SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30165.Seq
         (897 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT001649-1|AAN71404.1|  601|Drosophila melanogaster RE43755p pro...    98   2e-20
AE014298-960|AAF46204.1|  601|Drosophila melanogaster CG3075-PA ...    98   2e-20
BT022745-1|AAY55161.1|  155|Drosophila melanogaster IP14609p pro...    52   1e-06
AE013599-3393|AAF46843.1|  155|Drosophila melanogaster CG11301-P...    52   1e-06
AY118858-1|AAM50718.1|  133|Drosophila melanogaster GM21739p pro...    52   1e-06
AY118935-1|AAM50795.1|  341|Drosophila melanogaster LD24434p pro...    40   0.006
AF302258-1|AAG15389.1|  341|Drosophila melanogaster NC2alpha pro...    40   0.006
AE013599-3251|AAF46749.2|  341|Drosophila melanogaster CG10318-P...    40   0.006
AY113515-1|AAM29520.1|  140|Drosophila melanogaster RE59557p pro...    33   0.40 
AJ271142-1|CAB70603.1|  140|Drosophila melanogaster histone-fold...    33   0.40 
AE014298-1740|AAF48131.1|  140|Drosophila melanogaster CG15736-P...    33   0.40 
AE014297-3252|AAF56081.1|  424|Drosophila melanogaster CG6688-PA...    30   4.9  
BT016082-1|AAV36967.1|  568|Drosophila melanogaster LD47465p pro...    29   6.5  
AY070520-1|AAL47991.1|  507|Drosophila melanogaster GH23534p pro...    29   6.5  
AE014297-2300|AAX52959.1|  568|Drosophila melanogaster CG5201-PC...    29   6.5  
AE014297-2299|AAF55383.1|  568|Drosophila melanogaster CG5201-PB...    29   6.5  
AE014297-2298|AAN13728.1|  568|Drosophila melanogaster CG5201-PA...    29   6.5  
AB004232-1|BAA22841.1|  568|Drosophila melanogaster DAD polypept...    29   6.5  

>BT001649-1|AAN71404.1|  601|Drosophila melanogaster RE43755p
           protein.
          Length = 601

 Score = 97.9 bits (233), Expect = 2e-20
 Identities = 43/73 (58%), Positives = 52/73 (71%)
 Frame = +1

Query: 292 TLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFI 471
           T+  FW  ++ ++  +   D K Q LPLARIKKIMKLDE  KMI+ EAP+LFAKA E FI
Sbjct: 129 TIDNFWPNIVSEVHSIGQVDAKHQVLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFI 188

Query: 472 HELTLRAWSHTEE 510
            ELT+ AW HTEE
Sbjct: 189 QELTMHAWVHTEE 201



 Score = 39.1 bits (87), Expect = 0.008
 Identities = 16/25 (64%), Positives = 20/25 (80%)
 Frame = +2

Query: 542 SDSILKSDQFDFLIDIVPRHEVKPT 616
           + +I   DQFDFLIDIVPR E+KP+
Sbjct: 213 AQAIANYDQFDFLIDIVPREEIKPS 237


>AE014298-960|AAF46204.1|  601|Drosophila melanogaster CG3075-PA
           protein.
          Length = 601

 Score = 97.9 bits (233), Expect = 2e-20
 Identities = 43/73 (58%), Positives = 52/73 (71%)
 Frame = +1

Query: 292 TLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFI 471
           T+  FW  ++ ++  +   D K Q LPLARIKKIMKLDE  KMI+ EAP+LFAKA E FI
Sbjct: 129 TIDNFWPNIVSEVHSIGQVDAKHQVLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFI 188

Query: 472 HELTLRAWSHTEE 510
            ELT+ AW HTEE
Sbjct: 189 QELTMHAWVHTEE 201



 Score = 39.1 bits (87), Expect = 0.008
 Identities = 16/25 (64%), Positives = 20/25 (80%)
 Frame = +2

Query: 542 SDSILKSDQFDFLIDIVPRHEVKPT 616
           + +I   DQFDFLIDIVPR E+KP+
Sbjct: 213 AQAIANYDQFDFLIDIVPREEIKPS 237


>BT022745-1|AAY55161.1|  155|Drosophila melanogaster IP14609p
           protein.
          Length = 155

 Score = 52.0 bits (119), Expect = 1e-06
 Identities = 28/76 (36%), Positives = 47/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query: 292 TLQQFWDKVLEDIQKVNSE-DFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           T +Q  +K + +  K  ++ + K   LPLARI+ IMKLD ++ M + EA  + AKA E+F
Sbjct: 52  TTEQLTEKPVTNGNKAPADNEAKMTQLPLARIRNIMKLDPDLHMANNEAVFIVAKAVELF 111

Query: 469 IHELTLRAWSHTEEIK 516
           I  L+  ++++T + K
Sbjct: 112 IASLSRESYTYTAQSK 127


>AE013599-3393|AAF46843.1|  155|Drosophila melanogaster CG11301-PA
           protein.
          Length = 155

 Score = 52.0 bits (119), Expect = 1e-06
 Identities = 28/76 (36%), Positives = 47/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query: 292 TLQQFWDKVLEDIQKVNSE-DFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           T +Q  +K + +  K  ++ + K   LPLARI+ IMKLD ++ M + EA  + AKA E+F
Sbjct: 52  TTEQLTEKPVTNGNKAPADNEAKMTQLPLARIRNIMKLDPDLHMANNEAVFIVAKAVELF 111

Query: 469 IHELTLRAWSHTEEIK 516
           I  L+  ++++T + K
Sbjct: 112 IASLSRESYTYTAQSK 127


>AY118858-1|AAM50718.1|  133|Drosophila melanogaster GM21739p
           protein.
          Length = 133

 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 28/76 (36%), Positives = 47/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query: 292 TLQQFWDKVLEDIQKVNSE-DFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           T +Q  +K + +  K  ++ + K   LPLARI+ IMKLD ++ M + EA  + AKA E+F
Sbjct: 30  TTEQLAEKPVTNGNKAPADNEAKMTQLPLARIRNIMKLDPDLHMANNEAVFIVAKAVELF 89

Query: 469 IHELTLRAWSHTEEIK 516
           I  L+  ++++T + K
Sbjct: 90  IASLSRESYTYTAQSK 105


>AY118935-1|AAM50795.1|  341|Drosophila melanogaster LD24434p
           protein.
          Length = 341

 Score = 39.5 bits (88), Expect = 0.006
 Identities = 22/69 (31%), Positives = 34/69 (49%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIKGGLCSATT*RQ 549
           P  RIKKIM+ DEE+  ++   PV+ ++  E+F+  L  +    T        S +  RQ
Sbjct: 13  PAGRIKKIMQSDEEIGKVAQAVPVIISRTLELFVESLLTKTLRITNARNAKTLSPSHMRQ 72

Query: 550 YIEIGSVRF 576
            I +   RF
Sbjct: 73  CI-VSEKRF 80


>AF302258-1|AAG15389.1|  341|Drosophila melanogaster NC2alpha
           protein.
          Length = 341

 Score = 39.5 bits (88), Expect = 0.006
 Identities = 22/69 (31%), Positives = 34/69 (49%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIKGGLCSATT*RQ 549
           P  RIKKIM+ DEE+  ++   PV+ ++  E+F+  L  +    T        S +  RQ
Sbjct: 13  PAGRIKKIMQSDEEIGKVAQAVPVIISRTLELFVESLLTKTLRITNARNAKTLSPSHMRQ 72

Query: 550 YIEIGSVRF 576
            I +   RF
Sbjct: 73  CI-VSEKRF 80


>AE013599-3251|AAF46749.2|  341|Drosophila melanogaster CG10318-PA,
           isoform A protein.
          Length = 341

 Score = 39.5 bits (88), Expect = 0.006
 Identities = 22/69 (31%), Positives = 34/69 (49%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIKGGLCSATT*RQ 549
           P  RIKKIM+ DEE+  ++   PV+ ++  E+F+  L  +    T        S +  RQ
Sbjct: 13  PAGRIKKIMQSDEEIGKVAQAVPVIISRTLELFVESLLTKTLRITNARNAKTLSPSHMRQ 72

Query: 550 YIEIGSVRF 576
            I +   RF
Sbjct: 73  CI-VSEKRF 80


>AY113515-1|AAM29520.1|  140|Drosophila melanogaster RE59557p
           protein.
          Length = 140

 Score = 33.5 bits (73), Expect = 0.40
 Identities = 18/48 (37%), Positives = 27/48 (56%)
 Frame = +1

Query: 367 LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEE 510
           LPL+R++ IMK   +  +I+ E   L  K  E+F+  L   A  +TEE
Sbjct: 20  LPLSRVRTIMKSSMDTGLITNEVLFLMTKCTELFVRHLAGAA--YTEE 65


>AJ271142-1|CAB70603.1|  140|Drosophila melanogaster histone-fold
           protein CHRAC subunit protein.
          Length = 140

 Score = 33.5 bits (73), Expect = 0.40
 Identities = 18/48 (37%), Positives = 27/48 (56%)
 Frame = +1

Query: 367 LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEE 510
           LPL+R++ IMK   +  +I+ E   L  K  E+F+  L   A  +TEE
Sbjct: 20  LPLSRVRTIMKSSMDTGLITNEVLFLMTKCTELFVRHLAGAA--YTEE 65


>AE014298-1740|AAF48131.1|  140|Drosophila melanogaster CG15736-PA
           protein.
          Length = 140

 Score = 33.5 bits (73), Expect = 0.40
 Identities = 18/48 (37%), Positives = 27/48 (56%)
 Frame = +1

Query: 367 LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEE 510
           LPL+R++ IMK   +  +I+ E   L  K  E+F+  L   A  +TEE
Sbjct: 20  LPLSRVRTIMKSSMDTGLITNEVLFLMTKCTELFVRHLAGAA--YTEE 65


>AE014297-3252|AAF56081.1|  424|Drosophila melanogaster CG6688-PA
           protein.
          Length = 424

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 15/28 (53%), Positives = 20/28 (71%)
 Frame = -1

Query: 315 FVPELLEGLCAASAEDSSPANQRPLLRT 232
           F+ +LLEG CA S ++ SP+N   LLRT
Sbjct: 247 FLTKLLEG-CAYSTDNLSPSNAATLLRT 273


>BT016082-1|AAV36967.1|  568|Drosophila melanogaster LD47465p
           protein.
          Length = 568

 Score = 29.5 bits (63), Expect = 6.5
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = -2

Query: 374 NGKAWVLKSSELTFCMSSKTLSQNCWRVC 288
           NG  W+      T  + S TLS+N  RVC
Sbjct: 471 NGDVWIYNRGNTTIFVDSPTLSENLDRVC 499


>AY070520-1|AAL47991.1|  507|Drosophila melanogaster GH23534p
           protein.
          Length = 507

 Score = 29.5 bits (63), Expect = 6.5
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = -2

Query: 374 NGKAWVLKSSELTFCMSSKTLSQNCWRVC 288
           NG  W+      T  + S TLS+N  RVC
Sbjct: 410 NGDVWIYNRGNTTIFVDSPTLSENLDRVC 438


>AE014297-2300|AAX52959.1|  568|Drosophila melanogaster CG5201-PC,
           isoform C protein.
          Length = 568

 Score = 29.5 bits (63), Expect = 6.5
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = -2

Query: 374 NGKAWVLKSSELTFCMSSKTLSQNCWRVC 288
           NG  W+      T  + S TLS+N  RVC
Sbjct: 471 NGDVWIYNRGNTTIFVDSPTLSENLDRVC 499


>AE014297-2299|AAF55383.1|  568|Drosophila melanogaster CG5201-PB,
           isoform B protein.
          Length = 568

 Score = 29.5 bits (63), Expect = 6.5
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = -2

Query: 374 NGKAWVLKSSELTFCMSSKTLSQNCWRVC 288
           NG  W+      T  + S TLS+N  RVC
Sbjct: 471 NGDVWIYNRGNTTIFVDSPTLSENLDRVC 499


>AE014297-2298|AAN13728.1|  568|Drosophila melanogaster CG5201-PA,
           isoform A protein.
          Length = 568

 Score = 29.5 bits (63), Expect = 6.5
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = -2

Query: 374 NGKAWVLKSSELTFCMSSKTLSQNCWRVC 288
           NG  W+      T  + S TLS+N  RVC
Sbjct: 471 NGDVWIYNRGNTTIFVDSPTLSENLDRVC 499


>AB004232-1|BAA22841.1|  568|Drosophila melanogaster DAD polypeptide
           protein.
          Length = 568

 Score = 29.5 bits (63), Expect = 6.5
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = -2

Query: 374 NGKAWVLKSSELTFCMSSKTLSQNCWRVC 288
           NG  W+      T  + S TLS+N  RVC
Sbjct: 471 NGDVWIYNRGNTTIFVDSPTLSENLDRVC 499


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 35,506,961
Number of Sequences: 53049
Number of extensions: 691820
Number of successful extensions: 2057
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 1745
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2057
length of database: 24,988,368
effective HSP length: 85
effective length of database: 20,479,203
effective search space used: 4362070239
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -