SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30164.Seq
         (888 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF132553-1|AAD27852.1|  801|Drosophila melanogaster BcDNA.GM0288...   164   2e-40
AF047037-1|AAC27447.1|  801|Drosophila melanogaster transitional...   164   2e-40
AE013599-984|AAF58863.1|  801|Drosophila melanogaster CG2331-PA,...   164   2e-40
AF202034-1|AAF17568.1|  799|Drosophila melanogaster endoplasmic ...   150   3e-36
BT010235-1|AAQ23553.1|  424|Drosophila melanogaster RE52890p pro...    30   3.7  
AE014297-3237|AAF56066.1|  424|Drosophila melanogaster CG7023-PB...    30   3.7  
AE014298-1761|AAN09307.1|  618|Drosophila melanogaster CG32651-P...    29   6.5  
AE014297-3238|AAN13921.1|  364|Drosophila melanogaster CG7023-PA...    29   8.6  

>AF132553-1|AAD27852.1|  801|Drosophila melanogaster BcDNA.GM02885
           protein.
          Length = 801

 Score =  164 bits (398), Expect = 2e-40
 Identities = 101/224 (45%), Positives = 130/224 (58%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           + +G+  +   CIVLSDD CPDEKIRM            SDVVS+  CP VKYGKRV IL
Sbjct: 55  ILKGKRRKETVCIVLSDDTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRIL 114

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           PID+S EG+TGNLFE+YLKPYF+EAYRPIH  D F    A  P   K        +   +
Sbjct: 115 PIDESTEGVTGNLFEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYC--I 172

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           + P   +  +   ++++ +   L+A+    +       AQIKEMVELPLR   ++ + + 
Sbjct: 173 VAPETVIFCDGDPIKREEEEESLNAVGYDDIGGCRKQLAQIKEMVELPLRHP-SLFKAIG 231

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K PRGIL ++G   TGK T     +  ETGA  FLINGP IMS
Sbjct: 232 VKPPRGIL-MYGPPGTGK-TLIARAVANETGAFFFLINGPEIMS 273



 Score =  110 bits (264), Expect = 3e-24
 Identities = 54/66 (81%), Positives = 63/66 (95%)
 Frame = +2

Query: 59  MADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGK 238
           MAD+K  +DL+TAIL+RKDRPNRLIVEEA +DDNSVV+LSQAKM++LQLFRGDTV+LKGK
Sbjct: 1   MADSKG-EDLATAILKRKDRPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGK 59

Query: 239 RRKETV 256
           RRKETV
Sbjct: 60  RRKETV 65


>AF047037-1|AAC27447.1|  801|Drosophila melanogaster transitional
           endoplasmic reticulumATPase TER94 protein.
          Length = 801

 Score =  164 bits (398), Expect = 2e-40
 Identities = 101/224 (45%), Positives = 130/224 (58%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           + +G+  +   CIVLSDD CPDEKIRM            SDVVS+  CP VKYGKRV IL
Sbjct: 55  ILKGKRRKETVCIVLSDDTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRIL 114

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           PID+S EG+TGNLFE+YLKPYF+EAYRPIH  D F    A  P   K        +   +
Sbjct: 115 PIDESTEGVTGNLFEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYC--I 172

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           + P   +  +   ++++ +   L+A+    +       AQIKEMVELPLR   ++ + + 
Sbjct: 173 VAPETVIFCDGDPIKREEEEESLNAVGYDDIGGCRKQLAQIKEMVELPLRHP-SLFKAIG 231

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K PRGIL ++G   TGK T     +  ETGA  FLINGP IMS
Sbjct: 232 VKPPRGIL-MYGPPGTGK-TLIARAVANETGAFFFLINGPEIMS 273



 Score =  110 bits (264), Expect = 3e-24
 Identities = 54/66 (81%), Positives = 63/66 (95%)
 Frame = +2

Query: 59  MADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGK 238
           MAD+K  +DL+TAIL+RKDRPNRLIVEEA +DDNSVV+LSQAKM++LQLFRGDTV+LKGK
Sbjct: 1   MADSKG-EDLATAILKRKDRPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGK 59

Query: 239 RRKETV 256
           RRKETV
Sbjct: 60  RRKETV 65


>AE013599-984|AAF58863.1|  801|Drosophila melanogaster CG2331-PA,
           isoform A protein.
          Length = 801

 Score =  164 bits (398), Expect = 2e-40
 Identities = 101/224 (45%), Positives = 130/224 (58%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           + +G+  +   CIVLSDD CPDEKIRM            SDVVS+  CP VKYGKRV IL
Sbjct: 55  ILKGKRRKETVCIVLSDDTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRIL 114

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           PID+S EG+TGNLFE+YLKPYF+EAYRPIH  D F    A  P   K        +   +
Sbjct: 115 PIDESTEGVTGNLFEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYC--I 172

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           + P   +  +   ++++ +   L+A+    +       AQIKEMVELPLR   ++ + + 
Sbjct: 173 VAPETVIFCDGDPIKREEEEESLNAVGYDDIGGCRKQLAQIKEMVELPLRHP-SLFKAIG 231

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K PRGIL ++G   TGK T     +  ETGA  FLINGP IMS
Sbjct: 232 VKPPRGIL-MYGPPGTGK-TLIARAVANETGAFFFLINGPEIMS 273



 Score =  110 bits (264), Expect = 3e-24
 Identities = 54/66 (81%), Positives = 63/66 (95%)
 Frame = +2

Query: 59  MADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGK 238
           MAD+K  +DL+TAIL+RKDRPNRLIVEEA +DDNSVV+LSQAKM++LQLFRGDTV+LKGK
Sbjct: 1   MADSKG-EDLATAILKRKDRPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGK 59

Query: 239 RRKETV 256
           RRKETV
Sbjct: 60  RRKETV 65


>AF202034-1|AAF17568.1|  799|Drosophila melanogaster endoplasmic
           reticulum membranefusion protein protein.
          Length = 799

 Score =  150 bits (363), Expect = 3e-36
 Identities = 96/224 (42%), Positives = 124/224 (55%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           + +G+  +   CIVLSDD CPDEKIRM            SDVVS+  CP VKYGKRV IL
Sbjct: 55  ILKGKRRKETVCIVLSDDTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRIL 114

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           PID+S EG+TGNLFE+YLKPYF      IH  D F    A  P   K        +   +
Sbjct: 115 PIDESTEGVTGNLFEIYLKPYFPRGLSAIHMGDNFIVRAAMRPIEFKVVLTDPEPYC--I 172

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           + P   +  +   ++++ +   L+A+    +       AQIKEMVELPLR   ++ + + 
Sbjct: 173 VAPETVIFCDGDPIKREEEEESLNAVGYDDIGGCRKQLAQIKEMVELPLRHP-SLFKAIG 231

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K PRGIL ++G   TGK T     +  ETGA  FLINGP IMS
Sbjct: 232 VKPPRGIL-MYGPPGTGK-TLIARAVANETGAFFFLINGPEIMS 273



 Score =  110 bits (264), Expect = 3e-24
 Identities = 54/66 (81%), Positives = 63/66 (95%)
 Frame = +2

Query: 59  MADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGK 238
           MAD+K  +DL+TAIL+RKDRPNRLIVEEA +DDNSVV+LSQAKM++LQLFRGDTV+LKGK
Sbjct: 1   MADSKG-EDLATAILKRKDRPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGK 59

Query: 239 RRKETV 256
           RRKETV
Sbjct: 60  RRKETV 65


>BT010235-1|AAQ23553.1|  424|Drosophila melanogaster RE52890p
           protein.
          Length = 424

 Score = 30.3 bits (65), Expect = 3.7
 Identities = 15/41 (36%), Positives = 18/41 (43%)
 Frame = +1

Query: 169 GTFTGQNGATSTLPW*HSLAQGQTPQGNRCIVLSDDNCPDE 291
           G  TG NGA S   W H + QG      RC+     +  DE
Sbjct: 209 GNGTGTNGANSEPTWVHEIFQGILTSETRCLNCETVSSKDE 249


>AE014297-3237|AAF56066.1|  424|Drosophila melanogaster CG7023-PB,
           isoform B protein.
          Length = 424

 Score = 30.3 bits (65), Expect = 3.7
 Identities = 15/41 (36%), Positives = 18/41 (43%)
 Frame = +1

Query: 169 GTFTGQNGATSTLPW*HSLAQGQTPQGNRCIVLSDDNCPDE 291
           G  TG NGA S   W H + QG      RC+     +  DE
Sbjct: 209 GNGTGTNGANSEPTWVHEIFQGILTSETRCLNCETVSSKDE 249


>AE014298-1761|AAN09307.1|  618|Drosophila melanogaster CG32651-PA
           protein.
          Length = 618

 Score = 29.5 bits (63), Expect = 6.5
 Identities = 13/25 (52%), Positives = 17/25 (68%)
 Frame = +2

Query: 377 NMENESTYCQLMIQLRVLLAIYSKY 451
           N+ NES  C  +IQL+ +L  YSKY
Sbjct: 479 NVTNESVKCHAVIQLQNVLLEYSKY 503


>AE014297-3238|AAN13921.1|  364|Drosophila melanogaster CG7023-PA,
           isoform A protein.
          Length = 364

 Score = 29.1 bits (62), Expect = 8.6
 Identities = 14/38 (36%), Positives = 17/38 (44%)
 Frame = +1

Query: 178 TGQNGATSTLPW*HSLAQGQTPQGNRCIVLSDDNCPDE 291
           TG NGA S   W H + QG      RC+     +  DE
Sbjct: 152 TGTNGANSEPTWVHEIFQGILTSETRCLNCETVSSKDE 189


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 41,969,914
Number of Sequences: 53049
Number of extensions: 905663
Number of successful extensions: 2386
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 2275
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2370
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4332305172
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -