SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30160.Seq
         (904 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY094852-1|AAM11205.1|  638|Drosophila melanogaster RE12569p pro...   167   1e-41
AE013599-2714|AAF57677.1|  638|Drosophila melanogaster CG10924-P...   167   1e-41
BT003447-1|AAO39450.1|  647|Drosophila melanogaster RH57538p pro...   155   1e-37
AE013599-2716|AAM68462.1|  500|Drosophila melanogaster CG17725-P...   155   1e-37
AE013599-2715|AAF57676.1|  647|Drosophila melanogaster CG17725-P...   155   1e-37
Y00402-1|CAA68463.1|  647|Drosophila melanogaster protein ( Dros...   153   2e-37
BT001634-1|AAN71389.1|  451|Drosophila melanogaster RE38701p pro...    33   0.71 
AY058715-1|AAL13944.1|  451|Drosophila melanogaster LD45348p pro...    33   0.71 
AE014297-327|AAF51973.2|  648|Drosophila melanogaster CG2179-PB,...    33   0.71 
AE014297-326|AAF51972.2|  783|Drosophila melanogaster CG2179-PA,...    33   0.71 
BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p pro...    30   3.8  
AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisom...    30   3.8  
AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-P...    30   3.8  
AJ621420-1|CAF18556.1|  357|Drosophila melanogaster alpha1,4-N-a...    30   5.0  
AF135118-1|AAD31714.1| 3367|Drosophila melanogaster laminin alph...    29   8.7  
AE014134-2477|AAF53381.2| 2731|Drosophila melanogaster CG15288-P...    29   8.7  
AE014134-2476|AAN10875.1| 3375|Drosophila melanogaster CG15288-P...    29   8.7  

>AY094852-1|AAM11205.1|  638|Drosophila melanogaster RE12569p
           protein.
          Length = 638

 Score =  167 bits (407), Expect = 1e-41
 Identities = 86/127 (67%), Positives = 94/127 (74%), Gaps = 6/127 (4%)
 Frame = +3

Query: 255 VLEILRQ-DEQFVRCLHAVG---SG--GTPGWPCDPKNTIILHKPAENEIVXXXXXXXXX 416
           VL  L+  D QFV+CLH+VG   SG    P WPCDP+ TI+LHKPAENEIV         
Sbjct: 197 VLNYLQSGDGQFVKCLHSVGTPKSGVQAMPSWPCDPERTIVLHKPAENEIVSYGSGYGGN 256

Query: 417 XXXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTP 596
               KKC ALR+GS IA+REGWLAEHMLI+GITNPQGKK YIAAAFPSACGKTNLAMMTP
Sbjct: 257 SLLGKKCLALRIGSTIAKREGWLAEHMLILGITNPQGKKIYIAAAFPSACGKTNLAMMTP 316

Query: 597 NTGPGTK 617
            T PG K
Sbjct: 317 -TLPGYK 322



 Score = 83.0 bits (196), Expect = 5e-16
 Identities = 37/42 (88%), Positives = 40/42 (95%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG 249
           GRTMYVIPFSMGPVGSPLSKIG+EITDSPYVV SM++MTR G
Sbjct: 153 GRTMYVIPFSMGPVGSPLSKIGIEITDSPYVVESMKIMTRAG 194



 Score = 41.1 bits (92), Expect = 0.002
 Identities = 21/36 (58%), Positives = 24/36 (66%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PGYKV CVGDDIA MKF  +    R  +  +NGFFG
Sbjct: 319 PGYKVECVGDDIAWMKFDNK-GVLRA-INPENGFFG 352


>AE013599-2714|AAF57677.1|  638|Drosophila melanogaster CG10924-PA
           protein.
          Length = 638

 Score =  167 bits (407), Expect = 1e-41
 Identities = 86/127 (67%), Positives = 94/127 (74%), Gaps = 6/127 (4%)
 Frame = +3

Query: 255 VLEILRQ-DEQFVRCLHAVG---SG--GTPGWPCDPKNTIILHKPAENEIVXXXXXXXXX 416
           VL  L+  D QFV+CLH+VG   SG    P WPCDP+ TI+LHKPAENEIV         
Sbjct: 197 VLNYLQSGDGQFVKCLHSVGTPKSGVQAMPSWPCDPERTIVLHKPAENEIVSYGSGYGGN 256

Query: 417 XXXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTP 596
               KKC ALR+GS IA+REGWLAEHMLI+GITNPQGKK YIAAAFPSACGKTNLAMMTP
Sbjct: 257 SLLGKKCLALRIGSTIAKREGWLAEHMLILGITNPQGKKIYIAAAFPSACGKTNLAMMTP 316

Query: 597 NTGPGTK 617
            T PG K
Sbjct: 317 -TLPGYK 322



 Score = 83.0 bits (196), Expect = 5e-16
 Identities = 37/42 (88%), Positives = 40/42 (95%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIG 249
           GRTMYVIPFSMGPVGSPLSKIG+EITDSPYVV SM++MTR G
Sbjct: 153 GRTMYVIPFSMGPVGSPLSKIGIEITDSPYVVESMKIMTRAG 194



 Score = 41.1 bits (92), Expect = 0.002
 Identities = 21/36 (58%), Positives = 24/36 (66%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PGYKV CVGDDIA MKF  +    R  +  +NGFFG
Sbjct: 319 PGYKVECVGDDIAWMKFDNK-GVLRA-INPENGFFG 352


>BT003447-1|AAO39450.1|  647|Drosophila melanogaster RH57538p
           protein.
          Length = 647

 Score =  155 bits (375), Expect = 1e-37
 Identities = 73/120 (60%), Positives = 88/120 (73%), Gaps = 5/120 (4%)
 Frame = +3

Query: 255 VLEILRQDEQFVRCLHAVGSGGT-----PGWPCDPKNTIILHKPAENEIVXXXXXXXXXX 419
           VL  L + E+FVR LH+VG+        P WPCDP+ TIILHKPAEN IV          
Sbjct: 206 VLRQLAKKEEFVRALHSVGAPANGQVEQPSWPCDPERTIILHKPAENLIVSYGSGYGGNS 265

Query: 420 XXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTPN 599
              KKCFALR+GS IA++EGWLAEHMLI+GIT+P+G+K+YI AAFPSACGKTNLAM+ P+
Sbjct: 266 LLGKKCFALRIGSTIAKQEGWLAEHMLILGITDPKGEKKYITAAFPSACGKTNLAMLNPS 325



 Score = 82.2 bits (194), Expect = 9e-16
 Identities = 36/43 (83%), Positives = 41/43 (95%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIGA 252
           GRTMYV+PFSMGPVGSPLSKIG+E+TDS YVV SMR+MTR+GA
Sbjct: 162 GRTMYVVPFSMGPVGSPLSKIGIELTDSAYVVASMRIMTRMGA 204



 Score = 35.9 bits (79), Expect = 0.076
 Identities = 26/58 (44%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
 Frame = +2

Query: 611 YKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFGSCXQVXSXGNXXXKPIG-NRXFKN 781
           YKV CVGDDIA MKF  +    R  +  +NGFFG    V    +    PI  N  FKN
Sbjct: 329 YKVECVGDDIAWMKFDSQ-GVLRA-INPENGFFG----VAPGTSMETNPIAMNTVFKN 380


>AE013599-2716|AAM68462.1|  500|Drosophila melanogaster CG17725-PB,
           isoform B protein.
          Length = 500

 Score =  155 bits (375), Expect = 1e-37
 Identities = 73/120 (60%), Positives = 88/120 (73%), Gaps = 5/120 (4%)
 Frame = +3

Query: 255 VLEILRQDEQFVRCLHAVGSGGT-----PGWPCDPKNTIILHKPAENEIVXXXXXXXXXX 419
           VL  L + E+FVR LH+VG+        P WPCDP+ TIILHKPAEN IV          
Sbjct: 59  VLRQLAKKEEFVRALHSVGAPANGQVEQPSWPCDPERTIILHKPAENLIVSYGSGYGGNS 118

Query: 420 XXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTPN 599
              KKCFALR+GS IA++EGWLAEHMLI+GIT+P+G+K+YI AAFPSACGKTNLAM+ P+
Sbjct: 119 LLGKKCFALRIGSTIAKQEGWLAEHMLILGITDPKGEKKYITAAFPSACGKTNLAMLNPS 178



 Score = 82.2 bits (194), Expect = 9e-16
 Identities = 36/43 (83%), Positives = 41/43 (95%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIGA 252
           GRTMYV+PFSMGPVGSPLSKIG+E+TDS YVV SMR+MTR+GA
Sbjct: 15  GRTMYVVPFSMGPVGSPLSKIGIELTDSAYVVASMRIMTRMGA 57



 Score = 35.9 bits (79), Expect = 0.076
 Identities = 26/58 (44%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
 Frame = +2

Query: 611 YKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFGSCXQVXSXGNXXXKPIG-NRXFKN 781
           YKV CVGDDIA MKF  +    R  +  +NGFFG    V    +    PI  N  FKN
Sbjct: 182 YKVECVGDDIAWMKFDSQ-GVLRA-INPENGFFG----VAPGTSMETNPIAMNTVFKN 233


>AE013599-2715|AAF57676.1|  647|Drosophila melanogaster CG17725-PA,
           isoform A protein.
          Length = 647

 Score =  155 bits (375), Expect = 1e-37
 Identities = 73/120 (60%), Positives = 88/120 (73%), Gaps = 5/120 (4%)
 Frame = +3

Query: 255 VLEILRQDEQFVRCLHAVGSGGT-----PGWPCDPKNTIILHKPAENEIVXXXXXXXXXX 419
           VL  L + E+FVR LH+VG+        P WPCDP+ TIILHKPAEN IV          
Sbjct: 206 VLRQLAKKEEFVRALHSVGAPANGQVEQPSWPCDPERTIILHKPAENLIVSYGSGYGGNS 265

Query: 420 XXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTPN 599
              KKCFALR+GS IA++EGWLAEHMLI+GIT+P+G+K+YI AAFPSACGKTNLAM+ P+
Sbjct: 266 LLGKKCFALRIGSTIAKQEGWLAEHMLILGITDPKGEKKYITAAFPSACGKTNLAMLNPS 325



 Score = 82.2 bits (194), Expect = 9e-16
 Identities = 36/43 (83%), Positives = 41/43 (95%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIGA 252
           GRTMYV+PFSMGPVGSPLSKIG+E+TDS YVV SMR+MTR+GA
Sbjct: 162 GRTMYVVPFSMGPVGSPLSKIGIELTDSAYVVASMRIMTRMGA 204



 Score = 35.9 bits (79), Expect = 0.076
 Identities = 26/58 (44%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
 Frame = +2

Query: 611 YKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFGSCXQVXSXGNXXXKPIG-NRXFKN 781
           YKV CVGDDIA MKF  +    R  +  +NGFFG    V    +    PI  N  FKN
Sbjct: 329 YKVECVGDDIAWMKFDSQ-GVLRA-INPENGFFG----VAPGTSMETNPIAMNTVFKN 380


>Y00402-1|CAA68463.1|  647|Drosophila melanogaster protein (
           Drosophila melanogastermRNA for phosphoenolpyruvate
           carboxykinase  (GTP) (PEPCK,EC 4.1.1.32).  ).
          Length = 647

 Score =  153 bits (372), Expect = 2e-37
 Identities = 73/120 (60%), Positives = 87/120 (72%), Gaps = 5/120 (4%)
 Frame = +3

Query: 255 VLEILRQDEQFVRCLHAVGSGGT-----PGWPCDPKNTIILHKPAENEIVXXXXXXXXXX 419
           VL  L + E+FVR LH+VG+        P WPCDP+ TIILHKPAEN IV          
Sbjct: 206 VLRQLAKKEEFVRALHSVGAPANGQVEQPSWPCDPERTIILHKPAENLIVSYGSGYGGNS 265

Query: 420 XXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMTPN 599
              KKCFALR+GS IA++EGWLAEHMLI+GIT+P+G K+YI AAFPSACGKTNLAM+ P+
Sbjct: 266 LLGKKCFALRIGSTIAKQEGWLAEHMLILGITDPKGVKKYITAAFPSACGKTNLAMLNPS 325



 Score = 82.2 bits (194), Expect = 9e-16
 Identities = 36/43 (83%), Positives = 41/43 (95%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIGA 252
           GRTMYV+PFSMGPVGSPLSKIG+E+TDS YVV SMR+MTR+GA
Sbjct: 162 GRTMYVVPFSMGPVGSPLSKIGIELTDSAYVVASMRIMTRMGA 204



 Score = 35.9 bits (79), Expect = 0.076
 Identities = 26/58 (44%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
 Frame = +2

Query: 611 YKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFGSCXQVXSXGNXXXKPIG-NRXFKN 781
           YKV CVGDDIA MKF  +    R  +  +NGFFG    V    +    PI  N  FKN
Sbjct: 329 YKVECVGDDIAWMKFDSQ-GVLRA-INPENGFFG----VAPGTSMETNPIAMNTVFKN 380


>BT001634-1|AAN71389.1|  451|Drosophila melanogaster RE38701p
           protein.
          Length = 451

 Score = 32.7 bits (71), Expect = 0.71
 Identities = 30/90 (33%), Positives = 41/90 (45%), Gaps = 3/90 (3%)
 Frame = -2

Query: 411 RRIHCRSLRSRSQPACGV---*WCS*GRRANPECHRSRLREDNERTARLDVEFLELRSNS 241
           RRI CRS RS+S+         + S  RR++    RSR +  ++R  R        RS+S
Sbjct: 274 RRIVCRSRRSKSRSRSHYRKSSYSSRSRRSHSRSSRSRSKTPSQRKNRKLASTRRSRSSS 333

Query: 240 SHDSHRINHVRRIRDFYADLRERRSHRTHR 151
              S   +H RR      D R R  HR+ R
Sbjct: 334 YSRSRSRSHSRRQSSSRRDHRGR--HRSSR 361


>AY058715-1|AAL13944.1|  451|Drosophila melanogaster LD45348p
           protein.
          Length = 451

 Score = 32.7 bits (71), Expect = 0.71
 Identities = 30/90 (33%), Positives = 41/90 (45%), Gaps = 3/90 (3%)
 Frame = -2

Query: 411 RRIHCRSLRSRSQPACGV---*WCS*GRRANPECHRSRLREDNERTARLDVEFLELRSNS 241
           RRI CRS RS+S+         + S  RR++    RSR +  ++R  R        RS+S
Sbjct: 274 RRIVCRSRRSKSRSRSHYRKSSYSSRSRRSHSRSSRSRSKTPSQRKNRKLASTRRSRSSS 333

Query: 240 SHDSHRINHVRRIRDFYADLRERRSHRTHR 151
              S   +H RR      D R R  HR+ R
Sbjct: 334 YSRSRSRSHSRRQSSSRRDHRGR--HRSSR 361


>AE014297-327|AAF51973.2|  648|Drosophila melanogaster CG2179-PB,
           isoform B protein.
          Length = 648

 Score = 32.7 bits (71), Expect = 0.71
 Identities = 30/90 (33%), Positives = 41/90 (45%), Gaps = 3/90 (3%)
 Frame = -2

Query: 411 RRIHCRSLRSRSQPACGV---*WCS*GRRANPECHRSRLREDNERTARLDVEFLELRSNS 241
           RRI CRS RS+S+         + S  RR++    RSR +  ++R  R        RS+S
Sbjct: 471 RRIVCRSRRSKSRSRSHYRKSSYSSRSRRSHSRSSRSRSKTPSQRKNRKLASTRRSRSSS 530

Query: 240 SHDSHRINHVRRIRDFYADLRERRSHRTHR 151
              S   +H RR      D R R  HR+ R
Sbjct: 531 YSRSRSRSHSRRQSSSRRDHRGR--HRSSR 558


>AE014297-326|AAF51972.2|  783|Drosophila melanogaster CG2179-PA,
           isoform A protein.
          Length = 783

 Score = 32.7 bits (71), Expect = 0.71
 Identities = 30/90 (33%), Positives = 41/90 (45%), Gaps = 3/90 (3%)
 Frame = -2

Query: 411 RRIHCRSLRSRSQPACGV---*WCS*GRRANPECHRSRLREDNERTARLDVEFLELRSNS 241
           RRI CRS RS+S+         + S  RR++    RSR +  ++R  R        RS+S
Sbjct: 606 RRIVCRSRRSKSRSRSHYRKSSYSSRSRRSHSRSSRSRSKTPSQRKNRKLASTRRSRSSS 665

Query: 240 SHDSHRINHVRRIRDFYADLRERRSHRTHR 151
              S   +H RR      D R R  HR+ R
Sbjct: 666 YSRSRSRSHSRRQSSSRRDHRGR--HRSSR 693


>BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p
           protein.
          Length = 1250

 Score = 30.3 bits (65), Expect = 3.8
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +2

Query: 629 GDDIALMKFRXRTAYFRGHLXRKNGFFGSC 718
           GD   ++KFR  T Y+RG     +G++ +C
Sbjct: 711 GDGYRMLKFRLSTPYYRGVFGTPSGWYKTC 740


>AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA
           topoisomerase III alpha protein.
          Length = 1250

 Score = 30.3 bits (65), Expect = 3.8
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +2

Query: 629 GDDIALMKFRXRTAYFRGHLXRKNGFFGSC 718
           GD   ++KFR  T Y+RG     +G++ +C
Sbjct: 711 GDGYRMLKFRLSTPYYRGVFGTPSGWYKTC 740


>AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-PA
           protein.
          Length = 1250

 Score = 30.3 bits (65), Expect = 3.8
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +2

Query: 629 GDDIALMKFRXRTAYFRGHLXRKNGFFGSC 718
           GD   ++KFR  T Y+RG     +G++ +C
Sbjct: 711 GDGYRMLKFRLSTPYYRGVFGTPSGWYKTC 740


>AJ621420-1|CAF18556.1|  357|Drosophila melanogaster
           alpha1,4-N-acetylgalactosaminyltransferaseprotein.
          Length = 357

 Score = 29.9 bits (64), Expect = 5.0
 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 9/72 (12%)
 Frame = +3

Query: 108 WNGMRWTHN---VRDTILDGSCGISSL----EDRRRNHGFAL--RGLFYASHD*NWSEVL 260
           +NG+ W +N   V   +    CG   +    ED +R  GF +  RG FYA     W +  
Sbjct: 241 FNGVDWGNNGPGVITRVAQKICGTKDIALMREDPKRCMGFKVFGRGAFYAVPWKQWRDFF 300

Query: 261 EILRQDEQFVRC 296
           E  + +E   RC
Sbjct: 301 EPEKLEETIARC 312


>AF135118-1|AAD31714.1| 3367|Drosophila melanogaster laminin alpha1,2
            protein.
          Length = 3367

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 14/32 (43%), Positives = 16/32 (50%)
 Frame = -2

Query: 471  DERSLIPDVERSTSCPTNYCRRIHCRSLRSRS 376
            DE  L+PD E   S  T  C   HC S+ S S
Sbjct: 1128 DEWELVPDTEDPNSESTVACEECHCSSVGSLS 1159


>AE014134-2477|AAF53381.2| 2731|Drosophila melanogaster CG15288-PA,
            isoform A protein.
          Length = 2731

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 14/32 (43%), Positives = 16/32 (50%)
 Frame = -2

Query: 471  DERSLIPDVERSTSCPTNYCRRIHCRSLRSRS 376
            DE  L+PD E   S  T  C   HC S+ S S
Sbjct: 1128 DEWELVPDTEDPNSESTVACEECHCSSVGSLS 1159


>AE014134-2476|AAN10875.1| 3375|Drosophila melanogaster CG15288-PB,
            isoform B protein.
          Length = 3375

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 14/32 (43%), Positives = 16/32 (50%)
 Frame = -2

Query: 471  DERSLIPDVERSTSCPTNYCRRIHCRSLRSRS 376
            DE  L+PD E   S  T  C   HC S+ S S
Sbjct: 1128 DEWELVPDTEDPNSESTVACEECHCSSVGSLS 1159


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 38,184,169
Number of Sequences: 53049
Number of extensions: 784706
Number of successful extensions: 2011
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 1890
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2001
length of database: 24,988,368
effective HSP length: 85
effective length of database: 20,479,203
effective search space used: 4403028645
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -