SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30153.Seq
         (864 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT016117-1|AAV37002.1|  326|Drosophila melanogaster LD06441p pro...   134   1e-31
AE014296-512|AAF47688.1|  326|Drosophila melanogaster CG2101-PA ...   134   1e-31
DQ539337-1|ABG02858.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539336-1|ABG02857.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539335-1|ABG02856.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539334-1|ABG02855.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539333-1|ABG02854.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539332-1|ABG02853.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539331-1|ABG02852.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539330-1|ABG02851.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539329-1|ABG02850.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539328-1|ABG02849.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539327-1|ABG02848.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539326-1|ABG02847.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539325-1|ABG02846.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539324-1|ABG02845.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539323-1|ABG02844.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539322-1|ABG02843.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539321-1|ABG02842.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539320-1|ABG02841.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539319-1|ABG02840.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539318-1|ABG02839.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539317-1|ABG02838.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539316-1|ABG02837.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539315-1|ABG02836.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539314-1|ABG02835.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539313-1|ABG02834.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539312-1|ABG02833.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539311-1|ABG02832.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
DQ539310-1|ABG02831.1|  469|Drosophila melanogaster CG5273 protein.    31   2.0  
BT010227-1|AAQ23545.1|  469|Drosophila melanogaster RE67565p pro...    31   2.0  
AL132792-3|CAB60032.1|  468|Drosophila melanogaster EG:BACR19J1....    31   2.0  
AE014298-103|AAN09031.1|  469|Drosophila melanogaster CG5273-PC,...    31   2.0  
AE014298-102|AAN09030.1|  469|Drosophila melanogaster CG5273-PB,...    31   2.0  
AE014298-101|AAF45545.1|  469|Drosophila melanogaster CG5273-PA,...    31   2.0  
AY058570-1|AAL13799.1|  553|Drosophila melanogaster LD26007p pro...    31   2.7  
AJ271814-1|CAB72133.1|  553|Drosophila melanogaster Meso18E prot...    31   2.7  
AE014298-2922|AAF49011.1|  553|Drosophila melanogaster CG14233-P...    31   2.7  
AY118462-1|AAM49831.1|  625|Drosophila melanogaster GM01690p pro...    29   6.2  
AE014297-1476|AAF54775.1|  588|Drosophila melanogaster CG4066-PA...    29   6.2  

>BT016117-1|AAV37002.1|  326|Drosophila melanogaster LD06441p
           protein.
          Length = 326

 Score =  134 bits (325), Expect = 1e-31
 Identities = 54/86 (62%), Positives = 68/86 (79%)
 Frame = +2

Query: 257 NQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVIKSQ 436
           +Q+W  VWPGP++FHP+SVPLP+RQG+  +G A P K ANAELMKIPNFLHLTPP I+ Q
Sbjct: 75  DQDWTAVWPGPRSFHPASVPLPLRQGFTERGAAAPSKFANAELMKIPNFLHLTPPAIRQQ 134

Query: 437 CEALKQFCTEWPNLLNSEESIEKHIP 514
           CEA+K+FCT WP  L +E   ++H P
Sbjct: 135 CEAIKKFCTPWPKGLETEAKWQRHFP 160



 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 51/157 (32%), Positives = 82/157 (52%)
 Frame = +1

Query: 292 NFPPVFGAITDTSGLRTKGSSTAR*KSECRINENTKFPSLNTTSYQEPV*SLKTILYGMA 471
           +F P    +    G   +G++     +   + +   F  L   + ++   ++K       
Sbjct: 87  SFHPASVPLPLRQGFTERGAAAPSKFANAELMKIPNFLHLTPPAIRQQCEAIKKFCTPWP 146

Query: 472 ESTQL*GKYREAYPLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRLV 651
           +  +   K++  +PLE+ ++DYC + P+IRNP AR V + ++L+DLK D HA DKF RLV
Sbjct: 147 KGLETEAKWQRHFPLEVTTTDYCQSLPTIRNPEARRVTITLKLSDLKFDAHARDKFLRLV 206

Query: 652 GDRYDPKTDLVTIHSGFVVQLKYKTLDYVHLFX*LAC 762
           GDRY+  TDLVT  +    Q K +  DY  L+   AC
Sbjct: 207 GDRYNKDTDLVTFVTDRCPQ-KKQNYDYA-LYLLTAC 241



 Score = 34.7 bits (76), Expect = 0.17
 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 1/38 (2%)
 Frame = +3

Query: 144 EEEEEFRVLDILKKRDKMQRR-VVKRTDVQPDRIDRMA 254
           E++EEFRVL +   + +MQ+R  V+R  + P R  RMA
Sbjct: 36  EDDEEFRVLSLRTVKQQMQKRQQVRRDPITPPRTGRMA 73


>AE014296-512|AAF47688.1|  326|Drosophila melanogaster CG2101-PA
           protein.
          Length = 326

 Score =  134 bits (325), Expect = 1e-31
 Identities = 54/86 (62%), Positives = 68/86 (79%)
 Frame = +2

Query: 257 NQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPPVIKSQ 436
           +Q+W  VWPGP++FHP+SVPLP+RQG+  +G A P K ANAELMKIPNFLHLTPP I+ Q
Sbjct: 75  DQDWTAVWPGPRSFHPASVPLPLRQGFTERGAAAPSKFANAELMKIPNFLHLTPPAIRQQ 134

Query: 437 CEALKQFCTEWPNLLNSEESIEKHIP 514
           CEA+K+FCT WP  L +E   ++H P
Sbjct: 135 CEAIKKFCTPWPKGLETEAKWQRHFP 160



 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 51/157 (32%), Positives = 82/157 (52%)
 Frame = +1

Query: 292 NFPPVFGAITDTSGLRTKGSSTAR*KSECRINENTKFPSLNTTSYQEPV*SLKTILYGMA 471
           +F P    +    G   +G++     +   + +   F  L   + ++   ++K       
Sbjct: 87  SFHPASVPLPLRQGFTERGAAAPSKFANAELMKIPNFLHLTPPAIRQQCEAIKKFCTPWP 146

Query: 472 ESTQL*GKYREAYPLEIISSDYCHASPSIRNPLARVVILRVQLADLKLDKHATDKFKRLV 651
           +  +   K++  +PLE+ ++DYC + P+IRNP AR V + ++L+DLK D HA DKF RLV
Sbjct: 147 KGLETEAKWQRHFPLEVTTTDYCQSLPTIRNPEARRVTITLKLSDLKFDAHARDKFLRLV 206

Query: 652 GDRYDPKTDLVTIHSGFVVQLKYKTLDYVHLFX*LAC 762
           GDRY+  TDLVT  +    Q K +  DY  L+   AC
Sbjct: 207 GDRYNKDTDLVTFVTDRCPQ-KKQNYDYA-LYLLTAC 241



 Score = 34.7 bits (76), Expect = 0.17
 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 1/38 (2%)
 Frame = +3

Query: 144 EEEEEFRVLDILKKRDKMQRR-VVKRTDVQPDRIDRMA 254
           E++EEFRVL +   + +MQ+R  V+R  + P R  RMA
Sbjct: 36  EDDEEFRVLSLRTVKQQMQKRQQVRRDPITPPRTGRMA 73


>DQ539337-1|ABG02858.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539336-1|ABG02857.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539335-1|ABG02856.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539334-1|ABG02855.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539333-1|ABG02854.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539332-1|ABG02853.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539331-1|ABG02852.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539330-1|ABG02851.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539329-1|ABG02850.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539328-1|ABG02849.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539327-1|ABG02848.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539326-1|ABG02847.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539325-1|ABG02846.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539324-1|ABG02845.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539323-1|ABG02844.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539322-1|ABG02843.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539321-1|ABG02842.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539320-1|ABG02841.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539319-1|ABG02840.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539318-1|ABG02839.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539317-1|ABG02838.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539316-1|ABG02837.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539315-1|ABG02836.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539314-1|ABG02835.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539313-1|ABG02834.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539312-1|ABG02833.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539311-1|ABG02832.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>DQ539310-1|ABG02831.1|  469|Drosophila melanogaster CG5273 protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>BT010227-1|AAQ23545.1|  469|Drosophila melanogaster RE67565p
           protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>AL132792-3|CAB60032.1|  468|Drosophila melanogaster EG:BACR19J1.3
           protein.
          Length = 468

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 175 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 212


>AE014298-103|AAN09031.1|  469|Drosophila melanogaster CG5273-PC,
           isoform C protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>AE014298-102|AAN09030.1|  469|Drosophila melanogaster CG5273-PB,
           isoform B protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>AE014298-101|AAF45545.1|  469|Drosophila melanogaster CG5273-PA,
           isoform A protein.
          Length = 469

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 251 GPNQNWGNVWPGPKTFHPSSVPLPIRQGYVPKGQAPPG 364
           GP   +    P   T++PS+  +P+  GY P    PPG
Sbjct: 176 GPGSGYSPNIPAGATYYPSAGHVPMGGGYHPAAAPPPG 213


>AY058570-1|AAL13799.1|  553|Drosophila melanogaster LD26007p
           protein.
          Length = 553

 Score = 30.7 bits (66), Expect = 2.7
 Identities = 18/60 (30%), Positives = 32/60 (53%)
 Frame = +3

Query: 63  SGCFNSACNVKLWRLNSTSADSALKKGEEEEEFRVLDILKKRDKMQRRVVKRTDVQPDRI 242
           S C +S+  +K  R  STS D       +   + +++ LK+R+K    ++KR D + DR+
Sbjct: 383 SDC-SSSTTLKKKRKMSTSTDG------DSTNYELIEYLKRREKRDEELLKRMDAREDRL 435


>AJ271814-1|CAB72133.1|  553|Drosophila melanogaster Meso18E protein
           protein.
          Length = 553

 Score = 30.7 bits (66), Expect = 2.7
 Identities = 18/60 (30%), Positives = 32/60 (53%)
 Frame = +3

Query: 63  SGCFNSACNVKLWRLNSTSADSALKKGEEEEEFRVLDILKKRDKMQRRVVKRTDVQPDRI 242
           S C +S+  +K  R  STS D       +   + +++ LK+R+K    ++KR D + DR+
Sbjct: 383 SDC-SSSTTLKKKRKMSTSTDG------DSTNYELIEYLKRREKRDEELLKRMDAREDRL 435


>AE014298-2922|AAF49011.1|  553|Drosophila melanogaster CG14233-PA
           protein.
          Length = 553

 Score = 30.7 bits (66), Expect = 2.7
 Identities = 18/60 (30%), Positives = 32/60 (53%)
 Frame = +3

Query: 63  SGCFNSACNVKLWRLNSTSADSALKKGEEEEEFRVLDILKKRDKMQRRVVKRTDVQPDRI 242
           S C +S+  +K  R  STS D       +   + +++ LK+R+K    ++KR D + DR+
Sbjct: 383 SDC-SSSTTLKKKRKMSTSTDG------DSTNYELIEYLKRREKRDEELLKRMDAREDRL 435


>AY118462-1|AAM49831.1|  625|Drosophila melanogaster GM01690p
           protein.
          Length = 625

 Score = 29.5 bits (63), Expect = 6.2
 Identities = 19/70 (27%), Positives = 27/70 (38%)
 Frame = +1

Query: 610 KLDKHATDKFKRLVGDRYDPKTDLVTIHSGFVVQLKYKTLDYVHLFX*LACTMSRGNFED 789
           K   H   +F R +    DP    + I +        KT    H      C + + +F  
Sbjct: 73  KKSPHLRQEFGRALMGHQDPLLLALKIFANCPDSSNIKTKSLSHFVLDTVCKLHK-DFPH 131

Query: 790 LGEGEDPRTT 819
           LGEG DP T+
Sbjct: 132 LGEGSDPNTS 141


>AE014297-1476|AAF54775.1|  588|Drosophila melanogaster CG4066-PA
           protein.
          Length = 588

 Score = 29.5 bits (63), Expect = 6.2
 Identities = 18/68 (26%), Positives = 36/68 (52%)
 Frame = +3

Query: 66  GCFNSACNVKLWRLNSTSADSALKKGEEEEEFRVLDILKKRDKMQRRVVKRTDVQPDRID 245
           G   S  N+ ++   S  A S L + +E+ + RV +++ K +  Q ++++RT    DR++
Sbjct: 368 GVVTSFQNLDIFANRSIEAVSDLTRLQEQNKDRVRNLVDKLNVTQGQILRRTKGLDDRLN 427

Query: 246 RMAQTRTG 269
            + Q   G
Sbjct: 428 FVNQLLLG 435


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 38,139,023
Number of Sequences: 53049
Number of extensions: 825534
Number of successful extensions: 2161
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 1993
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2158
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4168047156
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -