SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30161.Seq
         (888 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY051689-1|AAK93113.1|  270|Drosophila melanogaster LD23646p pro...   106   4e-23
AF191498-1|AAF14696.1|  270|Drosophila melanogaster O-phosphoser...   106   4e-23
AE014296-1652|AAF50274.1|  270|Drosophila melanogaster CG3705-PA...   106   4e-23
M10017-1|AAA65478.1|  552|Drosophila melanogaster engrailed prot...    33   0.40 
AY069448-1|AAL39593.1|  552|Drosophila melanogaster LD16125p pro...    33   0.40 
AE013599-1321|AAM68711.1|  552|Drosophila melanogaster CG9015-PB...    33   0.40 
AE013599-1320|AAF58639.1|  552|Drosophila melanogaster CG9015-PA...    33   0.40 
BT030440-1|ABO52860.1| 1378|Drosophila melanogaster LD40879p pro...    33   0.53 
AE014296-778|AAX52730.2|  660|Drosophila melanogaster CG33545-PA...    33   0.70 
U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro...    31   2.8  
M34394-1|AAA28976.1| 1275|Drosophila melanogaster protein ( D.me...    31   2.8  
M21306-1|AAA56928.1| 1274|Drosophila melanogaster photoreceptor ...    31   2.8  
BT029275-1|ABK30912.1|  640|Drosophila melanogaster IP09721p pro...    31   2.8  
BT025806-1|ABF85706.1|  620|Drosophila melanogaster IP01548p pro...    31   2.8  
BT022190-1|AAY51584.1|  640|Drosophila melanogaster IP01192p pro...    31   2.8  
BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro...    31   2.8  
BT001536-1|AAN71291.1|  448|Drosophila melanogaster RE08243p pro...    31   2.8  
AY118584-1|AAM49953.1|  448|Drosophila melanogaster LD44207p pro...    31   2.8  
AE014298-752|AAF46043.2|  640|Drosophila melanogaster CG33980-PA...    31   2.8  
AE014297-4482|AAF56970.1| 1275|Drosophila melanogaster CG7875-PA...    31   2.8  
AE014297-13|AAF52167.1|  448|Drosophila melanogaster CG18143-PA ...    31   2.8  
AE014296-1148|AAN12081.1| 2465|Drosophila melanogaster CG32394-P...    31   2.8  
AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB...    31   2.8  
AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA...    31   2.8  
L77907-1|AAC37264.1| 1883|Drosophila melanogaster chromodomain-h...    30   3.7  
BT011071-1|AAR82736.1| 1645|Drosophila melanogaster SD21488p pro...    30   3.7  
AY095050-1|AAM11378.1| 1101|Drosophila melanogaster LD39323p pro...    30   3.7  
AE014134-528|AAF51170.1| 1883|Drosophila melanogaster CG3733-PA ...    30   3.7  
AY118524-1|AAM49893.1| 2486|Drosophila melanogaster LD22609p pro...    29   6.5  
AE014298-2269|AAF48533.3| 2486|Drosophila melanogaster CG9056-PA...    29   6.5  
AY058603-1|AAL13832.1| 1553|Drosophila melanogaster LD29482p pro...    29   8.6  
AE014298-3031|AAF50897.2| 2181|Drosophila melanogaster CG1412-PA...    29   8.6  
AE013599-3680|AAF47056.1|  157|Drosophila melanogaster CG12491-P...    29   8.6  
AE013599-3679|ABI31112.1|  157|Drosophila melanogaster CG34105-P...    29   8.6  

>AY051689-1|AAK93113.1|  270|Drosophila melanogaster LD23646p
           protein.
          Length = 270

 Score =  106 bits (255), Expect = 4e-23
 Identities = 50/88 (56%), Positives = 66/88 (75%)
 Frame = +1

Query: 241 PTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALK 420
           P    ++ + +  VCFDVDSTVI +EGIDELA++CGKG EV R+T EAMGG MTFQ+ALK
Sbjct: 51  PQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEAMGGAMTFQDALK 110

Query: 421 KRLDIIRPNVGQIREFIEKFPVRLTPGI 504
            RL+IIRP   Q+R+FI++ P  L+  +
Sbjct: 111 IRLNIIRPTQQQVRDFIQERPSTLSKNV 138



 Score = 79.0 bits (186), Expect = 8e-15
 Identities = 41/95 (43%), Positives = 54/95 (56%)
 Frame = +3

Query: 507 RLVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPT 686
           R V  L   G  VYL+SGGF  LI PVA  L IP  N++AN++ F + GEY  FD N+PT
Sbjct: 140 RFVSHLKAEGKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDINQPT 199

Query: 687 SRSGGXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
           SRSGG    +  + + +    L+ + G G    EA
Sbjct: 200 SRSGGKAEAIALIRKENSDDSLITMIGDGATDLEA 234


>AF191498-1|AAF14696.1|  270|Drosophila melanogaster O-phosphoserine
           phosphohydrolaseAstray protein.
          Length = 270

 Score =  106 bits (255), Expect = 4e-23
 Identities = 50/88 (56%), Positives = 66/88 (75%)
 Frame = +1

Query: 241 PTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALK 420
           P    ++ + +  VCFDVDSTVI +EGIDELA++CGKG EV R+T EAMGG MTFQ+ALK
Sbjct: 51  PQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEAMGGAMTFQDALK 110

Query: 421 KRLDIIRPNVGQIREFIEKFPVRLTPGI 504
            RL+IIRP   Q+R+FI++ P  L+  +
Sbjct: 111 IRLNIIRPTQQQVRDFIQERPSTLSKNV 138



 Score = 79.0 bits (186), Expect = 8e-15
 Identities = 41/95 (43%), Positives = 54/95 (56%)
 Frame = +3

Query: 507 RLVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPT 686
           R V  L   G  VYL+SGGF  LI PVA  L IP  N++AN++ F + GEY  FD N+PT
Sbjct: 140 RFVSHLKAEGKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDINQPT 199

Query: 687 SRSGGXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
           SRSGG    +  + + +    L+ + G G    EA
Sbjct: 200 SRSGGKAEAIALIRKENNDDSLITMIGDGATDLEA 234


>AE014296-1652|AAF50274.1|  270|Drosophila melanogaster CG3705-PA
           protein.
          Length = 270

 Score =  106 bits (255), Expect = 4e-23
 Identities = 50/88 (56%), Positives = 66/88 (75%)
 Frame = +1

Query: 241 PTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGNMTFQEALK 420
           P    ++ + +  VCFDVDSTVI +EGIDELA++CGKG EV R+T EAMGG MTFQ+ALK
Sbjct: 51  PQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEAMGGAMTFQDALK 110

Query: 421 KRLDIIRPNVGQIREFIEKFPVRLTPGI 504
            RL+IIRP   Q+R+FI++ P  L+  +
Sbjct: 111 IRLNIIRPTQQQVRDFIQERPSTLSKNV 138



 Score = 79.0 bits (186), Expect = 8e-15
 Identities = 41/95 (43%), Positives = 54/95 (56%)
 Frame = +3

Query: 507 RLVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPT 686
           R V  L   G  VYL+SGGF  LI PVA  L IP  N++AN++ F + GEY  FD N+PT
Sbjct: 140 RFVSHLKAEGKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDINQPT 199

Query: 687 SRSGGXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
           SRSGG    +  + + +    L+ + G G    EA
Sbjct: 200 SRSGGKAEAIALIRKENSDDSLITMIGDGATDLEA 234


>M10017-1|AAA65478.1|  552|Drosophila melanogaster engrailed protein
           protein.
          Length = 552

 Score = 33.5 bits (73), Expect = 0.40
 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = -2

Query: 392 PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213
           PP AS  S ++S+      +SSS  S C +  S+   + S+ L  SG  V A+S    P+
Sbjct: 329 PPPASNASTISSTSSVAT-SSSSSSSGCSSAASSLNSSPSSRLGASGSGVNASSPQPQPI 387

Query: 212 -RASSTSRTAGCFSN 171
              S+ SR +G  S+
Sbjct: 388 PPPSAVSRDSGMESS 402



 Score = 29.1 bits (62), Expect = 8.6
 Identities = 24/77 (31%), Positives = 35/77 (45%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           P A  ++    S    +LAS    S+  T+ STS    S+  ++SG S  A+S  S+P  
Sbjct: 309 PAAPTMTQPPLSSSASSLASPPPASNASTISSTSSVATSSSSSSSGCSSAASSLNSSP-- 366

Query: 209 ASSTSRTAGCFSNCKEP 159
            SS    +G   N   P
Sbjct: 367 -SSRLGASGSGVNASSP 382


>AY069448-1|AAL39593.1|  552|Drosophila melanogaster LD16125p
           protein.
          Length = 552

 Score = 33.5 bits (73), Expect = 0.40
 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = -2

Query: 392 PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213
           PP AS  S ++S+      +SSS  S C +  S+   + S+ L  SG  V A+S    P+
Sbjct: 329 PPPASNASTISSTSSVAT-SSSSSSSGCSSAASSLNSSPSSRLGASGSGVNASSPQPQPI 387

Query: 212 -RASSTSRTAGCFSN 171
              S+ SR +G  S+
Sbjct: 388 PPPSAVSRDSGMESS 402



 Score = 29.1 bits (62), Expect = 8.6
 Identities = 24/77 (31%), Positives = 35/77 (45%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           P A  ++    S    +LAS    S+  T+ STS    S+  ++SG S  A+S  S+P  
Sbjct: 309 PAAPTMTQPPLSSSASSLASPPPASNASTISSTSSVATSSSSSSSGCSSAASSLNSSP-- 366

Query: 209 ASSTSRTAGCFSNCKEP 159
            SS    +G   N   P
Sbjct: 367 -SSRLGASGSGVNASSP 382


>AE013599-1321|AAM68711.1|  552|Drosophila melanogaster CG9015-PB,
           isoform B protein.
          Length = 552

 Score = 33.5 bits (73), Expect = 0.40
 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = -2

Query: 392 PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213
           PP AS  S ++S+      +SSS  S C +  S+   + S+ L  SG  V A+S    P+
Sbjct: 329 PPPASNASTISSTSSVAT-SSSSSSSGCSSAASSLNSSPSSRLGASGSGVNASSPQPQPI 387

Query: 212 -RASSTSRTAGCFSN 171
              S+ SR +G  S+
Sbjct: 388 PPPSAVSRDSGMESS 402



 Score = 29.1 bits (62), Expect = 8.6
 Identities = 24/77 (31%), Positives = 35/77 (45%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           P A  ++    S    +LAS    S+  T+ STS    S+  ++SG S  A+S  S+P  
Sbjct: 309 PAAPTMTQPPLSSSASSLASPPPASNASTISSTSSVATSSSSSSSGCSSAASSLNSSP-- 366

Query: 209 ASSTSRTAGCFSNCKEP 159
            SS    +G   N   P
Sbjct: 367 -SSRLGASGSGVNASSP 382


>AE013599-1320|AAF58639.1|  552|Drosophila melanogaster CG9015-PA,
           isoform A protein.
          Length = 552

 Score = 33.5 bits (73), Expect = 0.40
 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = -2

Query: 392 PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213
           PP AS  S ++S+      +SSS  S C +  S+   + S+ L  SG  V A+S    P+
Sbjct: 329 PPPASNASTISSTSSVAT-SSSSSSSGCSSAASSLNSSPSSRLGASGSGVNASSPQPQPI 387

Query: 212 -RASSTSRTAGCFSN 171
              S+ SR +G  S+
Sbjct: 388 PPPSAVSRDSGMESS 402



 Score = 29.1 bits (62), Expect = 8.6
 Identities = 24/77 (31%), Positives = 35/77 (45%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVR 210
           P A  ++    S    +LAS    S+  T+ STS    S+  ++SG S  A+S  S+P  
Sbjct: 309 PAAPTMTQPPLSSSASSLASPPPASNASTISSTSSVATSSSSSSSGCSSAASSLNSSP-- 366

Query: 209 ASSTSRTAGCFSNCKEP 159
            SS    +G   N   P
Sbjct: 367 -SSRLGASGSGVNASSP 382


>BT030440-1|ABO52860.1| 1378|Drosophila melanogaster LD40879p
           protein.
          Length = 1378

 Score = 33.1 bits (72), Expect = 0.53
 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 4/73 (5%)
 Frame = -2

Query: 362 TSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVG----ATSR*STPVRASSTS 195
           T + F  N  S++  SSC    +TS   ++ + NNS  S G    A++  S   R  S S
Sbjct: 168 TITSFNSNSNSNNSSSSCKNYNTTSNSNKNNIDNNSSNSSGQIMLASASASASARKRSRS 227

Query: 194 RTAGCFSNCKEPS 156
            + G  SN K  S
Sbjct: 228 TSNGSKSNNKTAS 240


>AE014296-778|AAX52730.2|  660|Drosophila melanogaster CG33545-PA
           protein.
          Length = 660

 Score = 32.7 bits (71), Expect = 0.70
 Identities = 20/54 (37%), Positives = 26/54 (48%)
 Frame = -2

Query: 416 KASWNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNS 255
           +AS N   P  A A +  TSSP P    SS   S   T  +++  TQS +L  S
Sbjct: 37  EASSNPTTPTTAVATTTSTSSPSPAASTSSKGHSQSATASASASATQSQLLTTS 90


>U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous
           protein protein.
          Length = 1091

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 13/27 (48%), Positives = 15/27 (55%)
 Frame = -1

Query: 828 PPKPMKPSAGGXKPRASVAPVPGRSPG 748
           PP PM   AGG  P     P+PGR+ G
Sbjct: 527 PPPPMPGRAGGGPPPPPPPPMPGRAGG 553


>M34394-1|AAA28976.1| 1275|Drosophila melanogaster protein (
            D.melanogaster trp proteingene, complete cds. ).
          Length = 1275

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 14/23 (60%), Positives = 14/23 (60%)
 Frame = -1

Query: 828  PPKPMKPSAGGXKPRASVAPVPG 760
            PPK  KPSAGG KP     P PG
Sbjct: 1017 PPKDSKPSAGGPKP-GDQKPTPG 1038


>M21306-1|AAA56928.1| 1274|Drosophila melanogaster photoreceptor
            membrane-associatedprotein protein.
          Length = 1274

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 14/23 (60%), Positives = 14/23 (60%)
 Frame = -1

Query: 828  PPKPMKPSAGGXKPRASVAPVPG 760
            PPK  KPSAGG KP     P PG
Sbjct: 1016 PPKDSKPSAGGPKP-GDQKPTPG 1037


>BT029275-1|ABK30912.1|  640|Drosophila melanogaster IP09721p
           protein.
          Length = 640

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 25/70 (35%), Positives = 35/70 (50%)
 Frame = -2

Query: 365 LTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTA 186
           L+SS    N+ S + PSSC T  STS    S     SG +  A+S  +TP  AS+T+ ++
Sbjct: 377 LSSSTESLNVVSPA-PSSCPTSASTSAPPTS----TSGYAGAASSAATTPTGASTTNSSS 431

Query: 185 GCFSNCKEPS 156
                   PS
Sbjct: 432 SPHIELGSPS 441


>BT025806-1|ABF85706.1|  620|Drosophila melanogaster IP01548p
           protein.
          Length = 620

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 14/23 (60%), Positives = 14/23 (60%)
 Frame = -1

Query: 828 PPKPMKPSAGGXKPRASVAPVPG 760
           PPK  KPSAGG KP     P PG
Sbjct: 362 PPKDSKPSAGGPKP-GDQKPTPG 383


>BT022190-1|AAY51584.1|  640|Drosophila melanogaster IP01192p
           protein.
          Length = 640

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 25/70 (35%), Positives = 35/70 (50%)
 Frame = -2

Query: 365 LTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTA 186
           L+SS    N+ S + PSSC T  STS    S     SG +  A+S  +TP  AS+T+ ++
Sbjct: 377 LSSSTESLNVVSPA-PSSCPTSASTSAPPTS----TSGYAGAASSAATTPTGASTTNSSS 431

Query: 185 GCFSNCKEPS 156
                   PS
Sbjct: 432 SPHIELGSPS 441


>BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p
           protein.
          Length = 1091

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 13/27 (48%), Positives = 15/27 (55%)
 Frame = -1

Query: 828 PPKPMKPSAGGXKPRASVAPVPGRSPG 748
           PP PM   AGG  P     P+PGR+ G
Sbjct: 527 PPPPMPGRAGGGPPPPPPPPMPGRAGG 553


>BT001536-1|AAN71291.1|  448|Drosophila melanogaster RE08243p
           protein.
          Length = 448

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = -1

Query: 456 LTDVRPDDVQSLLQGFLECHIAAHCFRRQSFNL 358
           LT+V   D Q L+ GF++CHI A  F +    L
Sbjct: 55  LTEVHLSDYQFLMPGFVDCHIHAPQFAQLGLGL 87


>AY118584-1|AAM49953.1|  448|Drosophila melanogaster LD44207p
           protein.
          Length = 448

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = -1

Query: 456 LTDVRPDDVQSLLQGFLECHIAAHCFRRQSFNL 358
           LT+V   D Q L+ GF++CHI A  F +    L
Sbjct: 55  LTEVHLSDYQFLMPGFVDCHIHAPQFAQLGLGL 87


>AE014298-752|AAF46043.2|  640|Drosophila melanogaster CG33980-PA
           protein.
          Length = 640

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 25/70 (35%), Positives = 35/70 (50%)
 Frame = -2

Query: 365 LTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTA 186
           L+SS    N+ S + PSSC T  STS    S     SG +  A+S  +TP  AS+T+ ++
Sbjct: 377 LSSSTESLNVVSPA-PSSCPTSASTSAPPTS----TSGYAGAASSAATTPTGASTTNSSS 431

Query: 185 GCFSNCKEPS 156
                   PS
Sbjct: 432 SPHIELGSPS 441


>AE014297-4482|AAF56970.1| 1275|Drosophila melanogaster CG7875-PA
            protein.
          Length = 1275

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 14/23 (60%), Positives = 14/23 (60%)
 Frame = -1

Query: 828  PPKPMKPSAGGXKPRASVAPVPG 760
            PPK  KPSAGG KP     P PG
Sbjct: 1017 PPKDSKPSAGGPKP-GDQKPTPG 1038


>AE014297-13|AAF52167.1|  448|Drosophila melanogaster CG18143-PA
           protein.
          Length = 448

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = -1

Query: 456 LTDVRPDDVQSLLQGFLECHIAAHCFRRQSFNL 358
           LT+V   D Q L+ GF++CHI A  F +    L
Sbjct: 55  LTEVHLSDYQFLMPGFVDCHIHAPQFAQLGLGL 87


>AE014296-1148|AAN12081.1| 2465|Drosophila melanogaster CG32394-PA
           protein.
          Length = 2465

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 18/51 (35%), Positives = 24/51 (47%)
 Frame = -2

Query: 398 ILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQS 246
           I  P  SA      S  P + +SSS   +  T  +   + Q AVLN+SG S
Sbjct: 25  IFIPSGSAQQQQQQSQEPPSSSSSSQSGTTTTASTVRSKKQKAVLNSSGSS 75


>AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB,
           isoform B protein.
          Length = 1091

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 13/27 (48%), Positives = 15/27 (55%)
 Frame = -1

Query: 828 PPKPMKPSAGGXKPRASVAPVPGRSPG 748
           PP PM   AGG  P     P+PGR+ G
Sbjct: 527 PPPPMPGRAGGGPPPPPPPPMPGRAGG 553


>AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA,
           isoform A protein.
          Length = 1091

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 13/27 (48%), Positives = 15/27 (55%)
 Frame = -1

Query: 828 PPKPMKPSAGGXKPRASVAPVPGRSPG 748
           PP PM   AGG  P     P+PGR+ G
Sbjct: 527 PPPPMPGRAGGGPPPPPPPPMPGRAGG 553


>L77907-1|AAC37264.1| 1883|Drosophila melanogaster
            chromodomain-helicase-DNA-bindingprotein protein.
          Length = 1883

 Score = 30.3 bits (65), Expect = 3.7
 Identities = 16/42 (38%), Positives = 25/42 (59%)
 Frame = +1

Query: 157  DGSLQFEKQPAVRDVEDALTGVDQRDVAPTDCPELFRTADCV 282
            D S+  E +  +R V+ AL  +DQ DV+ +D  +L  T DC+
Sbjct: 1506 DPSIFNECKEKMRPVKKALKALDQPDVSLSDQDQLQHTRDCL 1547


>BT011071-1|AAR82736.1| 1645|Drosophila melanogaster SD21488p protein.
          Length = 1645

 Score = 30.3 bits (65), Expect = 3.7
 Identities = 16/42 (38%), Positives = 25/42 (59%)
 Frame = +1

Query: 157  DGSLQFEKQPAVRDVEDALTGVDQRDVAPTDCPELFRTADCV 282
            D S+  E +  +R V+ AL  +DQ DV+ +D  +L  T DC+
Sbjct: 1506 DPSIFNECKEKMRPVKKALKALDQPDVSLSDQDQLQHTRDCL 1547


>AY095050-1|AAM11378.1| 1101|Drosophila melanogaster LD39323p protein.
          Length = 1101

 Score = 30.3 bits (65), Expect = 3.7
 Identities = 16/42 (38%), Positives = 25/42 (59%)
 Frame = +1

Query: 157  DGSLQFEKQPAVRDVEDALTGVDQRDVAPTDCPELFRTADCV 282
            D S+  E +  +R V+ AL  +DQ DV+ +D  +L  T DC+
Sbjct: 974  DPSIFNECKEKMRPVKKALKALDQPDVSLSDQDQLQHTRDCL 1015


>AE014134-528|AAF51170.1| 1883|Drosophila melanogaster CG3733-PA
            protein.
          Length = 1883

 Score = 30.3 bits (65), Expect = 3.7
 Identities = 16/42 (38%), Positives = 25/42 (59%)
 Frame = +1

Query: 157  DGSLQFEKQPAVRDVEDALTGVDQRDVAPTDCPELFRTADCV 282
            D S+  E +  +R V+ AL  +DQ DV+ +D  +L  T DC+
Sbjct: 1506 DPSIFNECKEKMRPVKKALKALDQPDVSLSDQDQLQHTRDCL 1547


>AY118524-1|AAM49893.1| 2486|Drosophila melanogaster LD22609p protein.
          Length = 2486

 Score = 29.5 bits (63), Expect = 6.5
 Identities = 18/56 (32%), Positives = 29/56 (51%)
 Frame = -2

Query: 335  ASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAGCFSNC 168
            +SSSMP     + S S +  +  LN+   +V  T   +TP+ +S ++R     SNC
Sbjct: 1582 SSSSMPPGLGNLSSYSSKA-ALWLNSPANAVVTTCAPTTPIVSSGSARPTPPLSNC 1636


>AE014298-2269|AAF48533.3| 2486|Drosophila melanogaster CG9056-PA
            protein.
          Length = 2486

 Score = 29.5 bits (63), Expect = 6.5
 Identities = 18/56 (32%), Positives = 29/56 (51%)
 Frame = -2

Query: 335  ASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAGCFSNC 168
            +SSSMP     + S S +  +  LN+   +V  T   +TP+ +S ++R     SNC
Sbjct: 1582 SSSSMPPGLGNLSSYSSKA-ALWLNSPANAVVTTCAPTTPIVSSGSARPTPPLSNC 1636


>AY058603-1|AAL13832.1| 1553|Drosophila melanogaster LD29482p protein.
          Length = 1553

 Score = 29.1 bits (62), Expect = 8.6
 Identities = 20/69 (28%), Positives = 38/69 (55%)
 Frame = -2

Query: 401  VILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*S 222
            ++LP   S+VSL    PF     + +  S+  +  ST+  + S+ L++ G++  ++S  S
Sbjct: 903  LLLPTPVSSVSL----PFQSLDYAKASASASASASSTASTSSSSTLHSGGKASASSSSSS 958

Query: 221  TPVRASSTS 195
            T   +SS+S
Sbjct: 959  TTKFSSSSS 967


>AE014298-3031|AAF50897.2| 2181|Drosophila melanogaster CG1412-PA
            protein.
          Length = 2181

 Score = 29.1 bits (62), Expect = 8.6
 Identities = 20/69 (28%), Positives = 38/69 (55%)
 Frame = -2

Query: 401  VILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*S 222
            ++LP   S+VSL    PF     + +  S+  +  ST+  + S+ L++ G++  ++S  S
Sbjct: 1531 LLLPTPVSSVSL----PFQSLDYAKASASASASASSTASTSSSSTLHSGGKASASSSSSS 1586

Query: 221  TPVRASSTS 195
            T   +SS+S
Sbjct: 1587 TTKFSSSSS 1595


>AE013599-3680|AAF47056.1|  157|Drosophila melanogaster CG12491-PA
           protein.
          Length = 157

 Score = 29.1 bits (62), Expect = 8.6
 Identities = 22/76 (28%), Positives = 36/76 (47%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
           +S+ S  ++S  P   +SSS PSS     STS  + ++  + S  +  ++S  S     S
Sbjct: 30  SSSTSPTSNSSTPSTSSSSSTPSSS---SSTSTPSSNSTTSTSSSTPSSSSSTSPTSSTS 86

Query: 203 STSRTAGCFSNCKEPS 156
           ST+ T    S   + S
Sbjct: 87  STTATTTAPSTSSDTS 102


>AE013599-3679|ABI31112.1|  157|Drosophila melanogaster CG34105-PA
           protein.
          Length = 157

 Score = 29.1 bits (62), Expect = 8.6
 Identities = 22/76 (28%), Positives = 36/76 (47%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
           +S+ S  ++S  P   +SSS PSS     STS  + ++  + S  +  ++S  S     S
Sbjct: 30  SSSTSPTSNSSTPSTSSSSSTPSSS---SSTSTPSSNSTTSTSSSTPSSSSSTSPTSSTS 86

Query: 203 STSRTAGCFSNCKEPS 156
           ST+ T    S   + S
Sbjct: 87  STTATTTAPSTSSDTS 102


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 37,511,915
Number of Sequences: 53049
Number of extensions: 780555
Number of successful extensions: 3300
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 2920
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3280
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4332305172
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -