SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30158.Seq
         (813 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT014643-1|AAT27267.1|  268|Drosophila melanogaster RE55992p pro...    80   4e-15
AF181658-1|AAD55443.1|  244|Drosophila melanogaster GM04779p pro...    80   4e-15
AE014296-1506|AAF50377.2|  244|Drosophila melanogaster CG33162-P...    80   4e-15
BT009931-1|AAQ22400.1| 1351|Drosophila melanogaster SD10043p pro...    29   10.0 
AY061306-1|AAL28854.1|  743|Drosophila melanogaster LD22256p pro...    29   10.0 
AJ635208-1|CAG25590.1| 1153|Drosophila melanogaster CAP-G protei...    29   10.0 
AE013599-1638|AAS64861.1|  743|Drosophila melanogaster CG17054-P...    29   10.0 
AE013599-1637|AAS64860.1| 1346|Drosophila melanogaster CG17054-P...    29   10.0 
AE013599-1636|AAS64859.1| 1155|Drosophila melanogaster CG17054-P...    29   10.0 
AE013599-1635|AAS64858.1| 1155|Drosophila melanogaster CG17054-P...    29   10.0 
AE013599-1634|AAF58425.4| 1153|Drosophila melanogaster CG17054-P...    29   10.0 

>BT014643-1|AAT27267.1|  268|Drosophila melanogaster RE55992p
           protein.
          Length = 268

 Score = 79.8 bits (188), Expect = 4e-15
 Identities = 48/119 (40%), Positives = 68/119 (57%), Gaps = 1/119 (0%)
 Frame = +3

Query: 267 FVXLAYSQYXQTFTSMKENIEXXITSNKTLKIVDLPGXERLRNKFFXQHXSSAKGIVFVI 446
           F+ L + ++  TFTS+KEN+    T + + ++VD+PG  R+R+K    +   AKGIVFV+
Sbjct: 89  FMQLIHGKFPATFTSIKENVGDYRTGSASARLVDIPGHYRVRDKCLELYKHRAKGIVFVV 148

Query: 447 XSINIXEEIXDVAXYLYTILWIRSFXGTQ-LPX*YCGNKQXQP*PKXAQLSKGYSEKEL 620
            S+   ++I DVA +LYTIL   S   TQ        NKQ Q   K AQ+ K   E EL
Sbjct: 149 DSVTAHKDIRDVADFLYTIL---SDSATQPCSVLVLCNKQDQTTAKSAQVIKSLLESEL 204


>AF181658-1|AAD55443.1|  244|Drosophila melanogaster GM04779p
           protein.
          Length = 244

 Score = 79.8 bits (188), Expect = 4e-15
 Identities = 48/119 (40%), Positives = 68/119 (57%), Gaps = 1/119 (0%)
 Frame = +3

Query: 267 FVXLAYSQYXQTFTSMKENIEXXITSNKTLKIVDLPGXERLRNKFFXQHXSSAKGIVFVI 446
           F+ L + ++  TFTS+KEN+    T + + ++VD+PG  R+R+K    +   AKGIVFV+
Sbjct: 65  FMQLIHGKFPATFTSIKENVGDYRTGSASARLVDIPGHYRVRDKCLELYKHRAKGIVFVV 124

Query: 447 XSINIXEEIXDVAXYLYTILWIRSFXGTQ-LPX*YCGNKQXQP*PKXAQLSKGYSEKEL 620
            S+   ++I DVA +LYTIL   S   TQ        NKQ Q   K AQ+ K   E EL
Sbjct: 125 DSVTAHKDIRDVADFLYTIL---SDSATQPCSVLVLCNKQDQTTAKSAQVIKSLLESEL 180


>AE014296-1506|AAF50377.2|  244|Drosophila melanogaster CG33162-PA
           protein.
          Length = 244

 Score = 79.8 bits (188), Expect = 4e-15
 Identities = 48/119 (40%), Positives = 68/119 (57%), Gaps = 1/119 (0%)
 Frame = +3

Query: 267 FVXLAYSQYXQTFTSMKENIEXXITSNKTLKIVDLPGXERLRNKFFXQHXSSAKGIVFVI 446
           F+ L + ++  TFTS+KEN+    T + + ++VD+PG  R+R+K    +   AKGIVFV+
Sbjct: 65  FMQLIHGKFPATFTSIKENVGDYRTGSASARLVDIPGHYRVRDKCLELYKHRAKGIVFVV 124

Query: 447 XSINIXEEIXDVAXYLYTILWIRSFXGTQ-LPX*YCGNKQXQP*PKXAQLSKGYSEKEL 620
            S+   ++I DVA +LYTIL   S   TQ        NKQ Q   K AQ+ K   E EL
Sbjct: 125 DSVTAHKDIRDVADFLYTIL---SDSATQPCSVLVLCNKQDQTTAKSAQVIKSLLESEL 180


>BT009931-1|AAQ22400.1| 1351|Drosophila melanogaster SD10043p
           protein.
          Length = 1351

 Score = 28.7 bits (61), Expect = 10.0
 Identities = 18/64 (28%), Positives = 30/64 (46%)
 Frame = -2

Query: 506 QDXV*VXXYISDFFXYIDRXNHKHNXLXTTLVLXKEFISQSLXSRQINYFQXFIRSYXXF 327
           Q+ V    YIS    Y+    H H    +   L K+FI + L   +++ F+  I+    F
Sbjct: 598 QERVLKGLYIS---YYMTASPHVHKLTPSLCQLYKDFICRYLPCAEVDIFEWSIKCGTTF 654

Query: 326 NIFF 315
           +IF+
Sbjct: 655 SIFY 658


>AY061306-1|AAL28854.1|  743|Drosophila melanogaster LD22256p
           protein.
          Length = 743

 Score = 28.7 bits (61), Expect = 10.0
 Identities = 18/64 (28%), Positives = 30/64 (46%)
 Frame = -2

Query: 506 QDXV*VXXYISDFFXYIDRXNHKHNXLXTTLVLXKEFISQSLXSRQINYFQXFIRSYXXF 327
           Q+ V    YIS    Y+    H H    +   L K+FI + L   +++ F+  I+    F
Sbjct: 188 QERVLKGLYIS---YYMTASPHVHKLTPSLCQLYKDFICRYLPCAEVDIFEWSIKCGTTF 244

Query: 326 NIFF 315
           +IF+
Sbjct: 245 SIFY 248


>AJ635208-1|CAG25590.1| 1153|Drosophila melanogaster CAP-G protein
           protein.
          Length = 1153

 Score = 28.7 bits (61), Expect = 10.0
 Identities = 18/64 (28%), Positives = 30/64 (46%)
 Frame = -2

Query: 506 QDXV*VXXYISDFFXYIDRXNHKHNXLXTTLVLXKEFISQSLXSRQINYFQXFIRSYXXF 327
           Q+ V    YIS    Y+    H H    +   L K+FI + L   +++ F+  I+    F
Sbjct: 598 QERVLKGLYIS---YYMTASPHVHKLTPSLCQLYKDFICRYLPCAEVDIFEWSIKCGTTF 654

Query: 326 NIFF 315
           +IF+
Sbjct: 655 SIFY 658


>AE013599-1638|AAS64861.1|  743|Drosophila melanogaster CG17054-PE,
           isoform E protein.
          Length = 743

 Score = 28.7 bits (61), Expect = 10.0
 Identities = 18/64 (28%), Positives = 30/64 (46%)
 Frame = -2

Query: 506 QDXV*VXXYISDFFXYIDRXNHKHNXLXTTLVLXKEFISQSLXSRQINYFQXFIRSYXXF 327
           Q+ V    YIS    Y+    H H    +   L K+FI + L   +++ F+  I+    F
Sbjct: 188 QERVLKGLYIS---YYMTASPHVHKLTPSLCQLYKDFICRYLPCAEVDIFEWSIKCGTTF 244

Query: 326 NIFF 315
           +IF+
Sbjct: 245 SIFY 248


>AE013599-1637|AAS64860.1| 1346|Drosophila melanogaster CG17054-PB,
           isoform B protein.
          Length = 1346

 Score = 28.7 bits (61), Expect = 10.0
 Identities = 18/64 (28%), Positives = 30/64 (46%)
 Frame = -2

Query: 506 QDXV*VXXYISDFFXYIDRXNHKHNXLXTTLVLXKEFISQSLXSRQINYFQXFIRSYXXF 327
           Q+ V    YIS    Y+    H H    +   L K+FI + L   +++ F+  I+    F
Sbjct: 598 QERVLKGLYIS---YYMTASPHVHKLTPSLCQLYKDFICRYLPCAEVDIFEWSIKCGTTF 654

Query: 326 NIFF 315
           +IF+
Sbjct: 655 SIFY 658


>AE013599-1636|AAS64859.1| 1155|Drosophila melanogaster CG17054-PD,
           isoform D protein.
          Length = 1155

 Score = 28.7 bits (61), Expect = 10.0
 Identities = 18/64 (28%), Positives = 30/64 (46%)
 Frame = -2

Query: 506 QDXV*VXXYISDFFXYIDRXNHKHNXLXTTLVLXKEFISQSLXSRQINYFQXFIRSYXXF 327
           Q+ V    YIS    Y+    H H    +   L K+FI + L   +++ F+  I+    F
Sbjct: 598 QERVLKGLYIS---YYMTASPHVHKLTPSLCQLYKDFICRYLPCAEVDIFEWSIKCGTTF 654

Query: 326 NIFF 315
           +IF+
Sbjct: 655 SIFY 658


>AE013599-1635|AAS64858.1| 1155|Drosophila melanogaster CG17054-PC,
           isoform C protein.
          Length = 1155

 Score = 28.7 bits (61), Expect = 10.0
 Identities = 18/64 (28%), Positives = 30/64 (46%)
 Frame = -2

Query: 506 QDXV*VXXYISDFFXYIDRXNHKHNXLXTTLVLXKEFISQSLXSRQINYFQXFIRSYXXF 327
           Q+ V    YIS    Y+    H H    +   L K+FI + L   +++ F+  I+    F
Sbjct: 598 QERVLKGLYIS---YYMTASPHVHKLTPSLCQLYKDFICRYLPCAEVDIFEWSIKCGTTF 654

Query: 326 NIFF 315
           +IF+
Sbjct: 655 SIFY 658


>AE013599-1634|AAF58425.4| 1153|Drosophila melanogaster CG17054-PA,
           isoform A protein.
          Length = 1153

 Score = 28.7 bits (61), Expect = 10.0
 Identities = 18/64 (28%), Positives = 30/64 (46%)
 Frame = -2

Query: 506 QDXV*VXXYISDFFXYIDRXNHKHNXLXTTLVLXKEFISQSLXSRQINYFQXFIRSYXXF 327
           Q+ V    YIS    Y+    H H    +   L K+FI + L   +++ F+  I+    F
Sbjct: 598 QERVLKGLYIS---YYMTASPHVHKLTPSLCQLYKDFICRYLPCAEVDIFEWSIKCGTTF 654

Query: 326 NIFF 315
           +IF+
Sbjct: 655 SIFY 658


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,752,297
Number of Sequences: 53049
Number of extensions: 523639
Number of successful extensions: 1041
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 994
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1040
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3818998872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -