SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30152.Seq
         (877 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT022090-1|AAY33506.2|  767|Drosophila melanogaster GH26310p pro...    62   1e-09
BT014923-1|AAT47774.1|  767|Drosophila melanogaster AT19737p pro...    62   1e-09
AY069720-1|AAL39865.1|  654|Drosophila melanogaster LP02641p pro...    55   1e-07
AE014298-1317|AAN09249.2|  625|Drosophila melanogaster CG17754-P...    55   1e-07
AE014298-1316|AAF46476.2|  654|Drosophila melanogaster CG17754-P...    55   1e-07
AE014298-1315|AAN09250.2|  654|Drosophila melanogaster CG17754-P...    55   1e-07
BT010272-1|AAQ23590.1|  623|Drosophila melanogaster RE13447p pro...    55   1e-07
AF237711-1|AAF43447.1|  623|Drosophila melanogaster Diablo protein.    55   1e-07
AE014296-2581|AAF49578.1|  623|Drosophila melanogaster CG6224-PA...    55   1e-07
AB027612-1|BAD06413.1|  623|Drosophila melanogaster kelch-like p...    55   1e-07
BT001347-1|AAN71102.1|  620|Drosophila melanogaster AT24465p pro...    54   3e-07
AY060733-1|AAL28281.1|  513|Drosophila melanogaster GH18278p pro...    54   3e-07
AE013599-2779|AAF57630.2|  513|Drosophila melanogaster CG15097-P...    54   3e-07
AE013599-2778|AAO41354.1|  617|Drosophila melanogaster CG15097-P...    54   3e-07
L08483-2|AAA53471.1|  689|Drosophila melanogaster ring canal pro...    54   3e-07
L08483-1|AAA53472.2| 1477|Drosophila melanogaster ring canal pro...    54   3e-07
AE014134-2910|AAF53651.1|  689|Drosophila melanogaster CG7210-PA...    54   3e-07
AE014134-2909|AAN11182.3| 1477|Drosophila melanogaster CG7210-PB...    54   3e-07
DQ372684-1|ABD14408.1|  776|Drosophila melanogaster KEAP1 protein.     53   5e-07
BT001720-1|AAN71475.1|  608|Drosophila melanogaster RE68961p pro...    53   5e-07
AE014297-2308|AAO41571.1|  744|Drosophila melanogaster CG3962-PC...    53   5e-07
AE014297-2307|AAF55386.1|  744|Drosophila melanogaster CG3962-PA...    53   5e-07
AE014297-2306|AAN13732.2|  776|Drosophila melanogaster CG3962-PB...    53   5e-07
BT015287-1|AAT94516.1|  538|Drosophila melanogaster GH14381p pro...    48   1e-05
AY051950-1|AAK93374.1|  575|Drosophila melanogaster LD42169p pro...    48   1e-05
AE014297-1440|AAF54738.1|  538|Drosophila melanogaster CG3571-PB...    48   1e-05
AE014297-1439|AAF54737.1|  575|Drosophila melanogaster CG3571-PA...    48   1e-05
AY118728-1|AAM50588.1|  627|Drosophila melanogaster GH03286p pro...    42   0.001
AE014134-2301|AAF53261.1|  627|Drosophila melanogaster CG9426-PA...    42   0.001
U14404-1|AAA50839.1|  115|Drosophila melanogaster BTB-VII protei...    38   0.018
AY051895-1|AAK93319.1|  743|Drosophila melanogaster LD38452p pro...    38   0.018
AE014296-570|AAN11533.1|  743|Drosophila melanogaster CG11494-PB...    38   0.018
AE014296-569|AAF47721.2|  743|Drosophila melanogaster CG11494-PA...    38   0.018
AB235207-1|BAF31332.1| 1089|Drosophila melanogaster CG32611 prot...    37   0.042
X54666-1|CAA38477.1|  728|Drosophila melanogaster BRcore-TNT1-Q1...    36   0.073
X54665-1|CAA38476.1|  514|Drosophila melanogaster BRcore-Z2 prot...    36   0.073
X54664-1|CAA38475.1|  704|Drosophila melanogaster BRcore-NS-Z3 p...    36   0.073
X54663-1|CAA38474.1|  663|Drosophila melanogaster BRcore-Q1-Z1 p...    36   0.073
U72492-1|AAB92662.1|  675|Drosophila melanogaster fruitless clas...    36   0.073
U51585-1|AAB09760.1|  877|Drosophila melanogaster Broad-Complex ...    36   0.073
U43733-1|AAA86639.1|  904|Drosophila melanogaster Abrupt protein.      36   0.073
U14403-1|AAA50838.1|  115|Drosophila melanogaster BTB-VI protein...    36   0.073
U01333-1|AAA87052.1|  127|Drosophila melanogaster BTB domain pro...    36   0.073
D84437-1|BAA12663.1|  855|Drosophila melanogaster fruitless prot...    36   0.073
BT024450-1|ABC86512.1|  960|Drosophila melanogaster GH19932p pro...    36   0.073
BT001583-1|AAN71338.1|  894|Drosophila melanogaster RE25924p pro...    36   0.073
AY152838-1|AAN74533.1|  161|Drosophila melanogaster transcriptio...    36   0.073
AY152837-1|AAN74532.1|  109|Drosophila melanogaster transcriptio...    36   0.073
AY122075-1|AAM52587.1|  503|Drosophila melanogaster AT17506p pro...    36   0.073
AY069756-1|AAL39901.1|  880|Drosophila melanogaster LP12157p pro...    36   0.073
AL009146-4|CAA15629.1|  710|Drosophila melanogaster EG:17A9.1,FB...    36   0.073
AL009146-3|CAA15628.1|  702|Drosophila melanogaster EG:17A9.1,FB...    36   0.073
AL009146-2|CAA15627.1|  880|Drosophila melanogaster EG:17A9.1,FB...    36   0.073
AL009146-1|CAA15626.1|  514|Drosophila melanogaster EG:17A9.1,FB...    36   0.073
AJ252082-1|CAB64385.1|  979|Drosophila melanogaster BAB-I protei...    36   0.073
AF220177-1|AAG28588.1|  956|Drosophila melanogaster fruitless ty...    36   0.073
AF220176-1|AAG28587.1|  855|Drosophila melanogaster fruitless ty...    36   0.073
AF039231-1|AAB96677.1|  776|Drosophila melanogaster fruitless cl...    36   0.073
AE014298-238|AAN09054.1|  663|Drosophila melanogaster CG11491-PG...    36   0.073
AE014298-237|AAF45648.1|  724|Drosophila melanogaster CG11491-PE...    36   0.073
AE014298-236|AAN09053.1|  880|Drosophila melanogaster CG11491-PC...    36   0.073
AE014298-235|AAF45647.1|  880|Drosophila melanogaster CG11491-PB...    36   0.073
AE014298-234|AAF45650.2|  628|Drosophila melanogaster CG11491-PD...    36   0.073
AE014298-233|AAF45651.2|  702|Drosophila melanogaster CG11491-PA...    36   0.073
AE014298-232|AAN09052.1|  502|Drosophila melanogaster CG11491-PF...    36   0.073
AE014297-2540|AAN13777.1|  665|Drosophila melanogaster CG14307-P...    36   0.073
AE014297-2539|AAF55564.2|  516|Drosophila melanogaster CG14307-P...    36   0.073
AE014297-2538|AAS65176.1|  854|Drosophila melanogaster CG14307-P...    36   0.073
AE014297-2537|AAS65175.1|  854|Drosophila melanogaster CG14307-P...    36   0.073
AE014297-2536|AAF55565.2|  854|Drosophila melanogaster CG14307-P...    36   0.073
AE014297-2535|AAS65174.1|  906|Drosophila melanogaster CG14307-P...    36   0.073
AE014297-2534|AAS65173.1|  870|Drosophila melanogaster CG14307-P...    36   0.073
AE014297-2533|AAN13776.1|  955|Drosophila melanogaster CG14307-P...    36   0.073
AE014297-2532|AAN13775.1|  695|Drosophila melanogaster CG14307-P...    36   0.073
AE014297-2531|AAS65172.1|  705|Drosophila melanogaster CG14307-P...    36   0.073
AE014297-2530|AAF55563.2|  796|Drosophila melanogaster CG14307-P...    36   0.073
AE014297-2529|AAN13774.1|  688|Drosophila melanogaster CG14307-P...    36   0.073
AE014297-2528|AAF55562.2|  789|Drosophila melanogaster CG14307-P...    36   0.073
AE014296-173|AAS64927.1|  526|Drosophila melanogaster CG9097-PA,...    36   0.073
AE014296-172|AAF47439.2|  977|Drosophila melanogaster CG9097-PB,...    36   0.073
AE014134-2051|AAN10774.1|  894|Drosophila melanogaster CG4807-PB...    36   0.073
AE014134-2050|AAF53087.2|  904|Drosophila melanogaster CG4807-PA...    36   0.073
U14399-1|AAA50834.1|  115|Drosophila melanogaster BTB-II protein...    36   0.097
BT009963-1|AAQ22432.1| 1067|Drosophila melanogaster RE72345p pro...    36   0.097
AJ252173-1|CAB64388.1| 1067|Drosophila melanogaster BAB-II prote...    36   0.097
AE014296-178|AAF47442.2| 1067|Drosophila melanogaster CG9102-PA ...    36   0.097
Z11723-2|CAA77786.1|  811|Drosophila melanogaster DNA binding pr...    34   0.30 
Z11723-1|CAA77785.1|  813|Drosophila melanogaster DNA binding pr...    34   0.30 
X71627-1|CAA50634.1|  643|Drosophila melanogaster tramtrack p69 ...    34   0.30 
X71626-1|CAA50633.1|  813|Drosophila melanogaster tramtrack p88 ...    34   0.30 
X17121-1|CAA34981.1|  641|Drosophila melanogaster protein ( Dros...    34   0.30 
M62856-1|AAA28544.1|  641|Drosophila melanogaster fushi tarazu r...    34   0.30 
BT025183-1|ABF00108.1|  487|Drosophila melanogaster IP15250p pro...    34   0.30 
BT001723-1|AAN71478.1|  643|Drosophila melanogaster RE69322p pro...    34   0.30 
AY122169-1|AAM52681.1|  643|Drosophila melanogaster LD28689p pro...    34   0.30 
AE014297-4786|AAN14283.1|  643|Drosophila melanogaster CG1856-PF...    34   0.30 
AE014297-4785|AAF57181.1|  643|Drosophila melanogaster CG1856-PD...    34   0.30 
AE014297-4784|AAF57182.3|  643|Drosophila melanogaster CG1856-PC...    34   0.30 
AE014297-4783|AAN14282.1|  813|Drosophila melanogaster CG1856-PE...    34   0.30 
AE014297-4782|AAF57179.1|  813|Drosophila melanogaster CG1856-PB...    34   0.30 
AE014297-4781|AAF57180.1|  813|Drosophila melanogaster CG1856-PA...    34   0.30 
BT029293-1|ABK30930.1|  681|Drosophila melanogaster RT01152p pro...    33   0.39 
BT029292-1|ABK30929.1|  681|Drosophila melanogaster RT01151p pro...    33   0.39 
BT029291-1|ABK30928.1|  681|Drosophila melanogaster RT01150p pro...    33   0.39 
AE014297-3156|AAF55998.2|  681|Drosophila melanogaster CG31160-P...    33   0.39 
Z50021-1|CAA90324.1| 1096|Drosophila melanogaster centrosome-ass...    33   0.52 
BT010090-1|AAQ22559.1| 1096|Drosophila melanogaster LD02352p pro...    33   0.52 
AY094818-1|AAM11171.1|  616|Drosophila melanogaster LD33804p pro...    33   0.52 
AE014298-3034|AAN09551.1|  541|Drosophila melanogaster CG1812-PB...    33   0.52 
AE014298-3033|AAF50896.1|  616|Drosophila melanogaster CG1812-PA...    33   0.52 
AE014297-1986|AAN13643.1| 1096|Drosophila melanogaster CG6384-PB...    33   0.52 
AE014297-1985|AAF55159.1| 1096|Drosophila melanogaster CG6384-PA...    33   0.52 
D84438-1|BAA12664.1|   61|Drosophila melanogaster fru protein.         33   0.68 
U68563-1|AAB81117.1|  519|Drosophila melanogaster GAGA-519b Adf-...    32   0.90 
U18386-1|AAB81113.1|  519|Drosophila melanogaster GAGA-519a Adf-...    32   0.90 
U16728-1|AAB81112.1|  581|Drosophila melanogaster GAGA-581 Adf-2...    32   0.90 
L22205-1|AAA16072.1|  519|Drosophila melanogaster GAGA transcrip...    32   0.90 
BT003649-1|AAO39653.1|  581|Drosophila melanogaster AT11176p pro...    32   0.90 
AY069651-1|AAL39796.1|  519|Drosophila melanogaster LD41963p pro...    32   0.90 
AY060364-1|AAL25403.1|  127|Drosophila melanogaster LD14505p pro...    32   0.90 
AJ225042-2|CAB86986.1|  581|Drosophila melanogaster TRL-581 prot...    32   0.90 
AJ225042-1|CAA12383.1|  519|Drosophila melanogaster TRL-519 prot...    32   0.90 
AF308476-1|AAG45054.1|  127|Drosophila melanogaster batman prote...    32   0.90 
AE014296-2425|ABC66145.1|  519|Drosophila melanogaster CG33261-P...    32   0.90 
AE014296-2424|AAN11800.1|  519|Drosophila melanogaster CG33261-P...    32   0.90 
AE014296-2423|AAF49711.1|  519|Drosophila melanogaster CG33261-P...    32   0.90 
AE014296-2422|AAN11799.1|  519|Drosophila melanogaster CG33261-P...    32   0.90 
AE014296-2421|AAF49710.1|  519|Drosophila melanogaster CG33261-P...    32   0.90 
AE014296-2419|AAS65007.1|  582|Drosophila melanogaster CG33261-P...    32   0.90 
AE014296-2418|AAF49709.1|  582|Drosophila melanogaster CG33261-P...    32   0.90 
AE014296-2417|ABC66143.1|  567|Drosophila melanogaster CG33261-P...    32   0.90 
AE013599-2635|AAM68181.1|  127|Drosophila melanogaster CG5738-PD...    32   0.90 
AE013599-2634|AAM68180.1|  127|Drosophila melanogaster CG5738-PC...    32   0.90 
AE013599-2633|AAM68179.1|  127|Drosophila melanogaster CG5738-PB...    32   0.90 
AE013599-2632|AAF57739.1|  127|Drosophila melanogaster CG5738-PA...    32   0.90 
X90986-2|CAA62474.1| 1085|Drosophila melanogaster pipsqueak prot...    32   1.2  
X90986-1|CAA62473.1|  535|Drosophila melanogaster pipsqueak prot...    32   1.2  
U48358-1|AAC47153.1| 1065|Drosophila melanogaster PsqA protein.        32   1.2  
BT010295-1|AAQ23613.1|  661|Drosophila melanogaster LD16058p pro...    32   1.2  
AY069588-1|AAL39733.1| 1064|Drosophila melanogaster LD33470p pro...    32   1.2  
AF416603-1|AAL11905.1|  661|Drosophila melanogaster ribbon protein.    32   1.2  
AE013599-2846|AAF57588.1|  661|Drosophila melanogaster CG7230-PA...    32   1.2  
AE013599-1144|AAX52711.1|  535|Drosophila melanogaster CG2368-PL...    32   1.2  
AE013599-1143|AAF58770.1| 1046|Drosophila melanogaster CG2368-PA...    32   1.2  
AE013599-1142|AAS64878.1| 1064|Drosophila melanogaster CG2368-PC...    32   1.2  
AE013599-1141|AAF58769.1| 1064|Drosophila melanogaster CG2368-PB...    32   1.2  
X75498-1|CAA53215.1|  534|Drosophila melanogaster protein A prot...    31   2.1  
U62802-1|AAC17459.1|  514|Drosophila melanogaster doom protein.        31   2.1  
U30913-1|AAA82989.1|  520|Drosophila melanogaster mod1.9 protein...    31   2.1  
U30905-1|AAA82988.1|  610|Drosophila melanogaster mod2.2 protein.      31   2.1  
U14401-1|AAA50836.1|  115|Drosophila melanogaster BTB-IV protein...    31   2.1  
U07607-1|AAA19593.1|  894|Drosophila melanogaster Lola protein l...    31   2.1  
U07606-1|AAA19592.1|  467|Drosophila melanogaster Lola protein s...    31   2.1  
BT029698-1|ABL75755.1|  488|Drosophila melanogaster IP17441p pro...    31   2.1  
BT029109-1|ABJ17042.1|  603|Drosophila melanogaster IP14843p pro...    31   2.1  
BT024979-1|ABE01209.1|  384|Drosophila melanogaster IP13591p pro...    31   2.1  
BT022124-1|AAY51519.1|  882|Drosophila melanogaster IP09048p pro...    31   2.1  
BT004909-1|AAO49162.1|  706|Drosophila melanogaster LD03274p pro...    31   2.1  
BT003579-1|AAO39583.1|  539|Drosophila melanogaster LD27582p pro...    31   2.1  
BT003484-1|AAO39487.1|  505|Drosophila melanogaster SD07645p pro...    31   2.1  
AY095035-1|AAM11363.1|  676|Drosophila melanogaster LD26392p pro...    31   2.1  
AY058586-1|AAL13815.1|  748|Drosophila melanogaster LD28033p pro...    31   2.1  
AJ320163-1|CAC51488.1|  485|Drosophila melanogaster mod(mdg4)53....    31   2.1  
AJ320161-1|CAC51387.1|  476|Drosophila melanogaster mod(mdg4)52....    31   2.1  
AJ277194-1|CAB85489.1|  534|Drosophila melanogaster mod(mdg4)58....    31   2.1  
AJ277192-1|CAB85487.1|  610|Drosophila melanogaster mod(mdg4)67....    31   2.1  
AJ277191-1|CAB85486.1|  601|Drosophila melanogaster mod(mdg4)65....    31   2.1  
AJ277190-1|CAB85485.1|  580|Drosophila melanogaster mod(mdg4)64....    31   2.1  
AJ277189-1|CAB85484.1|  567|Drosophila melanogaster mod(mdg4)62....    31   2.1  
AJ277188-1|CAB85483.1|  545|Drosophila melanogaster mod(mdg4)60....    31   2.1  
AJ277187-1|CAB85482.1|  541|Drosophila melanogaster mod(mdg4)59....    31   2.1  
AJ277186-1|CAB85481.1|  541|Drosophila melanogaster mod(mdg4)59....    31   2.1  
AJ277185-1|CAB85480.1|  536|Drosophila melanogaster mod(mdg4)58....    31   2.1  
AJ277183-1|CAB85478.1|  514|Drosophila melanogaster mod(mdg4)56....    31   2.1  
AJ277182-1|CAB85477.1|  510|Drosophila melanogaster mod(mdg4)55....    31   2.1  
AJ277181-1|CAB85476.1|  505|Drosophila melanogaster mod(mdg4)55....    31   2.1  
AJ277180-1|CAB85475.1|  503|Drosophila melanogaster mod(mdg4)55....    31   2.1  
AJ277179-1|CAB85474.1|  506|Drosophila melanogaster mod(mdg4)55....    31   2.1  
AJ277177-1|CAB85472.1|  497|Drosophila melanogaster mod(mdg4)54....    31   2.1  
AJ277176-1|CAB85471.1|  486|Drosophila melanogaster mod(mdg4)53....    31   2.1  
AJ277174-1|CAB85469.1|  473|Drosophila melanogaster mod(mdg4)51....    31   2.1  
AE014298-820|AAF46102.2|  676|Drosophila melanogaster CG3726-PA ...    31   2.1  
AE014297-3002|AAN13875.1|  580|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-3001|AAN13874.1|  545|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-3000|AAN13873.1|  506|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2999|AAO41586.1|  486|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2998|AAO41585.1|  567|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2997|AAO41584.1|  505|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2996|AAO41583.1|  490|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2995|AAO41582.1|  500|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2994|AAF55888.1|  534|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2993|AAN13872.1|  603|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2992|AAN13871.1|  503|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2991|AAO41581.1|  526|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2990|AAO41580.1|  610|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2989|AAN13870.1|  510|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2988|AAN13869.1|  476|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2987|AAN13868.1|  539|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2986|AAN13867.1|  473|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2985|AAN13866.1|  541|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2984|AAF55885.2|  498|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2983|AAN13865.1|  514|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2982|AAN13864.1|  430|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2981|AAN13863.1|  497|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2980|AAF55884.1|  520|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2979|AAF55883.2|  536|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2978|AAN13862.1|  485|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2977|AAF55882.2|  475|Drosophila melanogaster CG32491-P...    31   2.1  
AE014297-2045|AAF55197.2|  943|Drosophila melanogaster CG6118-PA...    31   2.1  
AE014296-2272|AAN11836.1|  626|Drosophila melanogaster CG32121-P...    31   2.1  
AE013599-1140|AAO41431.1|  465|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1139|AAM68768.2|  603|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1138|AAO41430.1|  608|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1137|AAF58775.3|  706|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1136|AAO41429.1|  720|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1135|AAZ52818.1|  665|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1134|AAM68766.1|  748|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1133|AAM68765.1|  748|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1132|AAS64877.1|  549|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1131|AAM68764.3|  546|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1130|AAM68767.2|  565|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1129|AAO41428.1|  575|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1128|AAO41427.1|  575|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1127|AAO41426.1|  970|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1126|AAF58773.1|  787|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1125|AAF58776.3|  787|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1124|AAF58777.2|  518|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1123|AAF58778.4|  963|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1122|AAF58779.3|  757|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1121|AAO41424.2|  668|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1120|AAS64876.1|  771|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1119|AAF58781.3|  878|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1118|AAS64875.1|  577|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1117|AAS64874.1|  602|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1116|AAO41425.2|  891|Drosophila melanogaster CG12052-P...    31   2.1  
AE013599-1115|AAF58782.2|  891|Drosophila melanogaster CG12052-P...    31   2.1  
AB107351-1|BAC67656.1|  894|Drosophila melanogaster Lola protein...    31   2.1  
AB107350-1|BAC67655.1|  602|Drosophila melanogaster Lola protein...    31   2.1  
AB107349-1|BAC67654.1|  577|Drosophila melanogaster Lola protein...    31   2.1  
AB107348-1|BAC67653.1|  771|Drosophila melanogaster Lola protein...    31   2.1  
AB107347-1|BAC67652.1|  668|Drosophila melanogaster Lola protein...    31   2.1  
AB107346-1|BAC67651.1|  757|Drosophila melanogaster Lola protein...    31   2.1  
AB107345-1|BAC67650.1|  963|Drosophila melanogaster Lola protein...    31   2.1  
AB107344-1|BAC67649.1|  518|Drosophila melanogaster Lola protein...    31   2.1  
AB107343-1|BAC67648.1|  786|Drosophila melanogaster Lola protein...    31   2.1  
AB107342-1|BAC67647.1|  970|Drosophila melanogaster Lola protein...    31   2.1  
AB107341-1|BAC67646.1|  575|Drosophila melanogaster Lola protein...    31   2.1  
AB107340-1|BAC67645.1|  565|Drosophila melanogaster Lola protein...    31   2.1  
AB107339-1|BAC67644.1|  546|Drosophila melanogaster Lola protein...    31   2.1  
AB107338-1|BAC67643.1|  549|Drosophila melanogaster Lola protein...    31   2.1  
AB107337-1|BAC67642.1|  748|Drosophila melanogaster Lola protein...    31   2.1  
AB107336-1|BAC67641.1|  665|Drosophila melanogaster Lola protein...    31   2.1  
AB107335-1|BAC67640.1|  706|Drosophila melanogaster Lola protein...    31   2.1  
AB107334-1|BAC67639.1|  608|Drosophila melanogaster Lola protein...    31   2.1  
AB107333-1|BAC67638.1|  603|Drosophila melanogaster Lola protein...    31   2.1  
AB107332-1|BAC67637.1|  465|Drosophila melanogaster Lola protein...    31   2.1  
AB107331-1|BAC67636.1|  894|Drosophila melanogaster Lola protein...    31   2.1  
AB107330-1|BAC67635.1|  602|Drosophila melanogaster Lola protein...    31   2.1  
AB107329-1|BAC67634.1|  577|Drosophila melanogaster Lola protein...    31   2.1  
AB107328-1|BAC67633.1|  771|Drosophila melanogaster Lola protein...    31   2.1  
AB107327-1|BAC67632.1|  668|Drosophila melanogaster Lola protein...    31   2.1  
AB107326-1|BAC67631.1|  757|Drosophila melanogaster Lola protein...    31   2.1  
AB107325-1|BAC67630.1|  963|Drosophila melanogaster Lola protein...    31   2.1  
AB107324-1|BAC67629.1|  518|Drosophila melanogaster Lola protein...    31   2.1  
AB107323-1|BAC67628.1|  786|Drosophila melanogaster Lola protein...    31   2.1  
AB107322-1|BAC67627.1|  970|Drosophila melanogaster Lola protein...    31   2.1  
AB107321-1|BAC67626.1|  575|Drosophila melanogaster Lola protein...    31   2.1  
AB107320-1|BAC67625.1|  565|Drosophila melanogaster Lola protein...    31   2.1  
AB107319-1|BAC67624.1|  546|Drosophila melanogaster Lola protein...    31   2.1  
AB107318-1|BAC67623.1|  549|Drosophila melanogaster Lola protein...    31   2.1  
AB107317-1|BAC67622.1|  748|Drosophila melanogaster Lola protein...    31   2.1  
AB107316-1|BAC67621.1|  665|Drosophila melanogaster Lola protein...    31   2.1  
AB107315-1|BAC67620.1|  706|Drosophila melanogaster Lola protein...    31   2.1  
AB107314-1|BAC67619.1|  608|Drosophila melanogaster Lola protein...    31   2.1  
AB107313-1|BAC67618.1|  603|Drosophila melanogaster Lola protein...    31   2.1  
AB107312-1|BAC67617.1|  465|Drosophila melanogaster Lola protein...    31   2.1  
AB107311-1|BAC67616.1|  894|Drosophila melanogaster Lola protein...    31   2.1  
AB107310-1|BAC67615.1|  602|Drosophila melanogaster Lola protein...    31   2.1  
AB107309-1|BAC67614.1|  577|Drosophila melanogaster Lola protein...    31   2.1  
AB107308-1|BAC67613.1|  771|Drosophila melanogaster Lola protein...    31   2.1  
AB107307-1|BAC67612.1|  668|Drosophila melanogaster Lola protein...    31   2.1  
AB107306-1|BAC67611.1|  757|Drosophila melanogaster Lola protein...    31   2.1  
AB107305-1|BAC67610.1|  963|Drosophila melanogaster Lola protein...    31   2.1  
AB107304-1|BAC67609.1|  518|Drosophila melanogaster Lola protein...    31   2.1  
AB107303-1|BAC67608.1|  786|Drosophila melanogaster Lola protein...    31   2.1  
AB107302-1|BAC67607.1|  970|Drosophila melanogaster Lola protein...    31   2.1  
AB107301-1|BAC67606.1|  575|Drosophila melanogaster Lola protein...    31   2.1  
AB107300-1|BAC67605.1|  565|Drosophila melanogaster Lola protein...    31   2.1  
AB107299-1|BAC67604.1|  546|Drosophila melanogaster Lola protein...    31   2.1  
AB107298-1|BAC67603.1|  549|Drosophila melanogaster Lola protein...    31   2.1  
AB107297-1|BAC67602.1|  748|Drosophila melanogaster Lola protein...    31   2.1  
AB107296-1|BAC67601.1|  665|Drosophila melanogaster Lola protein...    31   2.1  
AB107295-1|BAC67600.1|  706|Drosophila melanogaster Lola protein...    31   2.1  
AB107294-1|BAC67599.1|  608|Drosophila melanogaster Lola protein...    31   2.1  
AB107293-1|BAC67598.1|  603|Drosophila melanogaster Lola protein...    31   2.1  
AB107292-1|BAC67597.1|  465|Drosophila melanogaster Lola protein...    31   2.1  
AB107291-1|BAC67596.1|  894|Drosophila melanogaster Lola protein...    31   2.1  
AB107290-1|BAC67595.1|  602|Drosophila melanogaster Lola protein...    31   2.1  
AB107289-1|BAC67594.1|  577|Drosophila melanogaster Lola protein...    31   2.1  
AB107288-1|BAC67593.1|  771|Drosophila melanogaster Lola protein...    31   2.1  
AB107287-1|BAC67592.1|  668|Drosophila melanogaster Lola protein...    31   2.1  
AB107286-1|BAC67591.1|  757|Drosophila melanogaster Lola protein...    31   2.1  
AB107285-1|BAC67590.1|  963|Drosophila melanogaster Lola protein...    31   2.1  
AB107284-1|BAC67589.1|  518|Drosophila melanogaster Lola protein...    31   2.1  
AB107283-1|BAC67588.1|  786|Drosophila melanogaster Lola protein...    31   2.1  
AB107282-1|BAC67587.1|  970|Drosophila melanogaster Lola protein...    31   2.1  
AB107281-1|BAC67586.1|  575|Drosophila melanogaster Lola protein...    31   2.1  
AB107280-1|BAC67585.1|  565|Drosophila melanogaster Lola protein...    31   2.1  
AB107279-1|BAC67584.1|  546|Drosophila melanogaster Lola protein...    31   2.1  
AB107278-1|BAC67583.1|  549|Drosophila melanogaster Lola protein...    31   2.1  
AB107277-1|BAC67582.1|  748|Drosophila melanogaster Lola protein...    31   2.1  
AB107276-1|BAC67581.1|  665|Drosophila melanogaster Lola protein...    31   2.1  
AB107275-1|BAC67580.1|  706|Drosophila melanogaster Lola protein...    31   2.1  
AB107274-1|BAC67579.1|  608|Drosophila melanogaster Lola protein...    31   2.1  
AB107273-1|BAC67578.1|  603|Drosophila melanogaster Lola protein...    31   2.1  
AB107272-1|BAC67577.1|  465|Drosophila melanogaster Lola protein...    31   2.1  
BT001697-1|AAN71452.1|  604|Drosophila melanogaster RE59755p pro...    31   2.8  
AY060464-1|AAL25503.1|  604|Drosophila melanogaster SD04616p pro...    31   2.8  
AE014134-279|AAN10454.1|  604|Drosophila melanogaster CG31666-PD...    31   2.8  
AE014134-278|AAF51350.2|  604|Drosophila melanogaster CG31666-PC...    31   2.8  
AE014134-277|AAF51352.3|  604|Drosophila melanogaster CG31666-PA...    31   2.8  
AE014134-276|AAF51351.2|  794|Drosophila melanogaster CG31666-PB...    31   2.8  
DQ507278-1|ABG24573.1|  829|Drosophila melanogaster roadkill iso...    30   3.6  
BT025210-1|ABF17901.1|  553|Drosophila melanogaster FI01104p pro...    30   3.6  
BT021321-1|AAX33469.1|  829|Drosophila melanogaster RE09049p pro...    30   3.6  
BT012443-1|AAS93714.1|  403|Drosophila melanogaster RE74593p pro...    30   3.6  
AY121682-1|AAM52009.1|  374|Drosophila melanogaster RE34508p pro...    30   3.6  
AY060324-1|AAL25363.1|  309|Drosophila melanogaster GH20830p pro...    30   3.6  
AE014298-818|AAN09155.2|  510|Drosophila melanogaster CG12236-PB...    30   3.6  
AE014298-817|AAF46100.1|  553|Drosophila melanogaster CG12236-PA...    30   3.6  
AE014297-1783|AAN14348.1|  374|Drosophila melanogaster CG9924-PB...    30   3.6  
AE014297-1782|AAF55007.3|  406|Drosophila melanogaster CG9924-PA...    30   3.6  
AE014297-1781|AAF55008.2|  829|Drosophila melanogaster CG9924-PE...    30   3.6  
AE014297-1780|AAN14347.1|  403|Drosophila melanogaster CG9924-PD...    30   3.6  
AE014297-1779|AAN14346.1|  403|Drosophila melanogaster CG9924-PC...    30   3.6  
AY069245-1|AAL39390.1|  197|Drosophila melanogaster GM01964p pro...    30   4.8  
AY061619-1|AAL29167.1|  428|Drosophila melanogaster SD08423p pro...    30   4.8  
AE014298-1932|AAF48294.1|  428|Drosophila melanogaster CG12175-P...    30   4.8  
U14400-1|AAA50835.1|  115|Drosophila melanogaster BTB-III protei...    29   6.4  
S77927-1|AAB33987.1|  168|Drosophila melanogaster pipsqueak-l(3)...    29   6.4  
AY122101-1|AAM52613.1| 1046|Drosophila melanogaster GH08821p pro...    29   6.4  
AY061260-1|AAL28808.1|  514|Drosophila melanogaster LD19131p pro...    29   6.4  
AJ252174-1|CAB64389.1| 1024|Drosophila melanogaster TKR protein ...    29   6.4  
AE014298-2294|AAF48544.1|  514|Drosophila melanogaster CG8924-PB...    29   6.4  
AE014298-2293|AAS65373.1|  514|Drosophila melanogaster CG8924-PA...    29   6.4  
AE013599-4022|AAX52689.1| 1046|Drosophila melanogaster CG16778-P...    29   6.4  
AE013599-4021|AAM68329.1| 1046|Drosophila melanogaster CG16778-P...    29   6.4  
AE013599-4020|AAF47317.2| 1046|Drosophila melanogaster CG16778-P...    29   6.4  
AE013599-4019|AAG22201.2| 1046|Drosophila melanogaster CG16778-P...    29   6.4  
AY094671-1|AAM11024.1| 1297|Drosophila melanogaster GH03947p pro...    29   8.4  
AJ441087-1|CAD29581.1|  130|Drosophila melanogaster GAGA factor ...    29   8.4  
AE014296-2420|ABC66144.1|  476|Drosophila melanogaster CG33261-P...    29   8.4  
AE013599-1327|AAF58636.1| 1297|Drosophila melanogaster CG9005-PA...    29   8.4  

>BT022090-1|AAY33506.2|  767|Drosophila melanogaster GH26310p
           protein.
          Length = 767

 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 31/73 (42%), Positives = 44/73 (60%)
 Frame = +2

Query: 509 GVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLP 688
           G+++ C D+L   L P+NC+ IM FAR  F   L   AR Y LRYF  VA ++ + L + 
Sbjct: 177 GLVKKCKDYLGRILTPENCVSIMGFARFRFLEDLHLKARNYTLRYFTEVAYRNIDILDMS 236

Query: 689 LDELNSIILEDEL 727
            ++  SII +DEL
Sbjct: 237 AEDFYSIISDDEL 249



 Score = 43.6 bits (98), Expect = 4e-04
 Identities = 32/96 (33%), Positives = 46/96 (47%), Gaps = 11/96 (11%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFT----TTLHSREQSD-------VLISGVR 401
           CDA +   +   F VHRAI+ +CS YF A FT     T    + SD       + I GV 
Sbjct: 82  CDAQISVGEDV-FNVHRAIMCSCSSYFRAQFTGFNADTPGCVDGSDAKKNNNFIHIPGVS 140

Query: 402 SXXXXXXXXXXXXXXIDVTDTNVHELLMTADYLAFL 509
           S               +++++NVHELL+ ADY+  +
Sbjct: 141 SCIMNCVIQYAYLRQTNISESNVHELLICADYVGMV 176


>BT014923-1|AAT47774.1|  767|Drosophila melanogaster AT19737p
           protein.
          Length = 767

 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 31/73 (42%), Positives = 44/73 (60%)
 Frame = +2

Query: 509 GVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLP 688
           G+++ C D+L   L P+NC+ IM FAR  F   L   AR Y LRYF  VA ++ + L + 
Sbjct: 177 GLVKKCKDYLGRILTPENCVSIMGFARFRFLEDLHLKARNYTLRYFTEVAYRNIDILDMS 236

Query: 689 LDELNSIILEDEL 727
            ++  SII +DEL
Sbjct: 237 AEDFYSIISDDEL 249



 Score = 43.6 bits (98), Expect = 4e-04
 Identities = 32/96 (33%), Positives = 46/96 (47%), Gaps = 11/96 (11%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFT----TTLHSREQSD-------VLISGVR 401
           CDA +   +   F VHRAI+ +CS YF A FT     T    + SD       + I GV 
Sbjct: 82  CDAQISVGEDV-FNVHRAIMCSCSSYFRAQFTGFNADTPGCVDGSDAKKNNNFIHIPGVS 140

Query: 402 SXXXXXXXXXXXXXXIDVTDTNVHELLMTADYLAFL 509
           S               +++++NVHELL+ ADY+  +
Sbjct: 141 SCIMNCVIQYAYLRQTNISESNVHELLICADYVGMV 176


>AY069720-1|AAL39865.1|  654|Drosophila melanogaster LP02641p
           protein.
          Length = 654

 Score = 55.2 bits (127), Expect = 1e-07
 Identities = 28/78 (35%), Positives = 41/78 (52%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +   V+  CC+ L   L+P NCLG   FA +  C  L   A+ Y  +YF+ V  Q+ E
Sbjct: 156 LLQLNAVVTACCNFLARQLHPSNCLGFAFFAEQQSCTTLLRLAQAYTCQYFMQVC-QNQE 214

Query: 674 FLHLPLDELNSIILEDEL 727
           F  L  D+L  ++  D+L
Sbjct: 215 FFQLNADQLGKLLSSDDL 232



 Score = 47.2 bits (107), Expect = 3e-05
 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 1/80 (1%)
 Frame = +3

Query: 255 CDAIVRAD-DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXX 431
           CD ++ A  DG   P HR +LSA S YF A+FT +L   ++ +V +  V           
Sbjct: 75  CDVVLIAGIDGKRVPAHRLVLSASSAYFSAMFTGSLRETKEQEVTLGEVHGDALHLLVQY 134

Query: 432 XXXXXIDVTDTNVHELLMTA 491
                I++ +  V  LL TA
Sbjct: 135 CYTGFIEMREDTVETLLATA 154


>AE014298-1317|AAN09249.2|  625|Drosophila melanogaster CG17754-PD,
           isoform D protein.
          Length = 625

 Score = 55.2 bits (127), Expect = 1e-07
 Identities = 28/78 (35%), Positives = 41/78 (52%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +   V+  CC+ L   L+P NCLG   FA +  C  L   A+ Y  +YF+ V  Q+ E
Sbjct: 156 LLQLNAVVTACCNFLARQLHPSNCLGFAFFAEQQSCTTLLRLAQAYTCQYFMQVC-QNQE 214

Query: 674 FLHLPLDELNSIILEDEL 727
           F  L  D+L  ++  D+L
Sbjct: 215 FFQLNADQLGKLLSSDDL 232



 Score = 47.2 bits (107), Expect = 3e-05
 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 1/80 (1%)
 Frame = +3

Query: 255 CDAIVRAD-DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXX 431
           CD ++ A  DG   P HR +LSA S YF A+FT +L   ++ +V +  V           
Sbjct: 75  CDVVLIAGIDGKRVPAHRLVLSASSAYFSAMFTGSLRETKEQEVTLGEVHGDALHLLVQY 134

Query: 432 XXXXXIDVTDTNVHELLMTA 491
                I++ +  V  LL TA
Sbjct: 135 CYTGFIEMREDTVETLLATA 154


>AE014298-1316|AAF46476.2|  654|Drosophila melanogaster CG17754-PC,
           isoform C protein.
          Length = 654

 Score = 55.2 bits (127), Expect = 1e-07
 Identities = 28/78 (35%), Positives = 41/78 (52%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +   V+  CC+ L   L+P NCLG   FA +  C  L   A+ Y  +YF+ V  Q+ E
Sbjct: 156 LLQLNAVVTACCNFLARQLHPSNCLGFAFFAEQQSCTTLLRLAQAYTCQYFMQVC-QNQE 214

Query: 674 FLHLPLDELNSIILEDEL 727
           F  L  D+L  ++  D+L
Sbjct: 215 FFQLNADQLGKLLSSDDL 232



 Score = 47.2 bits (107), Expect = 3e-05
 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 1/80 (1%)
 Frame = +3

Query: 255 CDAIVRAD-DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXX 431
           CD ++ A  DG   P HR +LSA S YF A+FT +L   ++ +V +  V           
Sbjct: 75  CDVVLIAGIDGKRVPAHRLVLSASSAYFSAMFTGSLRETKEQEVTLGEVHGDALHLLVQY 134

Query: 432 XXXXXIDVTDTNVHELLMTA 491
                I++ +  V  LL TA
Sbjct: 135 CYTGFIEMREDTVETLLATA 154


>AE014298-1315|AAN09250.2|  654|Drosophila melanogaster CG17754-PA,
           isoform A protein.
          Length = 654

 Score = 55.2 bits (127), Expect = 1e-07
 Identities = 28/78 (35%), Positives = 41/78 (52%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +   V+  CC+ L   L+P NCLG   FA +  C  L   A+ Y  +YF+ V  Q+ E
Sbjct: 156 LLQLNAVVTACCNFLARQLHPSNCLGFAFFAEQQSCTTLLRLAQAYTCQYFMQVC-QNQE 214

Query: 674 FLHLPLDELNSIILEDEL 727
           F  L  D+L  ++  D+L
Sbjct: 215 FFQLNADQLGKLLSSDDL 232



 Score = 47.2 bits (107), Expect = 3e-05
 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 1/80 (1%)
 Frame = +3

Query: 255 CDAIVRAD-DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXX 431
           CD ++ A  DG   P HR +LSA S YF A+FT +L   ++ +V +  V           
Sbjct: 75  CDVVLIAGIDGKRVPAHRLVLSASSAYFSAMFTGSLRETKEQEVTLGEVHGDALHLLVQY 134

Query: 432 XXXXXIDVTDTNVHELLMTA 491
                I++ +  V  LL TA
Sbjct: 135 CYTGFIEMREDTVETLLATA 154


>BT010272-1|AAQ23590.1|  623|Drosophila melanogaster RE13447p
           protein.
          Length = 623

 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 29/72 (40%), Positives = 41/72 (56%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           +  +CC+ L+  L+P NCLGI  FA    C +L   A ++    F  V  +S+EFL LP+
Sbjct: 157 IQDICCEFLKRQLDPTNCLGIRAFADTHSCRELLRIADKFTQHNFQEV-MESEEFLLLPV 215

Query: 692 DELNSIILEDEL 727
            +L  II  DEL
Sbjct: 216 GQLVDIICSDEL 227



 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 29/86 (33%), Positives = 38/86 (44%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++    G     HR ILSACS YF A+FT  L    Q++V I  +            
Sbjct: 72  CDVVLNVG-GRKIFAHRVILSACSSYFCAMFTGELEESRQTEVTIRDIDENAMELLIDFC 130

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I V ++NV  LL  A  L  +E
Sbjct: 131 YTAHIIVEESNVQTLLPAACLLQLVE 156


>AF237711-1|AAF43447.1|  623|Drosophila melanogaster Diablo protein.
          Length = 623

 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 29/72 (40%), Positives = 41/72 (56%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           +  +CC+ L+  L+P NCLGI  FA    C +L   A ++    F  V  +S+EFL LP+
Sbjct: 157 IQDICCEFLKRQLDPTNCLGIRAFADTHSCRELLRIADKFTQHNFQEV-MESEEFLLLPV 215

Query: 692 DELNSIILEDEL 727
            +L  II  DEL
Sbjct: 216 GQLVDIICSDEL 227



 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 29/86 (33%), Positives = 38/86 (44%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++    G     HR ILSACS YF A+FT  L    Q++V I  +            
Sbjct: 72  CDVVLNVG-GRKIFAHRVILSACSSYFCAMFTGELEESRQTEVTIRDIDENAMELLIDFC 130

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I V ++NV  LL  A  L  +E
Sbjct: 131 YTAHIIVEESNVQTLLPAACLLQLVE 156


>AE014296-2581|AAF49578.1|  623|Drosophila melanogaster CG6224-PA
           protein.
          Length = 623

 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 29/72 (40%), Positives = 41/72 (56%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           +  +CC+ L+  L+P NCLGI  FA    C +L   A ++    F  V  +S+EFL LP+
Sbjct: 157 IQDICCEFLKRQLDPTNCLGIRAFADTHSCRELLRIADKFTQHNFQEV-MESEEFLLLPV 215

Query: 692 DELNSIILEDEL 727
            +L  II  DEL
Sbjct: 216 GQLVDIICSDEL 227



 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 29/86 (33%), Positives = 38/86 (44%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++    G     HR ILSACS YF A+FT  L    Q++V I  +            
Sbjct: 72  CDVVLNVG-GRKIFAHRVILSACSSYFCAMFTGELEESRQTEVTIRDIDENAMELLIDFC 130

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I V ++NV  LL  A  L  +E
Sbjct: 131 YTAHIIVEESNVQTLLPAACLLQLVE 156


>AB027612-1|BAD06413.1|  623|Drosophila melanogaster kelch-like
           protein protein.
          Length = 623

 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 29/72 (40%), Positives = 41/72 (56%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           +  +CC+ L+  L+P NCLGI  FA    C +L   A ++    F  V  +S+EFL LP+
Sbjct: 157 IQDICCEFLKRQLDPTNCLGIRAFADTHSCRELLRIADKFTQHNFQEV-MESEEFLLLPV 215

Query: 692 DELNSIILEDEL 727
            +L  II  DEL
Sbjct: 216 GQLVDIICSDEL 227



 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 29/86 (33%), Positives = 38/86 (44%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++    G     HR ILSACS YF A+FT  L    Q++V I  +            
Sbjct: 72  CDVVLNVG-GRKIFAHRVILSACSSYFCAMFTGELEESRQTEVTIRDIDENAMELLIDFC 130

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I V ++NV  LL  A  L  +E
Sbjct: 131 YTAHIIVEESNVQTLLPAACLLQLVE 156


>BT001347-1|AAN71102.1|  620|Drosophila melanogaster AT24465p
           protein.
          Length = 620

 Score = 54.0 bits (124), Expect = 3e-07
 Identities = 29/80 (36%), Positives = 42/80 (52%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           S L +   V   CC  L   L+P NCLGI +FA    C +L   + +Y L+ F  V   +
Sbjct: 152 SGLLQMHSVRDACCKFLLRQLHPSNCLGIRSFADAHSCKELHTRSHKYALQNFQQV-VGT 210

Query: 668 DEFLHLPLDELNSIILEDEL 727
           +EFL LP +E+  +I   +L
Sbjct: 211 EEFLLLPFEEVRELISNSQL 230



 Score = 38.3 bits (85), Expect = 0.014
 Identities = 24/82 (29%), Positives = 35/82 (42%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  +    G +   HR +L++ SPYF A+F   +  R Q  V +  V S          
Sbjct: 75  CDVRLEVG-GDTINAHRVVLASVSPYFYAMFNDDMLERTQGLVRLHDVDSSALRQLIDYT 133

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I +T+ NV  LL  +  L
Sbjct: 134 YTGEITITEQNVQVLLPASGLL 155


>AY060733-1|AAL28281.1|  513|Drosophila melanogaster GH18278p
           protein.
          Length = 513

 Score = 54.0 bits (124), Expect = 3e-07
 Identities = 29/80 (36%), Positives = 42/80 (52%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           S L +   V   CC  L   L+P NCLGI +FA    C +L   + +Y L+ F  V   +
Sbjct: 45  SGLLQMHSVRDACCKFLLRQLHPSNCLGIRSFADAHSCKELHTRSHKYALQNFQQV-VGT 103

Query: 668 DEFLHLPLDELNSIILEDEL 727
           +EFL LP +E+  +I   +L
Sbjct: 104 EEFLLLPFEEVRELISNSQL 123


>AE013599-2779|AAF57630.2|  513|Drosophila melanogaster CG15097-PA,
           isoform A protein.
          Length = 513

 Score = 54.0 bits (124), Expect = 3e-07
 Identities = 29/80 (36%), Positives = 42/80 (52%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           S L +   V   CC  L   L+P NCLGI +FA    C +L   + +Y L+ F  V   +
Sbjct: 45  SGLLQMHSVRDACCKFLLRQLHPSNCLGIRSFADAHSCKELHTRSHKYALQNFQQV-VGT 103

Query: 668 DEFLHLPLDELNSIILEDEL 727
           +EFL LP +E+  +I   +L
Sbjct: 104 EEFLLLPFEEVRELISNSQL 123


>AE013599-2778|AAO41354.1|  617|Drosophila melanogaster CG15097-PB,
           isoform B protein.
          Length = 617

 Score = 54.0 bits (124), Expect = 3e-07
 Identities = 29/80 (36%), Positives = 42/80 (52%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           S L +   V   CC  L   L+P NCLGI +FA    C +L   + +Y L+ F  V   +
Sbjct: 149 SGLLQMHSVRDACCKFLLRQLHPSNCLGIRSFADAHSCKELHTRSHKYALQNFQQV-VGT 207

Query: 668 DEFLHLPLDELNSIILEDEL 727
           +EFL LP +E+  +I   +L
Sbjct: 208 EEFLLLPFEEVRELISNSQL 227



 Score = 38.3 bits (85), Expect = 0.014
 Identities = 24/82 (29%), Positives = 35/82 (42%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  +    G +   HR +L++ SPYF A+F   +  R Q  V +  V S          
Sbjct: 72  CDVRLEVG-GDTINAHRVVLASVSPYFYAMFNDDMLERTQGLVRLHDVDSSALRQLIDYT 130

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I +T+ NV  LL  +  L
Sbjct: 131 YTGEITITEQNVQVLLPASGLL 152


>L08483-2|AAA53471.1|  689|Drosophila melanogaster ring canal
           protein protein.
          Length = 689

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 36/124 (29%), Positives = 57/124 (45%), Gaps = 2/124 (1%)
 Frame = +3

Query: 135 NAQRNGKRPK*QSDGGSGNRS--VHVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRA 308
           ++Q++ +RP  +  G  G  S   H   S        +    CD I+ ADD      HR 
Sbjct: 115 SSQKHVQRPNGKERGTVGQYSNEQHTARSFDAMNEMRKQKQLCDVILVADD-VEIHAHRM 173

Query: 309 ILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHELLMT 488
           +L++CSPYF A+FT+   SR Q+ + +  V +              ++V + NV  LL  
Sbjct: 174 VLASCSPYFYAMFTSFEESR-QARITLQSVDARALELLIDYVYTATVEVNEDNVQVLLTA 232

Query: 489 ADYL 500
           A+ L
Sbjct: 233 ANLL 236



 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 29/80 (36%), Positives = 44/80 (55%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           + L +   V   CCD L++ L+  NCLGI  FA    C +L   A  Y+ ++F  V  Q 
Sbjct: 233 ANLLQLTDVRDACCDFLQTQLDASNCLGIREFADIHACVELLNYAETYIEQHFNEV-IQF 291

Query: 668 DEFLHLPLDELNSIILEDEL 727
           DEFL+L  +++ S+I  D +
Sbjct: 292 DEFLNLSHEQVISLIGNDRI 311


>L08483-1|AAA53472.2| 1477|Drosophila melanogaster ring canal
           protein protein.
          Length = 1477

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 36/124 (29%), Positives = 57/124 (45%), Gaps = 2/124 (1%)
 Frame = +3

Query: 135 NAQRNGKRPK*QSDGGSGNRS--VHVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRA 308
           ++Q++ +RP  +  G  G  S   H   S        +    CD I+ ADD      HR 
Sbjct: 115 SSQKHVQRPNGKERGTVGQYSNEQHTARSFDAMNEMRKQKQLCDVILVADD-VEIHAHRM 173

Query: 309 ILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHELLMT 488
           +L++CSPYF A+FT+   SR Q+ + +  V +              ++V + NV  LL  
Sbjct: 174 VLASCSPYFYAMFTSFEESR-QARITLQSVDARALELLIDYVYTATVEVNEDNVQVLLTA 232

Query: 489 ADYL 500
           A+ L
Sbjct: 233 ANLL 236



 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 29/80 (36%), Positives = 44/80 (55%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           + L +   V   CCD L++ L+  NCLGI  FA    C +L   A  Y+ ++F  V  Q 
Sbjct: 233 ANLLQLTDVRDACCDFLQTQLDASNCLGIREFADIHACVELLNYAETYIEQHFNEV-IQF 291

Query: 668 DEFLHLPLDELNSIILEDEL 727
           DEFL+L  +++ S+I  D +
Sbjct: 292 DEFLNLSHEQVISLIGNDRI 311


>AE014134-2910|AAF53651.1|  689|Drosophila melanogaster CG7210-PA,
           isoform A protein.
          Length = 689

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 36/124 (29%), Positives = 57/124 (45%), Gaps = 2/124 (1%)
 Frame = +3

Query: 135 NAQRNGKRPK*QSDGGSGNRS--VHVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRA 308
           ++Q++ +RP  +  G  G  S   H   S        +    CD I+ ADD      HR 
Sbjct: 115 SSQKHVQRPNGKERGTVGQYSNEQHTARSFDAMNEMRKQKQLCDVILVADD-VEIHAHRM 173

Query: 309 ILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHELLMT 488
           +L++CSPYF A+FT+   SR Q+ + +  V +              ++V + NV  LL  
Sbjct: 174 VLASCSPYFYAMFTSFEESR-QARITLQSVDARALELLIDYVYTATVEVNEDNVQVLLTA 232

Query: 489 ADYL 500
           A+ L
Sbjct: 233 ANLL 236



 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 29/80 (36%), Positives = 44/80 (55%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           + L +   V   CCD L++ L+  NCLGI  FA    C +L   A  Y+ ++F  V  Q 
Sbjct: 233 ANLLQLTDVRDACCDFLQTQLDASNCLGIREFADIHACVELLNYAETYIEQHFNEV-IQF 291

Query: 668 DEFLHLPLDELNSIILEDEL 727
           DEFL+L  +++ S+I  D +
Sbjct: 292 DEFLNLSHEQVISLIGNDRI 311


>AE014134-2909|AAN11182.3| 1477|Drosophila melanogaster CG7210-PB,
           isoform B protein.
          Length = 1477

 Score = 53.6 bits (123), Expect = 3e-07
 Identities = 36/124 (29%), Positives = 57/124 (45%), Gaps = 2/124 (1%)
 Frame = +3

Query: 135 NAQRNGKRPK*QSDGGSGNRS--VHVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRA 308
           ++Q++ +RP  +  G  G  S   H   S        +    CD I+ ADD      HR 
Sbjct: 115 SSQKHVQRPNGKERGTVGQYSNEQHTARSFDAMNEMRKQKQLCDVILVADD-VEIHAHRM 173

Query: 309 ILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHELLMT 488
           +L++CSPYF A+FT+   SR Q+ + +  V +              ++V + NV  LL  
Sbjct: 174 VLASCSPYFYAMFTSFEESR-QARITLQSVDARALELLIDYVYTATVEVNEDNVQVLLTA 232

Query: 489 ADYL 500
           A+ L
Sbjct: 233 ANLL 236



 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 29/80 (36%), Positives = 44/80 (55%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           + L +   V   CCD L++ L+  NCLGI  FA    C +L   A  Y+ ++F  V  Q 
Sbjct: 233 ANLLQLTDVRDACCDFLQTQLDASNCLGIREFADIHACVELLNYAETYIEQHFNEV-IQF 291

Query: 668 DEFLHLPLDELNSIILEDEL 727
           DEFL+L  +++ S+I  D +
Sbjct: 292 DEFLNLSHEQVISLIGNDRI 311


>DQ372684-1|ABD14408.1|  776|Drosophila melanogaster KEAP1 protein.
          Length = 776

 Score = 53.2 bits (122), Expect = 5e-07
 Identities = 28/74 (37%), Positives = 40/74 (54%)
 Frame = +2

Query: 506 PGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHL 685
           P V+  CC  L   L+P N +GI  FA +  C +L+  A  ++ R F  V  Q +EFL L
Sbjct: 173 PNVIDACCAFLERQLDPTNAIGIAHFAEQHGCVELQKKANVFIERNFTQVC-QEEEFLQL 231

Query: 686 PLDELNSIILEDEL 727
              +L ++I  DEL
Sbjct: 232 SAYQLIALIRRDEL 245



 Score = 46.0 bits (104), Expect = 7e-05
 Identities = 26/67 (38%), Positives = 32/67 (47%)
 Frame = +3

Query: 291 FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNV 470
           FP H+ +LSA SPYF A+FT  L   E S V + GV                I VT+  V
Sbjct: 101 FPAHKVVLSAASPYFKAMFTGGLKESEMSRVQLQGVCPTAMSRILYFMYTGQIRVTEVTV 160

Query: 471 HELLMTA 491
            +LL  A
Sbjct: 161 CQLLPAA 167


>BT001720-1|AAN71475.1|  608|Drosophila melanogaster RE68961p
           protein.
          Length = 608

 Score = 53.2 bits (122), Expect = 5e-07
 Identities = 28/74 (37%), Positives = 40/74 (54%)
 Frame = +2

Query: 506 PGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHL 685
           P V+  CC  L   L+P N +GI  FA +  C +L+  A  ++ R F  V  Q +EFL L
Sbjct: 5   PNVIDACCAFLERQLDPTNAIGIAHFAEQHGCVELQKKANVFIERNFTQVC-QEEEFLQL 63

Query: 686 PLDELNSIILEDEL 727
              +L ++I  DEL
Sbjct: 64  SAYQLIALIRRDEL 77


>AE014297-2308|AAO41571.1|  744|Drosophila melanogaster CG3962-PC,
           isoform C protein.
          Length = 744

 Score = 53.2 bits (122), Expect = 5e-07
 Identities = 28/74 (37%), Positives = 40/74 (54%)
 Frame = +2

Query: 506 PGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHL 685
           P V+  CC  L   L+P N +GI  FA +  C +L+  A  ++ R F  V  Q +EFL L
Sbjct: 141 PNVIDACCAFLERQLDPTNAIGIAHFAEQHGCVELQKKANVFIERNFTQVC-QEEEFLQL 199

Query: 686 PLDELNSIILEDEL 727
              +L ++I  DEL
Sbjct: 200 SAYQLIALIRRDEL 213



 Score = 46.0 bits (104), Expect = 7e-05
 Identities = 26/67 (38%), Positives = 32/67 (47%)
 Frame = +3

Query: 291 FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNV 470
           FP H+ +LSA SPYF A+FT  L   E S V + GV                I VT+  V
Sbjct: 69  FPAHKVVLSAASPYFKAMFTGGLKESEMSRVQLQGVCPTAMSRILYFMYTGQIRVTEVTV 128

Query: 471 HELLMTA 491
            +LL  A
Sbjct: 129 CQLLPAA 135


>AE014297-2307|AAF55386.1|  744|Drosophila melanogaster CG3962-PA,
           isoform A protein.
          Length = 744

 Score = 53.2 bits (122), Expect = 5e-07
 Identities = 28/74 (37%), Positives = 40/74 (54%)
 Frame = +2

Query: 506 PGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHL 685
           P V+  CC  L   L+P N +GI  FA +  C +L+  A  ++ R F  V  Q +EFL L
Sbjct: 141 PNVIDACCAFLERQLDPTNAIGIAHFAEQHGCVELQKKANVFIERNFTQVC-QEEEFLQL 199

Query: 686 PLDELNSIILEDEL 727
              +L ++I  DEL
Sbjct: 200 SAYQLIALIRRDEL 213



 Score = 46.0 bits (104), Expect = 7e-05
 Identities = 26/67 (38%), Positives = 32/67 (47%)
 Frame = +3

Query: 291 FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNV 470
           FP H+ +LSA SPYF A+FT  L   E S V + GV                I VT+  V
Sbjct: 69  FPAHKVVLSAASPYFKAMFTGGLKESEMSRVQLQGVCPTAMSRILYFMYTGQIRVTEVTV 128

Query: 471 HELLMTA 491
            +LL  A
Sbjct: 129 CQLLPAA 135


>AE014297-2306|AAN13732.2|  776|Drosophila melanogaster CG3962-PB,
           isoform B protein.
          Length = 776

 Score = 53.2 bits (122), Expect = 5e-07
 Identities = 28/74 (37%), Positives = 40/74 (54%)
 Frame = +2

Query: 506 PGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHL 685
           P V+  CC  L   L+P N +GI  FA +  C +L+  A  ++ R F  V  Q +EFL L
Sbjct: 173 PNVIDACCAFLERQLDPTNAIGIAHFAEQHGCVELQKKANVFIERNFTQVC-QEEEFLQL 231

Query: 686 PLDELNSIILEDEL 727
              +L ++I  DEL
Sbjct: 232 SAYQLIALIRRDEL 245



 Score = 46.0 bits (104), Expect = 7e-05
 Identities = 26/67 (38%), Positives = 32/67 (47%)
 Frame = +3

Query: 291 FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNV 470
           FP H+ +LSA SPYF A+FT  L   E S V + GV                I VT+  V
Sbjct: 101 FPAHKVVLSAASPYFKAMFTGGLKESEMSRVQLQGVCPTAMSRILYFMYTGQIRVTEVTV 160

Query: 471 HELLMTA 491
            +LL  A
Sbjct: 161 CQLLPAA 167


>BT015287-1|AAT94516.1|  538|Drosophila melanogaster GH14381p
           protein.
          Length = 538

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 28/72 (38%), Positives = 40/72 (55%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   C   L S  +P N LGI TFA  + C +L   A +Y+ + F  V +QS+EFL L  
Sbjct: 89  VRDACASFLISRFHPHNVLGIRTFADSMICRQLIDAADKYIDQNFAKV-SQSEEFLALDC 147

Query: 692 DELNSIILEDEL 727
           ++L  ++  DEL
Sbjct: 148 EQLLELMRRDEL 159



 Score = 33.9 bits (74), Expect = 0.30
 Identities = 23/93 (24%), Positives = 39/93 (41%), Gaps = 6/93 (6%)
 Frame = +3

Query: 288 SFPVHRAILSACSPYFLALFTTTLHSREQSDVLI--SGVRSXXXXXXXXXXXXXXIDVTD 461
           +F  HR +L+A  PYF A+FT  +      ++ +  S +                + + +
Sbjct: 12  TFSAHRVVLAATIPYFYAMFTNNMAESRIKEITMKESAIEPSALESLINYVYSGQVRIDN 71

Query: 462 TNVHELLMTADYLAFLE----CFSFVAIISEVH 548
            NV  L++ A +L        C SF  +IS  H
Sbjct: 72  QNVQNLMVGASFLQLSNVRDACASF--LISRFH 102


>AY051950-1|AAK93374.1|  575|Drosophila melanogaster LD42169p
           protein.
          Length = 575

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 28/72 (38%), Positives = 40/72 (55%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   C   L S  +P N LGI TFA  + C +L   A +Y+ + F  V +QS+EFL L  
Sbjct: 126 VRDACASFLISRFHPHNVLGIRTFADSMICRQLIDAADKYIDQNFAKV-SQSEEFLALDC 184

Query: 692 DELNSIILEDEL 727
           ++L  ++  DEL
Sbjct: 185 EQLLELMRRDEL 196



 Score = 41.1 bits (92), Expect = 0.002
 Identities = 27/109 (24%), Positives = 47/109 (43%), Gaps = 6/109 (5%)
 Frame = +3

Query: 240 RVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLI--SGVRSXXX 413
           R+   CD  ++ +D  +F  HR +L+A  PYF A+FT  +      ++ +  S +     
Sbjct: 34  RMGKLCDVTLKVED-QTFSAHRVVLAATIPYFYAMFTNNMAESRIKEITMKESAIEPSAL 92

Query: 414 XXXXXXXXXXXIDVTDTNVHELLMTADYLAFLE----CFSFVAIISEVH 548
                      + + + NV  L++ A +L        C SF  +IS  H
Sbjct: 93  ESLINYVYSGQVRIDNQNVQNLMVGASFLQLSNVRDACASF--LISRFH 139


>AE014297-1440|AAF54738.1|  538|Drosophila melanogaster CG3571-PB,
           isoform B protein.
          Length = 538

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 28/72 (38%), Positives = 40/72 (55%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   C   L S  +P N LGI TFA  + C +L   A +Y+ + F  V +QS+EFL L  
Sbjct: 89  VRDACASFLISRFHPHNVLGIRTFADSMICRQLIDAADKYIDQNFAKV-SQSEEFLALDC 147

Query: 692 DELNSIILEDEL 727
           ++L  ++  DEL
Sbjct: 148 EQLLELMRRDEL 159



 Score = 33.9 bits (74), Expect = 0.30
 Identities = 23/93 (24%), Positives = 39/93 (41%), Gaps = 6/93 (6%)
 Frame = +3

Query: 288 SFPVHRAILSACSPYFLALFTTTLHSREQSDVLI--SGVRSXXXXXXXXXXXXXXIDVTD 461
           +F  HR +L+A  PYF A+FT  +      ++ +  S +                + + +
Sbjct: 12  TFSAHRVVLAATIPYFYAMFTNNMAESRIKEITMKESAIEPSALESLINYVYSGQVRIDN 71

Query: 462 TNVHELLMTADYLAFLE----CFSFVAIISEVH 548
            NV  L++ A +L        C SF  +IS  H
Sbjct: 72  QNVQNLMVGASFLQLSNVRDACASF--LISRFH 102


>AE014297-1439|AAF54737.1|  575|Drosophila melanogaster CG3571-PA,
           isoform A protein.
          Length = 575

 Score = 48.4 bits (110), Expect = 1e-05
 Identities = 28/72 (38%), Positives = 40/72 (55%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   C   L S  +P N LGI TFA  + C +L   A +Y+ + F  V +QS+EFL L  
Sbjct: 126 VRDACASFLISRFHPHNVLGIRTFADSMICRQLIDAADKYIDQNFAKV-SQSEEFLALDC 184

Query: 692 DELNSIILEDEL 727
           ++L  ++  DEL
Sbjct: 185 EQLLELMRRDEL 196



 Score = 41.1 bits (92), Expect = 0.002
 Identities = 27/109 (24%), Positives = 47/109 (43%), Gaps = 6/109 (5%)
 Frame = +3

Query: 240 RVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLI--SGVRSXXX 413
           R+   CD  ++ +D  +F  HR +L+A  PYF A+FT  +      ++ +  S +     
Sbjct: 34  RMGKLCDVTLKVED-QTFSAHRVVLAATIPYFYAMFTNNMAESRIKEITMKESAIEPSAL 92

Query: 414 XXXXXXXXXXXIDVTDTNVHELLMTADYLAFLE----CFSFVAIISEVH 548
                      + + + NV  L++ A +L        C SF  +IS  H
Sbjct: 93  ESLINYVYSGQVRIDNQNVQNLMVGASFLQLSNVRDACASF--LISRFH 139


>AY118728-1|AAM50588.1|  627|Drosophila melanogaster GH03286p
           protein.
          Length = 627

 Score = 41.9 bits (94), Expect = 0.001
 Identities = 30/91 (32%), Positives = 40/91 (43%), Gaps = 2/91 (2%)
 Frame = +3

Query: 246 SSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSRE--QSDVLISGVRSXXXXX 419
           S  CD  + A   A+   HRA+LSA S YF A+F   L   E  Q  V++  +       
Sbjct: 80  SRFCDVEIIAGM-ATLSAHRAVLSAASAYFEAMFRPELGLNEVKQKSVVLHTIDGDILHI 138

Query: 420 XXXXXXXXXIDVTDTNVHELLMTADYLAFLE 512
                     ++T +NV ELL  AD L   E
Sbjct: 139 LLDFIYTGRCEITQSNVQELLAAADMLQLNE 169



 Score = 41.1 bits (92), Expect = 0.002
 Identities = 28/74 (37%), Positives = 35/74 (47%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+  CC+ L   L+  N LGI+ FA    C  L   A  ++   F  V T  DEFL  P 
Sbjct: 170 VVDGCCEFLCRELHASNALGILRFAEAHNCESLAKSALNFVHANFPAV-TLEDEFLETP- 227

Query: 692 DELNSIILEDELKR 733
             L S +L  EL R
Sbjct: 228 QTLLSQLLNSELLR 241


>AE014134-2301|AAF53261.1|  627|Drosophila melanogaster CG9426-PA
           protein.
          Length = 627

 Score = 41.9 bits (94), Expect = 0.001
 Identities = 30/91 (32%), Positives = 40/91 (43%), Gaps = 2/91 (2%)
 Frame = +3

Query: 246 SSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSRE--QSDVLISGVRSXXXXX 419
           S  CD  + A   A+   HRA+LSA S YF A+F   L   E  Q  V++  +       
Sbjct: 80  SRFCDVEIIAGM-ATLSAHRAVLSAASAYFEAMFRPELGLNEVKQKSVVLHTIDGDILHI 138

Query: 420 XXXXXXXXXIDVTDTNVHELLMTADYLAFLE 512
                     ++T +NV ELL  AD L   E
Sbjct: 139 LLDFIYTGRCEITQSNVQELLAAADMLQLNE 169



 Score = 41.1 bits (92), Expect = 0.002
 Identities = 28/74 (37%), Positives = 35/74 (47%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+  CC+ L   L+  N LGI+ FA    C  L   A  ++   F  V T  DEFL  P 
Sbjct: 170 VVDGCCEFLCRELHASNALGILRFAEAHNCESLAKSALNFVHANFPAV-TLEDEFLETP- 227

Query: 692 DELNSIILEDELKR 733
             L S +L  EL R
Sbjct: 228 QTLLSQLLNSELLR 241


>U14404-1|AAA50839.1|  115|Drosophila melanogaster BTB-VII protein
           domain protein.
          Length = 115

 Score = 37.9 bits (84), Expect = 0.018
 Identities = 22/79 (27%), Positives = 37/79 (46%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +  A +G     H+ +LSACS YF ALFTT  +  +   V++  V+              
Sbjct: 30  VTLAAEGRQLQAHKIVLSACSSYFQALFTT--NPCQHPIVILKDVQYDDLKTMVDFMYYG 87

Query: 444 XIDVTDTNVHELLMTADYL 500
            ++V+   +  +L TA+ L
Sbjct: 88  EVNVSQEQLPHILKTAEML 106


>AY051895-1|AAK93319.1|  743|Drosophila melanogaster LD38452p
           protein.
          Length = 743

 Score = 37.9 bits (84), Expect = 0.018
 Identities = 22/79 (27%), Positives = 37/79 (46%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +  A +G     H+ +LSACS YF ALFTT  +  +   V++  V+              
Sbjct: 33  VTLAAEGRQLQAHKIVLSACSSYFQALFTT--NPCQHPIVILKDVQYDDLKTMVDFMYYG 90

Query: 444 XIDVTDTNVHELLMTADYL 500
            ++V+   +  +L TA+ L
Sbjct: 91  EVNVSQEQLPHILKTAEML 109


>AE014296-570|AAN11533.1|  743|Drosophila melanogaster CG11494-PB,
           isoform B protein.
          Length = 743

 Score = 37.9 bits (84), Expect = 0.018
 Identities = 22/79 (27%), Positives = 37/79 (46%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +  A +G     H+ +LSACS YF ALFTT  +  +   V++  V+              
Sbjct: 33  VTLAAEGRQLQAHKIVLSACSSYFQALFTT--NPCQHPIVILKDVQYDDLKTMVDFMYYG 90

Query: 444 XIDVTDTNVHELLMTADYL 500
            ++V+   +  +L TA+ L
Sbjct: 91  EVNVSQEQLPHILKTAEML 109


>AE014296-569|AAF47721.2|  743|Drosophila melanogaster CG11494-PA,
           isoform A protein.
          Length = 743

 Score = 37.9 bits (84), Expect = 0.018
 Identities = 22/79 (27%), Positives = 37/79 (46%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +  A +G     H+ +LSACS YF ALFTT  +  +   V++  V+              
Sbjct: 33  VTLAAEGRQLQAHKIVLSACSSYFQALFTT--NPCQHPIVILKDVQYDDLKTMVDFMYYG 90

Query: 444 XIDVTDTNVHELLMTADYL 500
            ++V+   +  +L TA+ L
Sbjct: 91  EVNVSQEQLPHILKTAEML 109


>AB235207-1|BAF31332.1| 1089|Drosophila melanogaster CG32611
           protein.
          Length = 1089

 Score = 36.7 bits (81), Expect = 0.042
 Identities = 24/84 (28%), Positives = 35/84 (41%)
 Frame = +3

Query: 249 SACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXX 428
           S  D  +   +G S   H+ +LSACS YF +LF    H      V++  VR         
Sbjct: 29  SLVDVTLVCSEGTSIRAHKVVLSACSSYFQSLFLE--HPEGHLIVILKDVRFAELQTLVE 86

Query: 429 XXXXXXIDVTDTNVHELLMTADYL 500
                 ++V    +  LL TA+ L
Sbjct: 87  FMYKGEVNVQYCQLSALLKTAESL 110


>X54666-1|CAA38477.1|  728|Drosophila melanogaster BRcore-TNT1-Q1-Z1
           protein.
          Length = 728

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGRSIKAHRVVLSACSPYFRELLKST 64


>X54665-1|CAA38476.1|  514|Drosophila melanogaster BRcore-Z2
           protein.
          Length = 514

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGRSIKAHRVVLSACSPYFRELLKST 64


>X54664-1|CAA38475.1|  704|Drosophila melanogaster BRcore-NS-Z3
           protein.
          Length = 704

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGRSIKAHRVVLSACSPYFRELLKST 64


>X54663-1|CAA38474.1|  663|Drosophila melanogaster BRcore-Q1-Z1
           protein.
          Length = 663

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGRSIKAHRVVLSACSPYFRELLKST 64


>U72492-1|AAB92662.1|  675|Drosophila melanogaster fruitless class I
           female isoform protein.
          Length = 675

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 30  CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 64


>U51585-1|AAB09760.1|  877|Drosophila melanogaster Broad-Complex
           protein isoform Z4 protein.
          Length = 877

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGRSIKAHRVVLSACSPYFRELLKST 64


>U43733-1|AAA86639.1|  904|Drosophila melanogaster Abrupt protein.
          Length = 904

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 23/79 (29%), Positives = 34/79 (43%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +  A D  SF  H+ +LSACSPYF  L     +  E   V++  VR              
Sbjct: 105 VTLACDERSFTAHKVVLSACSPYFRRLLKA--NPCEHPIVILRDVRCDDVENLLSFMYNG 162

Query: 444 XIDVTDTNVHELLMTADYL 500
            ++V+   + + L TA  L
Sbjct: 163 EVNVSHEQLPDFLKTAHLL 181


>U14403-1|AAA50838.1|  115|Drosophila melanogaster BTB-VI protein
           domain protein.
          Length = 115

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 28  CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 62


>U01333-1|AAA87052.1|  127|Drosophila melanogaster BTB domain
           protein.
          Length = 127

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A DG S   H+ +LSACSPYF  L   T
Sbjct: 31  VTLACDGRSMKAHKMVLSACSPYFQTLLAET 61


>D84437-1|BAA12663.1|  855|Drosophila melanogaster fruitless protein
           protein.
          Length = 855

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 30  CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 64


>BT024450-1|ABC86512.1|  960|Drosophila melanogaster GH19932p
           protein.
          Length = 960

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 136 CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 170


>BT001583-1|AAN71338.1|  894|Drosophila melanogaster RE25924p
           protein.
          Length = 894

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 23/79 (29%), Positives = 34/79 (43%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +  A D  SF  H+ +LSACSPYF  L     +  E   V++  VR              
Sbjct: 105 VTLACDERSFTAHKVVLSACSPYFRRLLKA--NPCEHPIVILRDVRCDDVENLLSFMYNG 162

Query: 444 XIDVTDTNVHELLMTADYL 500
            ++V+   + + L TA  L
Sbjct: 163 EVNVSHEQLPDFLKTAHLL 181


>AY152838-1|AAN74533.1|  161|Drosophila melanogaster transcription
           factor fruitless protein.
          Length = 161

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 82  CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 116


>AY152837-1|AAN74532.1|  109|Drosophila melanogaster transcription
           factor fruitless protein.
          Length = 109

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 30  CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 64


>AY122075-1|AAM52587.1|  503|Drosophila melanogaster AT17506p
           protein.
          Length = 503

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A DG S   H+ +LSACSPYF  L   T
Sbjct: 106 VTLACDGRSMKAHKMVLSACSPYFQTLLAET 136


>AY069756-1|AAL39901.1|  880|Drosophila melanogaster LP12157p
           protein.
          Length = 880

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGRSIKAHRVVLSACSPYFRELLKST 64


>AL009146-4|CAA15629.1|  710|Drosophila melanogaster
           EG:17A9.1,FBgn0000210;br protein.
          Length = 710

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGRSIKAHRVVLSACSPYFRELLKST 64


>AL009146-3|CAA15628.1|  702|Drosophila melanogaster
           EG:17A9.1,FBgn0000210;br protein.
          Length = 702

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGRSIKAHRVVLSACSPYFRELLKST 64


>AL009146-2|CAA15627.1|  880|Drosophila melanogaster
           EG:17A9.1,FBgn0000210;br protein.
          Length = 880

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGRSIKAHRVVLSACSPYFRELLKST 64


>AL009146-1|CAA15626.1|  514|Drosophila melanogaster
           EG:17A9.1,FBgn0000210;br protein.
          Length = 514

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGRSIKAHRVVLSACSPYFRELLKST 64


>AJ252082-1|CAB64385.1|  979|Drosophila melanogaster BAB-I protein
           protein.
          Length = 979

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A DG S   H+ +LSACSPYF  L   T
Sbjct: 129 VTLACDGRSMKAHKMVLSACSPYFQTLLAET 159


>AF220177-1|AAG28588.1|  956|Drosophila melanogaster fruitless
           type-A protein.
          Length = 956

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 131 CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 165


>AF220176-1|AAG28587.1|  855|Drosophila melanogaster fruitless
           type-A protein.
          Length = 855

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 30  CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 64


>AF039231-1|AAB96677.1|  776|Drosophila melanogaster fruitless class
           I male isoform protein.
          Length = 776

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 131 CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 165


>AE014298-238|AAN09054.1|  663|Drosophila melanogaster CG11491-PG,
           isoform G protein.
          Length = 663

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGRSIKAHRVVLSACSPYFRELLKST 64


>AE014298-237|AAF45648.1|  724|Drosophila melanogaster CG11491-PE,
           isoform E protein.
          Length = 724

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGRSIKAHRVVLSACSPYFRELLKST 64


>AE014298-236|AAN09053.1|  880|Drosophila melanogaster CG11491-PC,
           isoform C protein.
          Length = 880

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGRSIKAHRVVLSACSPYFRELLKST 64


>AE014298-235|AAF45647.1|  880|Drosophila melanogaster CG11491-PB,
           isoform B protein.
          Length = 880

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGRSIKAHRVVLSACSPYFRELLKST 64


>AE014298-234|AAF45650.2|  628|Drosophila melanogaster CG11491-PD,
           isoform D protein.
          Length = 628

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGRSIKAHRVVLSACSPYFRELLKST 64


>AE014298-233|AAF45651.2|  702|Drosophila melanogaster CG11491-PA,
           isoform A protein.
          Length = 702

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGRSIKAHRVVLSACSPYFRELLKST 64


>AE014298-232|AAN09052.1|  502|Drosophila melanogaster CG11491-PF,
           isoform F protein.
          Length = 502

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A +G S   HR +LSACSPYF  L  +T
Sbjct: 34  VTLACEGRSIKAHRVVLSACSPYFRELLKST 64


>AE014297-2540|AAN13777.1|  665|Drosophila melanogaster CG14307-PD,
           isoform D protein.
          Length = 665

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 30  CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 64


>AE014297-2539|AAF55564.2|  516|Drosophila melanogaster CG14307-PA,
           isoform A protein.
          Length = 516

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 30  CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 64


>AE014297-2538|AAS65176.1|  854|Drosophila melanogaster CG14307-PM,
           isoform M protein.
          Length = 854

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 30  CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 64


>AE014297-2537|AAS65175.1|  854|Drosophila melanogaster CG14307-PL,
           isoform L protein.
          Length = 854

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 30  CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 64


>AE014297-2536|AAF55565.2|  854|Drosophila melanogaster CG14307-PC,
           isoform C protein.
          Length = 854

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 30  CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 64


>AE014297-2535|AAS65174.1|  906|Drosophila melanogaster CG14307-PJ,
           isoform J protein.
          Length = 906

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 82  CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 116


>AE014297-2534|AAS65173.1|  870|Drosophila melanogaster CG14307-PI,
           isoform I protein.
          Length = 870

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 46  CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 80


>AE014297-2533|AAN13776.1|  955|Drosophila melanogaster CG14307-PE,
           isoform E protein.
          Length = 955

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 131 CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 165


>AE014297-2532|AAN13775.1|  695|Drosophila melanogaster CG14307-PH,
           isoform H protein.
          Length = 695

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 30  CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 64


>AE014297-2531|AAS65172.1|  705|Drosophila melanogaster CG14307-PK,
           isoform K protein.
          Length = 705

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 40  CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 74


>AE014297-2530|AAF55563.2|  796|Drosophila melanogaster CG14307-PG,
           isoform G protein.
          Length = 796

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 131 CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 165


>AE014297-2529|AAN13774.1|  688|Drosophila melanogaster CG14307-PF,
           isoform F protein.
          Length = 688

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 30  CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 64


>AE014297-2528|AAF55562.2|  789|Drosophila melanogaster CG14307-PB,
           isoform B protein.
          Length = 789

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD +  A +G +   H+ ILSACSPYF  +F    H
Sbjct: 131 CD-VTLACEGETVKAHQTILSACSPYFETIFLQNQH 165


>AE014296-173|AAS64927.1|  526|Drosophila melanogaster CG9097-PA,
           isoform A protein.
          Length = 526

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A DG S   H+ +LSACSPYF  L   T
Sbjct: 129 VTLACDGRSMKAHKMVLSACSPYFQTLLAET 159


>AE014296-172|AAF47439.2|  977|Drosophila melanogaster CG9097-PB,
           isoform B protein.
          Length = 977

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTT 356
           +  A DG S   H+ +LSACSPYF  L   T
Sbjct: 129 VTLACDGRSMKAHKMVLSACSPYFQTLLAET 159


>AE014134-2051|AAN10774.1|  894|Drosophila melanogaster CG4807-PB,
           isoform B protein.
          Length = 894

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 23/79 (29%), Positives = 34/79 (43%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +  A D  SF  H+ +LSACSPYF  L     +  E   V++  VR              
Sbjct: 105 VTLACDERSFTAHKVVLSACSPYFRRLLKA--NPCEHPIVILRDVRCDDVENLLSFMYNG 162

Query: 444 XIDVTDTNVHELLMTADYL 500
            ++V+   + + L TA  L
Sbjct: 163 EVNVSHEQLPDFLKTAHLL 181


>AE014134-2050|AAF53087.2|  904|Drosophila melanogaster CG4807-PA,
           isoform A protein.
          Length = 904

 Score = 35.9 bits (79), Expect = 0.073
 Identities = 23/79 (29%), Positives = 34/79 (43%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXX 443
           +  A D  SF  H+ +LSACSPYF  L     +  E   V++  VR              
Sbjct: 105 VTLACDERSFTAHKVVLSACSPYFRRLLKA--NPCEHPIVILRDVRCDDVENLLSFMYNG 162

Query: 444 XIDVTDTNVHELLMTADYL 500
            ++V+   + + L TA  L
Sbjct: 163 EVNVSHEQLPDFLKTAHLL 181


>U14399-1|AAA50834.1|  115|Drosophila melanogaster BTB-II protein
           domain protein.
          Length = 115

 Score = 35.5 bits (78), Expect = 0.097
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALF 347
           +G S   H+ +LSACSPYF ALF
Sbjct: 35  EGHSIKAHKMVLSACSPYFQALF 57


>BT009963-1|AAQ22432.1| 1067|Drosophila melanogaster RE72345p
           protein.
          Length = 1067

 Score = 35.5 bits (78), Expect = 0.097
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALF 347
           +G S   H+ +LSACSPYF ALF
Sbjct: 230 EGHSIKAHKMVLSACSPYFQALF 252


>AJ252173-1|CAB64388.1| 1067|Drosophila melanogaster BAB-II protein
           protein.
          Length = 1067

 Score = 35.5 bits (78), Expect = 0.097
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALF 347
           +G S   H+ +LSACSPYF ALF
Sbjct: 230 EGHSIKAHKMVLSACSPYFQALF 252


>AE014296-178|AAF47442.2| 1067|Drosophila melanogaster CG9102-PA
           protein.
          Length = 1067

 Score = 35.5 bits (78), Expect = 0.097
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALF 347
           +G S   H+ +LSACSPYF ALF
Sbjct: 230 EGHSIKAHKMVLSACSPYFQALF 252


>Z11723-2|CAA77786.1|  811|Drosophila melanogaster DNA binding
           protein protein.
          Length = 811

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +  A +G     H+ +LSACSPYF  LF +  H  +   V++  V
Sbjct: 33  VTLAVEGQHLKAHKMVLSACSPYFNTLFVS--HPEKHPIVILKDV 75


>Z11723-1|CAA77785.1|  813|Drosophila melanogaster DNA binding
           protein protein.
          Length = 813

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +  A +G     H+ +LSACSPYF  LF +  H  +   V++  V
Sbjct: 35  VTLAVEGQHLKAHKMVLSACSPYFNTLFVS--HPEKHPIVILKDV 77


>X71627-1|CAA50634.1|  643|Drosophila melanogaster tramtrack p69
           protein.
          Length = 643

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +  A +G     H+ +LSACSPYF  LF +  H  +   V++  V
Sbjct: 35  VTLAVEGQHLKAHKMVLSACSPYFNTLFVS--HPEKHPIVILKDV 77


>X71626-1|CAA50633.1|  813|Drosophila melanogaster tramtrack p88
           protein.
          Length = 813

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +  A +G     H+ +LSACSPYF  LF +  H  +   V++  V
Sbjct: 35  VTLAVEGQHLKAHKMVLSACSPYFNTLFVS--HPEKHPIVILKDV 77


>X17121-1|CAA34981.1|  641|Drosophila melanogaster protein (
           Drosophila melanogastertramtrack (ttk) gene for a zinc
           finger  protein interactivewith the ftz transcriptional
           regulatory region. ).
          Length = 641

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +  A +G     H+ +LSACSPYF  LF +  H  +   V++  V
Sbjct: 33  VTLAVEGQHLKAHKMVLSACSPYFNTLFVS--HPEKHPIVILKDV 75


>M62856-1|AAA28544.1|  641|Drosophila melanogaster fushi tarazu
           repressor protein.
          Length = 641

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +  A +G     H+ +LSACSPYF  LF +  H  +   V++  V
Sbjct: 33  VTLAVEGQHLKAHKMVLSACSPYFNTLFVS--HPEKHPIVILKDV 75


>BT025183-1|ABF00108.1|  487|Drosophila melanogaster IP15250p
           protein.
          Length = 487

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +  A +G     H+ +LSACSPYF  LF +  H  +   V++  V
Sbjct: 35  VTLAVEGQHLKAHKMVLSACSPYFNTLFVS--HPEKHPIVILKDV 77


>BT001723-1|AAN71478.1|  643|Drosophila melanogaster RE69322p
           protein.
          Length = 643

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +  A +G     H+ +LSACSPYF  LF +  H  +   V++  V
Sbjct: 35  VTLAVEGQHLKAHKMVLSACSPYFNTLFVS--HPEKHPIVILKDV 77


>AY122169-1|AAM52681.1|  643|Drosophila melanogaster LD28689p
           protein.
          Length = 643

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +  A +G     H+ +LSACSPYF  LF +  H  +   V++  V
Sbjct: 35  VTLAVEGQHLKAHKMVLSACSPYFNTLFVS--HPEKHPIVILKDV 77


>AE014297-4786|AAN14283.1|  643|Drosophila melanogaster CG1856-PF,
           isoform F protein.
          Length = 643

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +  A +G     H+ +LSACSPYF  LF +  H  +   V++  V
Sbjct: 35  VTLAVEGQHLKAHKMVLSACSPYFNTLFVS--HPEKHPIVILKDV 77


>AE014297-4785|AAF57181.1|  643|Drosophila melanogaster CG1856-PD,
           isoform D protein.
          Length = 643

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +  A +G     H+ +LSACSPYF  LF +  H  +   V++  V
Sbjct: 35  VTLAVEGQHLKAHKMVLSACSPYFNTLFVS--HPEKHPIVILKDV 77


>AE014297-4784|AAF57182.3|  643|Drosophila melanogaster CG1856-PC,
           isoform C protein.
          Length = 643

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +  A +G     H+ +LSACSPYF  LF +  H  +   V++  V
Sbjct: 35  VTLAVEGQHLKAHKMVLSACSPYFNTLFVS--HPEKHPIVILKDV 77


>AE014297-4783|AAN14282.1|  813|Drosophila melanogaster CG1856-PE,
           isoform E protein.
          Length = 813

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +  A +G     H+ +LSACSPYF  LF +  H  +   V++  V
Sbjct: 35  VTLAVEGQHLKAHKMVLSACSPYFNTLFVS--HPEKHPIVILKDV 77


>AE014297-4782|AAF57179.1|  813|Drosophila melanogaster CG1856-PB,
           isoform B protein.
          Length = 813

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +  A +G     H+ +LSACSPYF  LF +  H  +   V++  V
Sbjct: 35  VTLAVEGQHLKAHKMVLSACSPYFNTLFVS--HPEKHPIVILKDV 77


>AE014297-4781|AAF57180.1|  813|Drosophila melanogaster CG1856-PA,
           isoform A protein.
          Length = 813

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           +  A +G     H+ +LSACSPYF  LF +  H  +   V++  V
Sbjct: 35  VTLAVEGQHLKAHKMVLSACSPYFNTLFVS--HPEKHPIVILKDV 77


>BT029293-1|ABK30930.1|  681|Drosophila melanogaster RT01152p
           protein.
          Length = 681

 Score = 33.5 bits (73), Expect = 0.39
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTT 353
           +  A DG     H+ +L+ CSPYF  +FTT
Sbjct: 32  VTLACDGKLLHAHKIVLAICSPYFQEIFTT 61


>BT029292-1|ABK30929.1|  681|Drosophila melanogaster RT01151p
           protein.
          Length = 681

 Score = 33.5 bits (73), Expect = 0.39
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTT 353
           +  A DG     H+ +L+ CSPYF  +FTT
Sbjct: 32  VTLACDGKLLHAHKIVLAICSPYFQEIFTT 61


>BT029291-1|ABK30928.1|  681|Drosophila melanogaster RT01150p
           protein.
          Length = 681

 Score = 33.5 bits (73), Expect = 0.39
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTT 353
           +  A DG     H+ +L+ CSPYF  +FTT
Sbjct: 32  VTLACDGKLLHAHKIVLAICSPYFQEIFTT 61


>AE014297-3156|AAF55998.2|  681|Drosophila melanogaster CG31160-PA
           protein.
          Length = 681

 Score = 33.5 bits (73), Expect = 0.39
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALFTT 353
           +  A DG     H+ +L+ CSPYF  +FTT
Sbjct: 32  VTLACDGKLLHAHKIVLAICSPYFQEIFTT 61


>Z50021-1|CAA90324.1| 1096|Drosophila melanogaster
           centrosome-associated zinc fingerprotein protein.
          Length = 1096

 Score = 33.1 bits (72), Expect = 0.52
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTT 353
           CD  ++  D +   VHR +LSAC+ YF  L  T
Sbjct: 30  CDLTLQFRDNSQLKVHRLVLSACTDYFNVLEQT 62


>BT010090-1|AAQ22559.1| 1096|Drosophila melanogaster LD02352p
           protein.
          Length = 1096

 Score = 33.1 bits (72), Expect = 0.52
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTT 353
           CD  ++  D +   VHR +LSAC+ YF  L  T
Sbjct: 30  CDLTLQFRDNSQLKVHRLVLSACTDYFNVLEQT 62


>AY094818-1|AAM11171.1|  616|Drosophila melanogaster LD33804p
           protein.
          Length = 616

 Score = 33.1 bits (72), Expect = 0.52
 Identities = 21/67 (31%), Positives = 31/67 (46%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+  C   L + +  +NCL I   A       L   A RY+  +F   AT SD F  + +
Sbjct: 134 VIDRCTIFLGAKIEMENCLAIAGMADIYGIMDLSERAYRYMCAHFEEFATTSD-FKEMKV 192

Query: 692 DELNSII 712
           D+L  I+
Sbjct: 193 DQLRFIL 199



 Score = 32.3 bits (70), Expect = 0.90
 Identities = 16/75 (21%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
 Frame = +3

Query: 291 FPVHRAILSACSPYFLALFT-TTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTN 467
           F  HR +L+A S YF A+F    +    + ++ + G+++              +++   N
Sbjct: 59  FKAHRVVLAASSDYFCAMFADCAMIESRKDEINLYGIKARAMGSIIDYIYTSMLELNYDN 118

Query: 468 VHELLMTADYLAFLE 512
           + E+L  A ++   E
Sbjct: 119 IEEILAAATHVQVRE 133


>AE014298-3034|AAN09551.1|  541|Drosophila melanogaster CG1812-PB,
           isoform B protein.
          Length = 541

 Score = 33.1 bits (72), Expect = 0.52
 Identities = 21/67 (31%), Positives = 31/67 (46%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+  C   L + +  +NCL I   A       L   A RY+  +F   AT SD F  + +
Sbjct: 59  VIDRCTIFLGAKIEMENCLAIAGMADIYGIMDLSERAYRYMCAHFEEFATTSD-FKEMKV 117

Query: 692 DELNSII 712
           D+L  I+
Sbjct: 118 DQLRFIL 124


>AE014298-3033|AAF50896.1|  616|Drosophila melanogaster CG1812-PA,
           isoform A protein.
          Length = 616

 Score = 33.1 bits (72), Expect = 0.52
 Identities = 21/67 (31%), Positives = 31/67 (46%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+  C   L + +  +NCL I   A       L   A RY+  +F   AT SD F  + +
Sbjct: 134 VIDRCTIFLGAKIEMENCLAIAGMADIYGIMDLSERAYRYMCAHFEEFATTSD-FKEMKV 192

Query: 692 DELNSII 712
           D+L  I+
Sbjct: 193 DQLRFIL 199



 Score = 32.3 bits (70), Expect = 0.90
 Identities = 16/75 (21%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
 Frame = +3

Query: 291 FPVHRAILSACSPYFLALFT-TTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTN 467
           F  HR +L+A S YF A+F    +    + ++ + G+++              +++   N
Sbjct: 59  FKAHRVVLAASSDYFCAMFADCAMIESRKDEINLYGIKARAMGSIIDYIYTSMLELNYDN 118

Query: 468 VHELLMTADYLAFLE 512
           + E+L  A ++   E
Sbjct: 119 IEEILAAATHVQVRE 133


>AE014297-1986|AAN13643.1| 1096|Drosophila melanogaster CG6384-PB,
           isoform B protein.
          Length = 1096

 Score = 33.1 bits (72), Expect = 0.52
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTT 353
           CD  ++  D +   VHR +LSAC+ YF  L  T
Sbjct: 30  CDLTLQFRDNSQLKVHRLVLSACTDYFNVLEQT 62


>AE014297-1985|AAF55159.1| 1096|Drosophila melanogaster CG6384-PA,
           isoform A protein.
          Length = 1096

 Score = 33.1 bits (72), Expect = 0.52
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTT 353
           CD  ++  D +   VHR +LSAC+ YF  L  T
Sbjct: 30  CDLTLQFRDNSQLKVHRLVLSACTDYFNVLEQT 62


>D84438-1|BAA12664.1|   61|Drosophila melanogaster fru protein.
          Length = 61

 Score = 32.7 bits (71), Expect = 0.68
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLALF 347
           +  A +G +   H+ ILSACSPYF  +F
Sbjct: 32  VTLACEGETVKAHQTILSACSPYFETIF 59


>U68563-1|AAB81117.1|  519|Drosophila melanogaster GAGA-519b Adf-2
           isoform protein.
          Length = 519

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 21/76 (27%), Positives = 31/76 (40%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXID 452
           A  G SFP H+ +L A SP+ L L   T    +   V+++GV +              + 
Sbjct: 39  AAGGRSFPAHKIVLCAASPFLLDLLKNT--PCKHPVVMLAGVNANDLEALLEFVYRGEVS 96

Query: 453 VTDTNVHELLMTADYL 500
           V    +  LL  A  L
Sbjct: 97  VDHAQLPSLLQAAQCL 112


>U18386-1|AAB81113.1|  519|Drosophila melanogaster GAGA-519a Adf-2
           isoform protein.
          Length = 519

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 21/76 (27%), Positives = 31/76 (40%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXID 452
           A  G SFP H+ +L A SP+ L L   T    +   V+++GV +              + 
Sbjct: 39  AAGGRSFPAHKIVLCAASPFLLDLLKNT--PCKHPVVMLAGVNANDLEALLEFVYRGEVS 96

Query: 453 VTDTNVHELLMTADYL 500
           V    +  LL  A  L
Sbjct: 97  VDHAQLPSLLQAAQCL 112


>U16728-1|AAB81112.1|  581|Drosophila melanogaster GAGA-581 Adf-2
           isoform protein.
          Length = 581

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 21/76 (27%), Positives = 31/76 (40%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXID 452
           A  G SFP H+ +L A SP+ L L   T    +   V+++GV +              + 
Sbjct: 39  AAGGRSFPAHKIVLCAASPFLLDLLKNT--PCKHPVVMLAGVNANDLEALLEFVYRGEVS 96

Query: 453 VTDTNVHELLMTADYL 500
           V    +  LL  A  L
Sbjct: 97  VDHAQLPSLLQAAQCL 112


>L22205-1|AAA16072.1|  519|Drosophila melanogaster GAGA
           transcription factor protein.
          Length = 519

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 21/76 (27%), Positives = 31/76 (40%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXID 452
           A  G SFP H+ +L A SP+ L L   T    +   V+++GV +              + 
Sbjct: 39  AAGGRSFPAHKIVLCAASPFLLDLLKNT--PCKHPVVMLAGVNANDLEALLEFVYRGEVS 96

Query: 453 VTDTNVHELLMTADYL 500
           V    +  LL  A  L
Sbjct: 97  VDHAQLPSLLQAAQCL 112


>BT003649-1|AAO39653.1|  581|Drosophila melanogaster AT11176p
           protein.
          Length = 581

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 21/76 (27%), Positives = 31/76 (40%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXID 452
           A  G SFP H+ +L A SP+ L L   T    +   V+++GV +              + 
Sbjct: 39  AAGGRSFPAHKIVLCAASPFLLDLLKNT--PCKHPVVMLAGVNANDLEALLEFVYRGEVS 96

Query: 453 VTDTNVHELLMTADYL 500
           V    +  LL  A  L
Sbjct: 97  VDHAQLPSLLQAAQCL 112


>AY069651-1|AAL39796.1|  519|Drosophila melanogaster LD41963p
           protein.
          Length = 519

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 21/76 (27%), Positives = 31/76 (40%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXID 452
           A  G SFP H+ +L A SP+ L L   T    +   V+++GV +              + 
Sbjct: 39  AAGGRSFPAHKIVLCAASPFLLDLLKNT--PCKHPVVMLAGVNANDLEALLEFVYRGEVS 96

Query: 453 VTDTNVHELLMTADYL 500
           V    +  LL  A  L
Sbjct: 97  VDHAQLPSLLQAAQCL 112


>AY060364-1|AAL25403.1|  127|Drosophila melanogaster LD14505p
           protein.
          Length = 127

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLAL 344
           +  A +G +   H+ +LSACSPYF AL
Sbjct: 35  VTLACEGQTCKAHKMVLSACSPYFKAL 61


>AJ225042-2|CAB86986.1|  581|Drosophila melanogaster TRL-581
           protein, GAGA-581 isoform protein.
          Length = 581

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 21/76 (27%), Positives = 31/76 (40%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXID 452
           A  G SFP H+ +L A SP+ L L   T    +   V+++GV +              + 
Sbjct: 39  AAGGRSFPAHKIVLCAASPFLLDLLKNT--PCKHPVVMLAGVNANDLEALLEFVYRGEVS 96

Query: 453 VTDTNVHELLMTADYL 500
           V    +  LL  A  L
Sbjct: 97  VDHAQLPSLLQAAQCL 112


>AJ225042-1|CAA12383.1|  519|Drosophila melanogaster TRL-519
           protein, GAGA-519 isoform protein.
          Length = 519

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 21/76 (27%), Positives = 31/76 (40%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXID 452
           A  G SFP H+ +L A SP+ L L   T    +   V+++GV +              + 
Sbjct: 39  AAGGRSFPAHKIVLCAASPFLLDLLKNT--PCKHPVVMLAGVNANDLEALLEFVYRGEVS 96

Query: 453 VTDTNVHELLMTADYL 500
           V    +  LL  A  L
Sbjct: 97  VDHAQLPSLLQAAQCL 112


>AF308476-1|AAG45054.1|  127|Drosophila melanogaster batman protein
           protein.
          Length = 127

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLAL 344
           +  A +G +   H+ +LSACSPYF AL
Sbjct: 35  VTLACEGQTCKAHKMVLSACSPYFKAL 61


>AE014296-2425|ABC66145.1|  519|Drosophila melanogaster CG33261-PH,
           isoform H protein.
          Length = 519

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 21/76 (27%), Positives = 31/76 (40%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXID 452
           A  G SFP H+ +L A SP+ L L   T    +   V+++GV +              + 
Sbjct: 39  AAGGRSFPAHKIVLCAASPFLLDLLKNT--PCKHPVVMLAGVNANDLEALLEFVYRGEVS 96

Query: 453 VTDTNVHELLMTADYL 500
           V    +  LL  A  L
Sbjct: 97  VDHAQLPSLLQAAQCL 112


>AE014296-2424|AAN11800.1|  519|Drosophila melanogaster CG33261-PE,
           isoform E protein.
          Length = 519

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 21/76 (27%), Positives = 31/76 (40%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXID 452
           A  G SFP H+ +L A SP+ L L   T    +   V+++GV +              + 
Sbjct: 39  AAGGRSFPAHKIVLCAASPFLLDLLKNT--PCKHPVVMLAGVNANDLEALLEFVYRGEVS 96

Query: 453 VTDTNVHELLMTADYL 500
           V    +  LL  A  L
Sbjct: 97  VDHAQLPSLLQAAQCL 112


>AE014296-2423|AAF49711.1|  519|Drosophila melanogaster CG33261-PD,
           isoform D protein.
          Length = 519

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 21/76 (27%), Positives = 31/76 (40%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXID 452
           A  G SFP H+ +L A SP+ L L   T    +   V+++GV +              + 
Sbjct: 39  AAGGRSFPAHKIVLCAASPFLLDLLKNT--PCKHPVVMLAGVNANDLEALLEFVYRGEVS 96

Query: 453 VTDTNVHELLMTADYL 500
           V    +  LL  A  L
Sbjct: 97  VDHAQLPSLLQAAQCL 112


>AE014296-2422|AAN11799.1|  519|Drosophila melanogaster CG33261-PC,
           isoform C protein.
          Length = 519

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 21/76 (27%), Positives = 31/76 (40%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXID 452
           A  G SFP H+ +L A SP+ L L   T    +   V+++GV +              + 
Sbjct: 39  AAGGRSFPAHKIVLCAASPFLLDLLKNT--PCKHPVVMLAGVNANDLEALLEFVYRGEVS 96

Query: 453 VTDTNVHELLMTADYL 500
           V    +  LL  A  L
Sbjct: 97  VDHAQLPSLLQAAQCL 112


>AE014296-2421|AAF49710.1|  519|Drosophila melanogaster CG33261-PB,
           isoform B protein.
          Length = 519

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 21/76 (27%), Positives = 31/76 (40%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXID 452
           A  G SFP H+ +L A SP+ L L   T    +   V+++GV +              + 
Sbjct: 39  AAGGRSFPAHKIVLCAASPFLLDLLKNT--PCKHPVVMLAGVNANDLEALLEFVYRGEVS 96

Query: 453 VTDTNVHELLMTADYL 500
           V    +  LL  A  L
Sbjct: 97  VDHAQLPSLLQAAQCL 112


>AE014296-2419|AAS65007.1|  582|Drosophila melanogaster CG33261-PF,
           isoform F protein.
          Length = 582

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 21/76 (27%), Positives = 31/76 (40%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXID 452
           A  G SFP H+ +L A SP+ L L   T    +   V+++GV +              + 
Sbjct: 39  AAGGRSFPAHKIVLCAASPFLLDLLKNT--PCKHPVVMLAGVNANDLEALLEFVYRGEVS 96

Query: 453 VTDTNVHELLMTADYL 500
           V    +  LL  A  L
Sbjct: 97  VDHAQLPSLLQAAQCL 112


>AE014296-2418|AAF49709.1|  582|Drosophila melanogaster CG33261-PA,
           isoform A protein.
          Length = 582

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 21/76 (27%), Positives = 31/76 (40%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXID 452
           A  G SFP H+ +L A SP+ L L   T    +   V+++GV +              + 
Sbjct: 39  AAGGRSFPAHKIVLCAASPFLLDLLKNT--PCKHPVVMLAGVNANDLEALLEFVYRGEVS 96

Query: 453 VTDTNVHELLMTADYL 500
           V    +  LL  A  L
Sbjct: 97  VDHAQLPSLLQAAQCL 112


>AE014296-2417|ABC66143.1|  567|Drosophila melanogaster CG33261-PI,
           isoform I protein.
          Length = 567

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 21/76 (27%), Positives = 31/76 (40%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXID 452
           A  G SFP H+ +L A SP+ L L   T    +   V+++GV +              + 
Sbjct: 39  AAGGRSFPAHKIVLCAASPFLLDLLKNT--PCKHPVVMLAGVNANDLEALLEFVYRGEVS 96

Query: 453 VTDTNVHELLMTADYL 500
           V    +  LL  A  L
Sbjct: 97  VDHAQLPSLLQAAQCL 112


>AE013599-2635|AAM68181.1|  127|Drosophila melanogaster CG5738-PD,
           isoform D protein.
          Length = 127

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLAL 344
           +  A +G +   H+ +LSACSPYF AL
Sbjct: 35  VTLACEGQTCKAHKMVLSACSPYFKAL 61


>AE013599-2634|AAM68180.1|  127|Drosophila melanogaster CG5738-PC,
           isoform C protein.
          Length = 127

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLAL 344
           +  A +G +   H+ +LSACSPYF AL
Sbjct: 35  VTLACEGQTCKAHKMVLSACSPYFKAL 61


>AE013599-2633|AAM68179.1|  127|Drosophila melanogaster CG5738-PB,
           isoform B protein.
          Length = 127

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLAL 344
           +  A +G +   H+ +LSACSPYF AL
Sbjct: 35  VTLACEGQTCKAHKMVLSACSPYFKAL 61


>AE013599-2632|AAF57739.1|  127|Drosophila melanogaster CG5738-PA,
           isoform A protein.
          Length = 127

 Score = 32.3 bits (70), Expect = 0.90
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +3

Query: 264 IVRADDGASFPVHRAILSACSPYFLAL 344
           +  A +G +   H+ +LSACSPYF AL
Sbjct: 35  VTLACEGQTCKAHKMVLSACSPYFKAL 61


>X90986-2|CAA62474.1| 1085|Drosophila melanogaster pipsqueak
           protein.
          Length = 1085

 Score = 31.9 bits (69), Expect = 1.2
 Identities = 23/84 (27%), Positives = 36/84 (42%)
 Frame = +3

Query: 249 SACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXX 428
           S  D  +  + G S   H+ +LSACS YF  L       +  + +L + +          
Sbjct: 33  SFVDVTLSCEHG-SLKAHKVVLSACSTYFQKLLLEN-PCKHPTIILPADIIFTDLKTIID 90

Query: 429 XXXXXXIDVTDTNVHELLMTADYL 500
                 IDVT++ +  LL TA+ L
Sbjct: 91  FVYRGEIDVTESELQGLLRTAEQL 114


>X90986-1|CAA62473.1|  535|Drosophila melanogaster pipsqueak
           protein.
          Length = 535

 Score = 31.9 bits (69), Expect = 1.2
 Identities = 23/84 (27%), Positives = 36/84 (42%)
 Frame = +3

Query: 249 SACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXX 428
           S  D  +  + G S   H+ +LSACS YF  L       +  + +L + +          
Sbjct: 33  SFVDVTLSCEHG-SLKAHKVVLSACSTYFQKLLLEN-PCKHPTIILPADIIFTDLKTIID 90

Query: 429 XXXXXXIDVTDTNVHELLMTADYL 500
                 IDVT++ +  LL TA+ L
Sbjct: 91  FVYRGEIDVTESELQGLLRTAEQL 114


>U48358-1|AAC47153.1| 1065|Drosophila melanogaster PsqA protein.
          Length = 1065

 Score = 31.9 bits (69), Expect = 1.2
 Identities = 23/84 (27%), Positives = 36/84 (42%)
 Frame = +3

Query: 249 SACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXX 428
           S  D  +  + G S   H+ +LSACS YF  L       +  + +L + +          
Sbjct: 33  SFVDVTLSCEHG-SLKAHKVVLSACSTYFQKLLLEN-PCKHPTIILPADIIFTDLKTIID 90

Query: 429 XXXXXXIDVTDTNVHELLMTADYL 500
                 IDVT++ +  LL TA+ L
Sbjct: 91  FVYRGEIDVTESELQGLLRTAEQL 114


>BT010295-1|AAQ23613.1|  661|Drosophila melanogaster LD16058p
           protein.
          Length = 661

 Score = 31.9 bits (69), Expect = 1.2
 Identities = 23/86 (26%), Positives = 35/86 (40%)
 Frame = +3

Query: 243 VSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXX 422
           V S  D  +  DD   F  HR +L+A SPYF  +       ++   +++ GV+       
Sbjct: 39  VGSYVDCSLVVDD-EQFQAHRVVLAANSPYFQHILKDV--PQDHCSIILPGVKGFEIAAL 95

Query: 423 XXXXXXXXIDVTDTNVHELLMTADYL 500
                     VT +   E+L TA  L
Sbjct: 96  LQYMYTGETTVTKSQEPEILRTAKEL 121


>AY069588-1|AAL39733.1| 1064|Drosophila melanogaster LD33470p
           protein.
          Length = 1064

 Score = 31.9 bits (69), Expect = 1.2
 Identities = 23/84 (27%), Positives = 36/84 (42%)
 Frame = +3

Query: 249 SACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXX 428
           S  D  +  + G S   H+ +LSACS YF  L       +  + +L + +          
Sbjct: 33  SFVDVTLSCEHG-SLKAHKVVLSACSTYFQKLLLEN-PCKHPTIILPADIIFTDLKTIID 90

Query: 429 XXXXXXIDVTDTNVHELLMTADYL 500
                 IDVT++ +  LL TA+ L
Sbjct: 91  FVYRGEIDVTESELQGLLRTAEQL 114


>AF416603-1|AAL11905.1|  661|Drosophila melanogaster ribbon protein.
          Length = 661

 Score = 31.9 bits (69), Expect = 1.2
 Identities = 23/86 (26%), Positives = 35/86 (40%)
 Frame = +3

Query: 243 VSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXX 422
           V S  D  +  DD   F  HR +L+A SPYF  +       ++   +++ GV+       
Sbjct: 39  VGSYVDCSLVVDD-EQFQAHRVVLAANSPYFQHILKDV--PQDHCSIILPGVKGFEIAAL 95

Query: 423 XXXXXXXXIDVTDTNVHELLMTADYL 500
                     VT +   E+L TA  L
Sbjct: 96  LQYMYTGETTVTKSQEPEILRTAKEL 121


>AE013599-2846|AAF57588.1|  661|Drosophila melanogaster CG7230-PA
           protein.
          Length = 661

 Score = 31.9 bits (69), Expect = 1.2
 Identities = 23/86 (26%), Positives = 35/86 (40%)
 Frame = +3

Query: 243 VSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXX 422
           V S  D  +  DD   F  HR +L+A SPYF  +       ++   +++ GV+       
Sbjct: 39  VGSYVDCSLVVDD-EQFQAHRVVLAANSPYFQHILKDV--PQDHCSIILPGVKGFEIAAL 95

Query: 423 XXXXXXXXIDVTDTNVHELLMTADYL 500
                     VT +   E+L TA  L
Sbjct: 96  LQYMYTGETTVTKSQEPEILRTAKEL 121


>AE013599-1144|AAX52711.1|  535|Drosophila melanogaster CG2368-PL,
           isoform L protein.
          Length = 535

 Score = 31.9 bits (69), Expect = 1.2
 Identities = 23/84 (27%), Positives = 36/84 (42%)
 Frame = +3

Query: 249 SACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXX 428
           S  D  +  + G S   H+ +LSACS YF  L       +  + +L + +          
Sbjct: 33  SFVDVTLSCEHG-SLKAHKVVLSACSTYFQKLLLEN-PCKHPTIILPADIIFTDLKTIID 90

Query: 429 XXXXXXIDVTDTNVHELLMTADYL 500
                 IDVT++ +  LL TA+ L
Sbjct: 91  FVYRGEIDVTESELQGLLRTAEQL 114


>AE013599-1143|AAF58770.1| 1046|Drosophila melanogaster CG2368-PA,
           isoform A protein.
          Length = 1046

 Score = 31.9 bits (69), Expect = 1.2
 Identities = 23/84 (27%), Positives = 36/84 (42%)
 Frame = +3

Query: 249 SACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXX 428
           S  D  +  + G S   H+ +LSACS YF  L       +  + +L + +          
Sbjct: 33  SFVDVTLSCEHG-SLKAHKVVLSACSTYFQKLLLEN-PCKHPTIILPADIIFTDLKTIID 90

Query: 429 XXXXXXIDVTDTNVHELLMTADYL 500
                 IDVT++ +  LL TA+ L
Sbjct: 91  FVYRGEIDVTESELQGLLRTAEQL 114


>AE013599-1142|AAS64878.1| 1064|Drosophila melanogaster CG2368-PC,
           isoform C protein.
          Length = 1064

 Score = 31.9 bits (69), Expect = 1.2
 Identities = 23/84 (27%), Positives = 36/84 (42%)
 Frame = +3

Query: 249 SACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXX 428
           S  D  +  + G S   H+ +LSACS YF  L       +  + +L + +          
Sbjct: 33  SFVDVTLSCEHG-SLKAHKVVLSACSTYFQKLLLEN-PCKHPTIILPADIIFTDLKTIID 90

Query: 429 XXXXXXIDVTDTNVHELLMTADYL 500
                 IDVT++ +  LL TA+ L
Sbjct: 91  FVYRGEIDVTESELQGLLRTAEQL 114


>AE013599-1141|AAF58769.1| 1064|Drosophila melanogaster CG2368-PB,
           isoform B protein.
          Length = 1064

 Score = 31.9 bits (69), Expect = 1.2
 Identities = 23/84 (27%), Positives = 36/84 (42%)
 Frame = +3

Query: 249 SACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXX 428
           S  D  +  + G S   H+ +LSACS YF  L       +  + +L + +          
Sbjct: 33  SFVDVTLSCEHG-SLKAHKVVLSACSTYFQKLLLEN-PCKHPTIILPADIIFTDLKTIID 90

Query: 429 XXXXXXIDVTDTNVHELLMTADYL 500
                 IDVT++ +  LL TA+ L
Sbjct: 91  FVYRGEIDVTESELQGLLRTAEQL 114


>X75498-1|CAA53215.1|  534|Drosophila melanogaster protein A
           protein.
          Length = 534

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>U62802-1|AAC17459.1|  514|Drosophila melanogaster doom protein.
          Length = 514

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>U30913-1|AAA82989.1|  520|Drosophila melanogaster mod1.9 protein
           protein.
          Length = 520

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>U30905-1|AAA82988.1|  610|Drosophila melanogaster mod2.2 protein.
          Length = 610

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>U14401-1|AAA50836.1|  115|Drosophila melanogaster BTB-IV protein
           domain protein.
          Length = 115

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 33  AAEGKFLKAHKVVLSACSPYFATL 56


>U07607-1|AAA19593.1|  894|Drosophila melanogaster Lola protein long
           isoform protein.
          Length = 894

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>U07606-1|AAA19592.1|  467|Drosophila melanogaster Lola protein
           short isoform protein.
          Length = 467

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>BT029698-1|ABL75755.1|  488|Drosophila melanogaster IP17441p
           protein.
          Length = 488

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>BT029109-1|ABJ17042.1|  603|Drosophila melanogaster IP14843p
           protein.
          Length = 603

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>BT024979-1|ABE01209.1|  384|Drosophila melanogaster IP13591p
           protein.
          Length = 384

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 21/85 (24%), Positives = 35/85 (41%)
 Frame = +3

Query: 246 SSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXX 425
           S   D  + A+ G     HR +LSACS +F+ +F   L +     ++I G          
Sbjct: 52  SHLTDVTISAE-GRQLRAHRVVLSACSSFFMDIF-RALEASNHPVIIIPGASFGAIVSLL 109

Query: 426 XXXXXXXIDVTDTNVHELLMTADYL 500
                  ++V +  +  LL  A+ L
Sbjct: 110 TFMYSGEVNVYEEQIPMLLNLAETL 134


>BT022124-1|AAY51519.1|  882|Drosophila melanogaster IP09048p
           protein.
          Length = 882

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALF 347
           A  G  F  H+ +LS CSPYF  +F
Sbjct: 338 AAGGKIFKAHKLVLSVCSPYFQQIF 362


>BT004909-1|AAO49162.1|  706|Drosophila melanogaster LD03274p
           protein.
          Length = 706

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>BT003579-1|AAO39583.1|  539|Drosophila melanogaster LD27582p
           protein.
          Length = 539

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>BT003484-1|AAO39487.1|  505|Drosophila melanogaster SD07645p
           protein.
          Length = 505

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AY095035-1|AAM11363.1|  676|Drosophila melanogaster LD26392p
           protein.
          Length = 676

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 22/82 (26%), Positives = 36/82 (43%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +  A +G     HR +L ACS +F A+ +     R+   +++  V            
Sbjct: 31  CD-VTLACEGQLIRAHRVVLCACSTFFDAVLSNYASERDPI-IIMKDVTFAEVKCLIEFM 88

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I+V  +++  LL TAD L
Sbjct: 89  YKGEINVEHSSLPSLLKTADDL 110


>AY058586-1|AAL13815.1|  748|Drosophila melanogaster LD28033p
           protein.
          Length = 748

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AJ320163-1|CAC51488.1|  485|Drosophila melanogaster mod(mdg4)53.4
           protein protein.
          Length = 485

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AJ320161-1|CAC51387.1|  476|Drosophila melanogaster mod(mdg4)52.2
           protein protein.
          Length = 476

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AJ277194-1|CAB85489.1|  534|Drosophila melanogaster mod(mdg4)58.0
           protein.
          Length = 534

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AJ277192-1|CAB85487.1|  610|Drosophila melanogaster mod(mdg4)67.2
           protein.
          Length = 610

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AJ277191-1|CAB85486.1|  601|Drosophila melanogaster mod(mdg4)65.0
           protein.
          Length = 601

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 35  AAEGQIVKAHRLVLSVCSPFFRKMFT 60


>AJ277190-1|CAB85485.1|  580|Drosophila melanogaster mod(mdg4)64.2
           protein.
          Length = 580

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AJ277189-1|CAB85484.1|  567|Drosophila melanogaster mod(mdg4)62.3
           protein.
          Length = 567

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AJ277188-1|CAB85483.1|  545|Drosophila melanogaster mod(mdg4)60.1
           protein.
          Length = 545

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AJ277187-1|CAB85482.1|  541|Drosophila melanogaster mod(mdg4)59.1
           protein.
          Length = 541

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AJ277186-1|CAB85481.1|  541|Drosophila melanogaster mod(mdg4)59.0
           protein.
          Length = 541

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AJ277185-1|CAB85480.1|  536|Drosophila melanogaster mod(mdg4)58.6
           protein.
          Length = 536

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AJ277183-1|CAB85478.1|  514|Drosophila melanogaster mod(mdg4)56.3
           protein.
          Length = 514

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AJ277182-1|CAB85477.1|  510|Drosophila melanogaster mod(mdg4)55.7
           protein.
          Length = 510

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AJ277181-1|CAB85476.1|  505|Drosophila melanogaster mod(mdg4)55.6
           protein.
          Length = 505

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AJ277180-1|CAB85475.1|  503|Drosophila melanogaster mod(mdg4)55.3
           protein.
          Length = 503

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AJ277179-1|CAB85474.1|  506|Drosophila melanogaster mod(mdg4)55.1
           protein.
          Length = 506

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AJ277177-1|CAB85472.1|  497|Drosophila melanogaster mod(mdg4)54.2
           protein.
          Length = 497

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AJ277176-1|CAB85471.1|  486|Drosophila melanogaster mod(mdg4)53.1
           protein.
          Length = 486

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AJ277174-1|CAB85469.1|  473|Drosophila melanogaster mod(mdg4)51.4
           protein.
          Length = 473

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014298-820|AAF46102.2|  676|Drosophila melanogaster CG3726-PA
           protein.
          Length = 676

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 22/82 (26%), Positives = 36/82 (43%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +  A +G     HR +L ACS +F A+ +     R+   +++  V            
Sbjct: 31  CD-VTLACEGQLIRAHRVVLCACSTFFDAVLSNYASERDPI-IIMKDVTFAEVKCLIEFM 88

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I+V  +++  LL TAD L
Sbjct: 89  YKGEINVEHSSLPSLLKTADDL 110


>AE014297-3002|AAN13875.1|  580|Drosophila melanogaster CG32491-PN,
           isoform N protein.
          Length = 580

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-3001|AAN13874.1|  545|Drosophila melanogaster CG32491-PO,
           isoform O protein.
          Length = 545

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-3000|AAN13873.1|  506|Drosophila melanogaster CG32491-PS,
           isoform S protein.
          Length = 506

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2999|AAO41586.1|  486|Drosophila melanogaster CG32491-PU,
           isoform U protein.
          Length = 486

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2998|AAO41585.1|  567|Drosophila melanogaster CG32491-PV,
           isoform V protein.
          Length = 567

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2997|AAO41584.1|  505|Drosophila melanogaster CG32491-PW,
           isoform W protein.
          Length = 505

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2996|AAO41583.1|  490|Drosophila melanogaster CG32491-PX,
           isoform X protein.
          Length = 490

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2995|AAO41582.1|  500|Drosophila melanogaster CG32491-PY,
           isoform Y protein.
          Length = 500

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2994|AAF55888.1|  534|Drosophila melanogaster CG32491-PC,
           isoform C protein.
          Length = 534

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2993|AAN13872.1|  603|Drosophila melanogaster CG32491-PE,
           isoform E protein.
          Length = 603

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2992|AAN13871.1|  503|Drosophila melanogaster CG32491-PM,
           isoform M protein.
          Length = 503

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2991|AAO41581.1|  526|Drosophila melanogaster CG32491-PZ,
           isoform Z protein.
          Length = 526

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2990|AAO41580.1|  610|Drosophila melanogaster CG32491-PT,
           isoform T protein.
          Length = 610

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2989|AAN13870.1|  510|Drosophila melanogaster CG32491-PK,
           isoform K protein.
          Length = 510

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2988|AAN13869.1|  476|Drosophila melanogaster CG32491-PL,
           isoform L protein.
          Length = 476

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2987|AAN13868.1|  539|Drosophila melanogaster CG32491-PP,
           isoform P protein.
          Length = 539

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2986|AAN13867.1|  473|Drosophila melanogaster CG32491-PJ,
           isoform J protein.
          Length = 473

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2985|AAN13866.1|  541|Drosophila melanogaster CG32491-PI,
           isoform I protein.
          Length = 541

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2984|AAF55885.2|  498|Drosophila melanogaster CG32491-PB,
           isoform B protein.
          Length = 498

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2983|AAN13865.1|  514|Drosophila melanogaster CG32491-PH,
           isoform H protein.
          Length = 514

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2982|AAN13864.1|  430|Drosophila melanogaster CG32491-PQ,
           isoform Q protein.
          Length = 430

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2981|AAN13863.1|  497|Drosophila melanogaster CG32491-PG,
           isoform G protein.
          Length = 497

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2980|AAF55884.1|  520|Drosophila melanogaster CG32491-PD,
           isoform D protein.
          Length = 520

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2979|AAF55883.2|  536|Drosophila melanogaster CG32491-PF,
           isoform F protein.
          Length = 536

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2978|AAN13862.1|  485|Drosophila melanogaster CG32491-PA,
           isoform A protein.
          Length = 485

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2977|AAF55882.2|  475|Drosophila melanogaster CG32491-PR,
           isoform R protein.
          Length = 475

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALFT 350
           A +G     HR +LS CSP+F  +FT
Sbjct: 37  AAEGQIVKAHRLVLSVCSPFFRKMFT 62


>AE014297-2045|AAF55197.2|  943|Drosophila melanogaster CG6118-PA
           protein.
          Length = 943

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLALF 347
           A  G  F  H+ +LS CSPYF  +F
Sbjct: 399 AAGGKIFKAHKLVLSVCSPYFQQIF 423


>AE014296-2272|AAN11836.1|  626|Drosophila melanogaster CG32121-PA
           protein.
          Length = 626

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 21/85 (24%), Positives = 35/85 (41%)
 Frame = +3

Query: 246 SSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXX 425
           S   D  + A+ G     HR +LSACS +F+ +F   L +     ++I G          
Sbjct: 30  SHLTDVTISAE-GRQLRAHRVVLSACSSFFMDIF-RALEASNHPVIIIPGASFGAIVSLL 87

Query: 426 XXXXXXXIDVTDTNVHELLMTADYL 500
                  ++V +  +  LL  A+ L
Sbjct: 88  TFMYSGEVNVYEEQIPMLLNLAETL 112


>AE013599-1140|AAO41431.1|  465|Drosophila melanogaster CG12052-PM,
           isoform M protein.
          Length = 465

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1139|AAM68768.2|  603|Drosophila melanogaster CG12052-PQ,
           isoform Q protein.
          Length = 603

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1138|AAO41430.1|  608|Drosophila melanogaster CG12052-PL,
           isoform L protein.
          Length = 608

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1137|AAF58775.3|  706|Drosophila melanogaster CG12052-PA,
           isoform A protein.
          Length = 706

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1136|AAO41429.1|  720|Drosophila melanogaster CG12052-PS,
           isoform S protein.
          Length = 720

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1135|AAZ52818.1|  665|Drosophila melanogaster CG12052-PZ,
           isoform Z protein.
          Length = 665

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1134|AAM68766.1|  748|Drosophila melanogaster CG12052-PE,
           isoform E protein.
          Length = 748

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1133|AAM68765.1|  748|Drosophila melanogaster CG12052-PD,
           isoform D protein.
          Length = 748

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1132|AAS64877.1|  549|Drosophila melanogaster CG12052-PV,
           isoform V protein.
          Length = 549

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1131|AAM68764.3|  546|Drosophila melanogaster CG12052-PK,
           isoform K protein.
          Length = 546

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1130|AAM68767.2|  565|Drosophila melanogaster CG12052-PF,
           isoform F protein.
          Length = 565

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1129|AAO41428.1|  575|Drosophila melanogaster CG12052-PU,
           isoform U protein.
          Length = 575

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1128|AAO41427.1|  575|Drosophila melanogaster CG12052-PT,
           isoform T protein.
          Length = 575

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1127|AAO41426.1|  970|Drosophila melanogaster CG12052-PI,
           isoform I protein.
          Length = 970

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1126|AAF58773.1|  787|Drosophila melanogaster CG12052-PC,
           isoform C protein.
          Length = 787

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1125|AAF58776.3|  787|Drosophila melanogaster CG12052-PB,
           isoform B protein.
          Length = 787

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1124|AAF58777.2|  518|Drosophila melanogaster CG12052-PH,
           isoform H protein.
          Length = 518

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1123|AAF58778.4|  963|Drosophila melanogaster CG12052-PP,
           isoform P protein.
          Length = 963

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1122|AAF58779.3|  757|Drosophila melanogaster CG12052-PJ,
           isoform J protein.
          Length = 757

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1121|AAO41424.2|  668|Drosophila melanogaster CG12052-PO,
           isoform O protein.
          Length = 668

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1120|AAS64876.1|  771|Drosophila melanogaster CG12052-PW,
           isoform W protein.
          Length = 771

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1119|AAF58781.3|  878|Drosophila melanogaster CG12052-PN,
           isoform N protein.
          Length = 878

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1118|AAS64875.1|  577|Drosophila melanogaster CG12052-PY,
           isoform Y protein.
          Length = 577

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1117|AAS64874.1|  602|Drosophila melanogaster CG12052-PX,
           isoform X protein.
          Length = 602

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1116|AAO41425.2|  891|Drosophila melanogaster CG12052-PR,
           isoform R protein.
          Length = 891

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AE013599-1115|AAF58782.2|  891|Drosophila melanogaster CG12052-PG,
           isoform G protein.
          Length = 891

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AB107351-1|BAC67656.1|  894|Drosophila melanogaster Lola protein
           isoform T protein.
          Length = 894

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AB107350-1|BAC67655.1|  602|Drosophila melanogaster Lola protein
           isoform S protein.
          Length = 602

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AB107349-1|BAC67654.1|  577|Drosophila melanogaster Lola protein
           isoform R protein.
          Length = 577

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AB107348-1|BAC67653.1|  771|Drosophila melanogaster Lola protein
           isoform Q protein.
          Length = 771

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AB107347-1|BAC67652.1|  668|Drosophila melanogaster Lola protein
           isoform P protein.
          Length = 668

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AB107346-1|BAC67651.1|  757|Drosophila melanogaster Lola protein
           isoform O protein.
          Length = 757

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AB107345-1|BAC67650.1|  963|Drosophila melanogaster Lola protein
           isoform N protein.
          Length = 963

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AB107344-1|BAC67649.1|  518|Drosophila melanogaster Lola protein
           isoform M protein.
          Length = 518

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AB107343-1|BAC67648.1|  786|Drosophila melanogaster Lola protein
           isoform L protein.
          Length = 786

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AB107342-1|BAC67647.1|  970|Drosophila melanogaster Lola protein
           isoform K protein.
          Length = 970

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AB107341-1|BAC67646.1|  575|Drosophila melanogaster Lola protein
           isoform J protein.
          Length = 575

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AB107340-1|BAC67645.1|  565|Drosophila melanogaster Lola protein
           isoform I protein.
          Length = 565

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AB107339-1|BAC67644.1|  546|Drosophila melanogaster Lola protein
           isoform H protein.
          Length = 546

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


>AB107338-1|BAC67643.1|  549|Drosophila melanogaster Lola protein
           isoform G protein.
          Length = 549

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 273 ADDGASFPVHRAILSACSPYFLAL 344
           A +G     H+ +LSACSPYF  L
Sbjct: 37  AAEGKFLKAHKVVLSACSPYFATL 60


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 38,435,152
Number of Sequences: 53049
Number of extensions: 835854
Number of successful extensions: 2984
Number of sequences better than 10.0: 353
Number of HSP's better than 10.0 without gapping: 2784
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2959
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4250176164
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -