SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30156.Seq
         (961 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X69120-1|CAA48872.1|  267|Drosophila melanogaster ribosoaml prot...   172   7e-43
U01335-1|AAA87053.1|  267|Drosophila melanogaster ribosomal prot...   172   7e-43
U01334-1|AAC34198.1|  267|Drosophila melanogaster ribosomal prot...   172   7e-43
AY094799-1|AAM11152.1|  267|Drosophila melanogaster LD24077p pro...   172   7e-43
AE014134-1713|AAF52822.1|  267|Drosophila melanogaster CG5920-PA...   172   7e-43
BT029103-1|ABJ17036.1|  823|Drosophila melanogaster IP14290p pro...    30   4.1  
AE014297-4030|AAF56644.2| 1958|Drosophila melanogaster CG5521-PA...    30   4.1  
AE014134-733|AAO41157.1|  579|Drosophila melanogaster CG33003-PA...    30   5.4  
AE014297-756|AAF54239.3| 1052|Drosophila melanogaster CG31462-PA...    29   7.2  

>X69120-1|CAA48872.1|  267|Drosophila melanogaster ribosoaml protein
           S2 protein.
          Length = 267

 Score =  172 bits (418), Expect = 7e-43
 Identities = 87/108 (80%), Positives = 90/108 (83%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKEFEIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGDN
Sbjct: 57  KIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 116

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGHIGLGVKCSKEVATAIRGAIILAKLSV+   +   GNKIGKPH  P
Sbjct: 117 NGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVP 164



 Score = 65.3 bits (152), Expect = 1e-10
 Identities = 50/150 (33%), Positives = 68/150 (45%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           KED KEWVPVTKLGRLVREGKI  LE IYL+    K    +   + SS +  +++ +   
Sbjct: 37  KEDSKEWVPVTKLGRLVREGKIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMP-- 94

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        I + V   +++        + L      PVRR Y 
Sbjct: 95  VQKQTRAGQRTRFKAFVAIGDNNGHIGLGV-KCSKEVATAIRGAIILAKLSVVPVRRGYW 153

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 154 GNKIGKPHTVPCKVTGKCG-SVSVRLIPAP 182


>U01335-1|AAA87053.1|  267|Drosophila melanogaster ribosomal protein
           S2 protein.
          Length = 267

 Score =  172 bits (418), Expect = 7e-43
 Identities = 87/108 (80%), Positives = 90/108 (83%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKEFEIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGDN
Sbjct: 57  KIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 116

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGHIGLGVKCSKEVATAIRGAIILAKLSV+   +   GNKIGKPH  P
Sbjct: 117 NGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVP 164



 Score = 65.3 bits (152), Expect = 1e-10
 Identities = 50/150 (33%), Positives = 68/150 (45%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           KED KEWVPVTKLGRLVREGKI  LE IYL+    K    +   + SS +  +++ +   
Sbjct: 37  KEDSKEWVPVTKLGRLVREGKIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMP-- 94

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        I + V   +++        + L      PVRR Y 
Sbjct: 95  VQKQTRAGQRTRFKAFVAIGDNNGHIGLGV-KCSKEVATAIRGAIILAKLSVVPVRRGYW 153

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 154 GNKIGKPHTVPCKVTGKCG-SVSVRLIPAP 182


>U01334-1|AAC34198.1|  267|Drosophila melanogaster ribosomal protein
           S2 protein.
          Length = 267

 Score =  172 bits (418), Expect = 7e-43
 Identities = 87/108 (80%), Positives = 90/108 (83%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKEFEIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGDN
Sbjct: 57  KIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 116

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGHIGLGVKCSKEVATAIRGAIILAKLSV+   +   GNKIGKPH  P
Sbjct: 117 NGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVP 164



 Score = 65.3 bits (152), Expect = 1e-10
 Identities = 50/150 (33%), Positives = 68/150 (45%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           KED KEWVPVTKLGRLVREGKI  LE IYL+    K    +   + SS +  +++ +   
Sbjct: 37  KEDSKEWVPVTKLGRLVREGKIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMP-- 94

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        I + V   +++        + L      PVRR Y 
Sbjct: 95  VQKQTRAGQRTRFKAFVAIGDNNGHIGLGV-KCSKEVATAIRGAIILAKLSVVPVRRGYW 153

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 154 GNKIGKPHTVPCKVTGKCG-SVSVRLIPAP 182


>AY094799-1|AAM11152.1|  267|Drosophila melanogaster LD24077p
           protein.
          Length = 267

 Score =  172 bits (418), Expect = 7e-43
 Identities = 87/108 (80%), Positives = 90/108 (83%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKEFEIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGDN
Sbjct: 57  KIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 116

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGHIGLGVKCSKEVATAIRGAIILAKLSV+   +   GNKIGKPH  P
Sbjct: 117 NGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVP 164



 Score = 65.3 bits (152), Expect = 1e-10
 Identities = 50/150 (33%), Positives = 68/150 (45%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           KED KEWVPVTKLGRLVREGKI  LE IYL+    K    +   + SS +  +++ +   
Sbjct: 37  KEDSKEWVPVTKLGRLVREGKIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMP-- 94

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        I + V   +++        + L      PVRR Y 
Sbjct: 95  VQKQTRAGQRTRFKAFVAIGDNNGHIGLGV-KCSKEVATAIRGAIILAKLSVVPVRRGYW 153

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 154 GNKIGKPHTVPCKVTGKCG-SVSVRLIPAP 182


>AE014134-1713|AAF52822.1|  267|Drosophila melanogaster CG5920-PA
           protein.
          Length = 267

 Score =  172 bits (418), Expect = 7e-43
 Identities = 87/108 (80%), Positives = 90/108 (83%)
 Frame = +1

Query: 220 KNRQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 399
           K +   E  L  LPIKEFEIIDFFLG SL DEVLKIMPVQKQTRAGQRTRFKAFVAIGDN
Sbjct: 57  KIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDN 116

Query: 400 NGHIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           NGHIGLGVKCSKEVATAIRGAIILAKLSV+   +   GNKIGKPH  P
Sbjct: 117 NGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVP 164



 Score = 65.3 bits (152), Expect = 1e-10
 Identities = 50/150 (33%), Positives = 68/150 (45%), Gaps = 3/150 (2%)
 Frame = +2

Query: 161 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSL---ISSSARP*MMRFLRSC 331
           KED KEWVPVTKLGRLVREGKI  LE IYL+    K    +   + SS +  +++ +   
Sbjct: 37  KEDSKEWVPVTKLGRLVREGKIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMP-- 94

Query: 332 LYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYG 511
           + +             +        I + V   +++        + L      PVRR Y 
Sbjct: 95  VQKQTRAGQRTRFKAFVAIGDNNGHIGLGV-KCSKEVATAIRGAIILAKLSVVPVRRGYW 153

Query: 512 VTR*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
             +     TVPCKV G+       RLIPAP
Sbjct: 154 GNKIGKPHTVPCKVTGKCG-SVSVRLIPAP 182


>BT029103-1|ABJ17036.1|  823|Drosophila melanogaster IP14290p
           protein.
          Length = 823

 Score = 30.3 bits (65), Expect = 4.1
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = -3

Query: 167 LPCRAHDHGRDHDRVHEDRHGLYLHRVIRIRREN-RHVHRLEQRPPLLN 24
           L C  H    D  R+H  + GL +  V+ + REN   VH + ++  LLN
Sbjct: 359 LDCTLHIEDVDQVRLHGYQQGLIVRDVLYVNRENINFVHEVYRQAFLLN 407


>AE014297-4030|AAF56644.2| 1958|Drosophila melanogaster CG5521-PA
           protein.
          Length = 1958

 Score = 30.3 bits (65), Expect = 4.1
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = -3

Query: 167 LPCRAHDHGRDHDRVHEDRHGLYLHRVIRIRREN-RHVHRLEQRPPLLN 24
           L C  H    D  R+H  + GL +  V+ + REN   VH + ++  LLN
Sbjct: 325 LDCTLHIEDVDQVRLHGYQQGLIVRDVLYVNRENINFVHEVYRQAFLLN 373


>AE014134-733|AAO41157.1|  579|Drosophila melanogaster CG33003-PA
           protein.
          Length = 579

 Score = 29.9 bits (64), Expect = 5.4
 Identities = 10/18 (55%), Positives = 11/18 (61%)
 Frame = -3

Query: 152 HDHGRDHDRVHEDRHGLY 99
           HDH  DHD VH+  H  Y
Sbjct: 413 HDHAPDHDHVHDHHHDHY 430


>AE014297-756|AAF54239.3| 1052|Drosophila melanogaster CG31462-PA
           protein.
          Length = 1052

 Score = 29.5 bits (63), Expect = 7.2
 Identities = 15/45 (33%), Positives = 23/45 (51%)
 Frame = +1

Query: 154 ARQGRPERVGSCHQTRPSCSRRKNRQTREHLLVFLPIKEFEIIDF 288
           AR  RP+R G   +     +R +N  +  H L  +P++ FE  DF
Sbjct: 180 ARSSRPQRQGRGLRRLFESNRSQNPPSEHHYLHGVPVRRFERQDF 224


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 37,590,191
Number of Sequences: 53049
Number of extensions: 766469
Number of successful extensions: 4041
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1933
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2987
length of database: 24,988,368
effective HSP length: 85
effective length of database: 20,479,203
effective search space used: 4792133502
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -