SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30155.Seq
         (883 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY052127-1|AAK93551.1| 1062|Drosophila melanogaster SD07741p pro...    32   0.91 
AY058638-1|AAL13867.1|  492|Drosophila melanogaster LD33732p pro...    31   2.8  
AE014296-326|AAF47543.2| 1062|Drosophila melanogaster CG7971-PA,...    31   2.8  
AE014296-325|AAZ66051.1|  849|Drosophila melanogaster CG7971-PD,...    31   2.8  
AE014296-324|AAF47542.2| 1107|Drosophila melanogaster CG7971-PC,...    31   2.8  
AY113409-1|AAM29414.1|  525|Drosophila melanogaster RE13562p pro...    29   6.4  
AY060938-1|AAL28486.1|  277|Drosophila melanogaster GM08053p pro...    29   6.4  
AE014298-1174|AAF46370.2|  525|Drosophila melanogaster CG12125-P...    29   6.4  
AE014296-2194|AAN11859.1| 1257|Drosophila melanogaster CG11006-P...    29   6.4  
AE014296-2193|AAN11858.1| 1294|Drosophila melanogaster CG11006-P...    29   6.4  
AE014296-2192|AAN11860.2| 1272|Drosophila melanogaster CG11006-P...    29   6.4  

>AY052127-1|AAK93551.1| 1062|Drosophila melanogaster SD07741p
           protein.
          Length = 1062

 Score = 32.3 bits (70), Expect = 0.91
 Identities = 18/44 (40%), Positives = 25/44 (56%)
 Frame = +1

Query: 223 NRPKSAKSLINKRIDRDRVECCSSLEQESTIKERGLQRQRAKNR 354
           +RPK  K  ++KR  RDR    S   Q S  ++R  +RQR+K R
Sbjct: 509 HRPKDEKQTLDKR--RDRSTDRSKENQRSNERQRSKERQRSKER 550


>AY058638-1|AAL13867.1|  492|Drosophila melanogaster LD33732p
           protein.
          Length = 492

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 17/44 (38%), Positives = 25/44 (56%)
 Frame = +1

Query: 223 NRPKSAKSLINKRIDRDRVECCSSLEQESTIKERGLQRQRAKNR 354
           +RPK  +  ++KR  RDR    S   Q S  ++R  +RQR+K R
Sbjct: 152 HRPKDEQQSVDKR--RDRSTDRSKENQRSNERQRSKERQRSKER 193


>AE014296-326|AAF47543.2| 1062|Drosophila melanogaster CG7971-PA,
           isoform A protein.
          Length = 1062

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 17/44 (38%), Positives = 25/44 (56%)
 Frame = +1

Query: 223 NRPKSAKSLINKRIDRDRVECCSSLEQESTIKERGLQRQRAKNR 354
           +RPK  +  ++KR  RDR    S   Q S  ++R  +RQR+K R
Sbjct: 509 HRPKDEQQSVDKR--RDRSTDRSKENQRSNERQRSKERQRSKER 550


>AE014296-325|AAZ66051.1|  849|Drosophila melanogaster CG7971-PD,
           isoform D protein.
          Length = 849

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 17/44 (38%), Positives = 25/44 (56%)
 Frame = +1

Query: 223 NRPKSAKSLINKRIDRDRVECCSSLEQESTIKERGLQRQRAKNR 354
           +RPK  +  ++KR  RDR    S   Q S  ++R  +RQR+K R
Sbjct: 509 HRPKDEQQSVDKR--RDRSTDRSKENQRSNERQRSKERQRSKER 550


>AE014296-324|AAF47542.2| 1107|Drosophila melanogaster CG7971-PC,
           isoform C protein.
          Length = 1107

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 17/44 (38%), Positives = 25/44 (56%)
 Frame = +1

Query: 223 NRPKSAKSLINKRIDRDRVECCSSLEQESTIKERGLQRQRAKNR 354
           +RPK  +  ++KR  RDR    S   Q S  ++R  +RQR+K R
Sbjct: 509 HRPKDEQQSVDKR--RDRSTDRSKENQRSNERQRSKERQRSKER 550


>AY113409-1|AAM29414.1|  525|Drosophila melanogaster RE13562p
           protein.
          Length = 525

 Score = 29.5 bits (63), Expect = 6.4
 Identities = 11/19 (57%), Positives = 13/19 (68%)
 Frame = +2

Query: 554 RARKPPHPPRLMRRYRARQ 610
           R RKPP PPR  R+Y  R+
Sbjct: 46  RRRKPPRPPRRARKYTGRR 64


>AY060938-1|AAL28486.1|  277|Drosophila melanogaster GM08053p
           protein.
          Length = 277

 Score = 29.5 bits (63), Expect = 6.4
 Identities = 11/19 (57%), Positives = 13/19 (68%)
 Frame = +2

Query: 554 RARKPPHPPRLMRRYRARQ 610
           R RKPP PPR  R+Y  R+
Sbjct: 46  RRRKPPRPPRRARKYTGRR 64


>AE014298-1174|AAF46370.2|  525|Drosophila melanogaster CG12125-PA
           protein.
          Length = 525

 Score = 29.5 bits (63), Expect = 6.4
 Identities = 11/19 (57%), Positives = 13/19 (68%)
 Frame = +2

Query: 554 RARKPPHPPRLMRRYRARQ 610
           R RKPP PPR  R+Y  R+
Sbjct: 46  RRRKPPRPPRRARKYTGRR 64


>AE014296-2194|AAN11859.1| 1257|Drosophila melanogaster CG11006-PB,
           isoform B protein.
          Length = 1257

 Score = 29.5 bits (63), Expect = 6.4
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = +2

Query: 23  TGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 136
           TG   A  +L++  H PL   GVI K   P  LP+S A
Sbjct: 26  TGSLSASASLVSHSHPPLQLRGVINKYSLPSHLPSSAA 63


>AE014296-2193|AAN11858.1| 1294|Drosophila melanogaster CG11006-PC,
           isoform C protein.
          Length = 1294

 Score = 29.5 bits (63), Expect = 6.4
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = +2

Query: 23  TGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 136
           TG   A  +L++  H PL   GVI K   P  LP+S A
Sbjct: 63  TGSLSASASLVSHSHPPLQLRGVINKYSLPSHLPSSAA 100


>AE014296-2192|AAN11860.2| 1272|Drosophila melanogaster CG11006-PD,
           isoform D protein.
          Length = 1272

 Score = 29.5 bits (63), Expect = 6.4
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = +2

Query: 23  TGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 136
           TG   A  +L++  H PL   GVI K   P  LP+S A
Sbjct: 41  TGSLSASASLVSHSHPPLQLRGVINKYSLPSHLPSSAA 78


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 38,168,045
Number of Sequences: 53049
Number of extensions: 792244
Number of successful extensions: 1766
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1705
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1766
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4291240668
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -