SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30163.Seq
         (824 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY061440-1|AAL28988.1|  352|Drosophila melanogaster LD37574p pro...   119   6e-27
AE014296-2093|AAF49961.3|  352|Drosophila melanogaster CG5654-PA...   119   6e-27
U49120-1|AAB94634.1|  359|Drosophila melanogaster Y-box protein ...   112   5e-25
AY118360-1|AAM48389.1|  195|Drosophila melanogaster RE05342p pro...    40   0.004
AF521096-1|AAM77748.1|  195|Drosophila melanogaster RNA-binding ...    40   0.004
AE014296-983|AAF50758.2|  195|Drosophila melanogaster CG17334-PA...    40   0.004
AE014296-347|AAF47561.2| 1314|Drosophila melanogaster CG13921-PA...    31   1.9  
BT029040-1|ABJ16973.1|  460|Drosophila melanogaster IP03738p pro...    29   7.7  

>AY061440-1|AAL28988.1|  352|Drosophila melanogaster LD37574p
           protein.
          Length = 352

 Score =  119 bits (286), Expect = 6e-27
 Identities = 55/73 (75%), Positives = 63/73 (86%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DT+EDVFVHQ+AIARNNP+KAVRSVGDGE VEF VV GEKG EAA VTGP GEPV
Sbjct: 77  FINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPV 136

Query: 421 KGSPYAADKRRGY 459
           +GS +AADKRR +
Sbjct: 137 RGSQFAADKRRNF 149



 Score = 52.0 bits (119), Expect = 1e-06
 Identities = 23/29 (79%), Positives = 25/29 (86%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINRMTPRK 268
           VIA KV+GTVKWFNVKSGYGFINR   R+
Sbjct: 57  VIATKVTGTVKWFNVKSGYGFINRNDTRE 85


>AE014296-2093|AAF49961.3|  352|Drosophila melanogaster CG5654-PA
           protein.
          Length = 352

 Score =  119 bits (286), Expect = 6e-27
 Identities = 55/73 (75%), Positives = 63/73 (86%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DT+EDVFVHQ+AIARNNP+KAVRSVGDGE VEF VV GEKG EAA VTGP GEPV
Sbjct: 77  FINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPV 136

Query: 421 KGSPYAADKRRGY 459
           +GS +AADKRR +
Sbjct: 137 RGSQFAADKRRNF 149



 Score = 52.0 bits (119), Expect = 1e-06
 Identities = 23/29 (79%), Positives = 25/29 (86%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINRMTPRK 268
           VIA KV+GTVKWFNVKSGYGFINR   R+
Sbjct: 57  VIATKVTGTVKWFNVKSGYGFINRNDTRE 85


>U49120-1|AAB94634.1|  359|Drosophila melanogaster Y-box protein
           protein.
          Length = 359

 Score =  112 bits (270), Expect = 5e-25
 Identities = 54/73 (73%), Positives = 62/73 (84%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPV 420
           F  ++DT+EDVFVHQ+AIA NNP+KAVRSVGDGE VEF VV GEKG EAA VTGP GEPV
Sbjct: 78  FINRNDTREDVFVHQSAIA-NNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPV 136

Query: 421 KGSPYAADKRRGY 459
           +GS +AADKRR +
Sbjct: 137 RGSQFAADKRRNF 149



 Score = 52.0 bits (119), Expect = 1e-06
 Identities = 23/29 (79%), Positives = 25/29 (86%)
 Frame = +2

Query: 182 VIAEKVSGTVKWFNVKSGYGFINRMTPRK 268
           VIA KV+GTVKWFNVKSGYGFINR   R+
Sbjct: 58  VIATKVTGTVKWFNVKSGYGFINRNDTRE 86


>AY118360-1|AAM48389.1|  195|Drosophila melanogaster RE05342p
           protein.
          Length = 195

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 25/79 (31%), Positives = 38/79 (48%)
 Frame = +1

Query: 199 IGHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG 378
           +G C+     +   F   +D  ++VFVHQ+ I  +      RS+G+ E VEF      +G
Sbjct: 40  LGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMS----GFRSLGEQEEVEFECQRTSRG 95

Query: 379 FEAAGVTGPGGEPVKGSPY 435
            EA  V+   G   +GS Y
Sbjct: 96  LEATRVSSRHGGSCQGSTY 114


>AF521096-1|AAM77748.1|  195|Drosophila melanogaster RNA-binding
           protein LIN-28 protein.
          Length = 195

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 25/79 (31%), Positives = 38/79 (48%)
 Frame = +1

Query: 199 IGHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG 378
           +G C+     +   F   +D  ++VFVHQ+ I  +      RS+G+ E VEF      +G
Sbjct: 40  LGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMS----GFRSLGEQEEVEFECQRTSRG 95

Query: 379 FEAAGVTGPGGEPVKGSPY 435
            EA  V+   G   +GS Y
Sbjct: 96  LEATRVSSRHGGSCQGSTY 114


>AE014296-983|AAF50758.2|  195|Drosophila melanogaster CG17334-PA
           protein.
          Length = 195

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 25/79 (31%), Positives = 38/79 (48%)
 Frame = +1

Query: 199 IGHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG 378
           +G C+     +   F   +D  ++VFVHQ+ I  +      RS+G+ E VEF      +G
Sbjct: 40  LGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMS----GFRSLGEQEEVEFECQRTSRG 95

Query: 379 FEAAGVTGPGGEPVKGSPY 435
            EA  V+   G   +GS Y
Sbjct: 96  LEATRVSSRHGGSCQGSTY 114


>AE014296-347|AAF47561.2| 1314|Drosophila melanogaster CG13921-PA,
           isoform A protein.
          Length = 1314

 Score = 31.1 bits (67), Expect = 1.9
 Identities = 20/66 (30%), Positives = 30/66 (45%)
 Frame = -3

Query: 363 NHGKLHRLSVADRAHSLTWVVTGDGSLMHKHIFLGVILLMKPYPLLTLNHFTVPDTFSAM 184
           + G  HR     + + +  ++ G  S +   +FLGV  L+  Y +   N  TVP TF   
Sbjct: 476 HRGSAHRHGAGIKKYVVWCLICGGFSCLLGVLFLGVYFLLHSYTITVGNFETVP-TFVPA 534

Query: 183 TCFCLT 166
           T   LT
Sbjct: 535 TLLILT 540


>BT029040-1|ABJ16973.1|  460|Drosophila melanogaster IP03738p
           protein.
          Length = 460

 Score = 29.1 bits (62), Expect = 7.7
 Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = +1

Query: 292 IARNNPRKAVRSVGDGEAVEFAVVAGE-KGFEAAGVTGPGGEPVKGSPYAAD 444
           +AR  P        DG  V  AV+A +  G   AG T   G PV G+  AAD
Sbjct: 202 VARAVPATDGNGAPDGVPVAGAVLATDGNGAPVAGATDGNGAPVAGAVPAAD 253


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,037,314
Number of Sequences: 53049
Number of extensions: 487324
Number of successful extensions: 1614
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1537
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1613
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3901127880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -