drosophila melanogaster LD03613p
           protein.
          Length = 160

 Score = 32.7 bits (71), Expect = 0.70
 Identities = 14/41 (34%), Positives = 21/41 (51%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           + VI +   ++V F+A WC  CK L P+  +      E DL
Sbjct: 61  QKVINSDNPVIVNFHAEWCDPCKILTPKMLELLENSNEIDL 101


>AL023893-3|CAA19652.1|  160|Drosophila melanogaster EG:132E8.3
           protein.
          Length = 160

 Score = 32.7 bits (71), Expect = 0.70
 Identities = 14/41 (34%), Positives = 21/41 (51%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           + VI +   ++V F+A WC  CK L P+  +      E DL
Sbjct: 61  QKVINSDNPVIVNFHAEWCDPCKILTPKMLELLENSNEIDL 101


>AE014298-194|AAF45615.1|  160|Drosophila melanogaster CG3719-PA
           protein.
          Length = 160

 Score = 32.7 bits (71), Expect = 0.70
 Identities = 14/41 (34%), Positives = 21/41 (51%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           + VI +   ++V F+A WC  CK L P+  +      E DL
Sbjct: 61  QKVINSDNPVIVNFHAEWCDPCKILTPKMLELLENSNEIDL 101


>AE014296-2483|AAN11792.1|  175|Drosophila melanogaster CG6988-PB,
           isoform B protein.
          Length = 175

 Score = 31.9 bits (69), Expect = 1.2
 Identities = 15/43 (34%), Positives = 25/43 (58%)
 Frame = +2

Query: 47  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVE 175
           +F A + +  +   EV  EE VLV +  NF+ +I   E++LV+
Sbjct: 8   LFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVD 50


>L27072-1|AAA28937.1|  107|Drosophila melanogaster thioredoxin-like
           protein protein.
          Length = 107

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 11/30 (36%), Positives = 17/30 (56%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           I+++FYA WCG CK +       A K + +
Sbjct: 22  IVLDFYATWCGPCKEMESTVKSLARKYSSK 51


>AE014298-719|AAF46019.1|  107|Drosophila melanogaster CG4193-PA
           protein.
          Length = 107

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 11/30 (36%), Positives = 17/30 (56%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           I+++FYA WCG CK +       A K + +
Sbjct: 22  IVLDFYATWCGPCKEMESTVKSLARKYSSK 51


>M30413-1|AAA28459.1|  742|Drosophila melanogaster protein (
           D.melanogaster cGMP-dependent protein kinase (DG2;T3)
           mRNA, complete cds.).
          Length = 742

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637 FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
           F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 650 FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 697


>M30149-1|AAA28454.1|  934|Drosophila melanogaster protein (
           D.melanogaster cGMP-dependent protein kinase (DG2;cD5)
           mRNA, complete cds.).
          Length = 934

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637 FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
           F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 842 FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 889


>M30148-1|AAA28458.1|  894|Drosophila melanogaster protein (
           D.melanogaster cGMP-dependent protein kinase (DG2;T2b)
           mRNA, complete cds.).
          Length = 894

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637 FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
           F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 802 FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 849


>M30147-1|AAA28456.1|  894|Drosophila melanogaster protein (
           D.melanogaster cGMP-dependent protein kinase (DG2;T2a)
           mRNA, complete cds.).
          Length = 894

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637 FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
           F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 802 FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 849


>M27124-1|AAA28457.1|  894|Drosophila melanogaster protein (
           D.melanogaster cGMP-dependent protein kinase (DG2;T2)
           gene, exons 6, 7 and8. ).
          Length = 894

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637 FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
           F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 802 FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 849


>M27120-1|AAA28455.1| 1088|Drosophila melanogaster protein (
            D.melanogaster cGMP-dependent protein kinase (DG2;T1a)
            gene, exons 6 through10. ).
          Length = 1088

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637  FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
            F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 996  FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 1043


>BT004881-1|AAO45237.1|  894|Drosophila melanogaster GH10421p
           protein.
          Length = 894

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637 FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
           F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 802 FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 849


>AY061514-1|AAL29062.1| 1088|Drosophila melanogaster LD46758p protein.
          Length = 1088

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637  FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
            F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 996  FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 1043


>AF132175-1|AAD34763.2|  894|Drosophila melanogaster LD21570p
           protein.
          Length = 894

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637 FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
           F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 802 FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 849


>AE014134-647|AAX52650.1|  934|Drosophila melanogaster CG10033-PJ,
           isoform J protein.
          Length = 934

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637 FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
           F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 842 FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 889


>AE014134-646|AAG22254.1|  934|Drosophila melanogaster CG10033-PE,
           isoform E protein.
          Length = 934

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637 FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
           F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 842 FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 889


>AE014134-645|AAS64616.1|  894|Drosophila melanogaster CG10033-PG,
           isoform G protein.
          Length = 894

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637 FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
           F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 802 FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 849


>AE014134-644|AAS64615.1|  894|Drosophila melanogaster CG10033-PF,
           isoform F protein.
          Length = 894

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637 FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
           F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 802 FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 849


>AE014134-643|AAG22253.1|  894|Drosophila melanogaster CG10033-PD,
           isoform D protein.
          Length = 894

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637 FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
           F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 802 FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 849


>AE014134-642|AAG22252.2|  894|Drosophila melanogaster CG10033-PC,
           isoform C protein.
          Length = 894

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637 FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
           F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 802 FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 849


>AE014134-641|AAG22251.1|  742|Drosophila melanogaster CG10033-PB,
           isoform B protein.
          Length = 742

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637 FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
           F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 650 FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 697


>AE014134-640|AAS64614.1| 1088|Drosophila melanogaster CG10033-PI,
            isoform I protein.
          Length = 1088

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637  FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
            F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 996  FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 1043


>AE014134-639|AAS64613.1| 1088|Drosophila melanogaster CG10033-PH,
            isoform H protein.
          Length = 1088

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637  FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
            F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 996  FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 1043


>AE014134-638|AAF51082.2| 1088|Drosophila melanogaster CG10033-PA,
            isoform A protein.
          Length = 1088

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +1

Query: 637  FSRTSKRNVSNMXMKKSLRICSMLWGLSRAWLTIXEFSA*NWFPRFFWWG 786
            F R   RN SN+  K      +   G  R  ++  E     WF  F+WWG
Sbjct: 996  FPRNITRNASNLIKKLCRDNPAERLGYQRGGIS--EIQKHKWFDGFYWWG 1043


>AE014298-2895|AAF48986.1|  606|Drosophila melanogaster CG14221-PA
           protein.
          Length = 606

 Score = 29.5 bits (63), Expect = 6.5
 Identities = 11/46 (23%), Positives = 22/46 (47%)
 Frame = +2

Query: 122 SKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           S   FE  +  +  ++++ Y+ WCG C  +     K   +L  ++L
Sbjct: 16  SDEEFEKFLQRSGLLVLDIYSEWCGPCLGMVGSLRKIKLELGGDNL 61


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 38,194,954
Number of Sequences: 53049
Number of extensions: 790234
Number of successful extensions: 2451
Number of sequences better than 10.0: 86
Number of HSP's better than 10.0 without gapping: 2157
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2434
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4352837424
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -