SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30150.Seq
         (821 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014296-2732|AAN11752.1|  739|Drosophila melanogaster CG13035-P...    62   9e-10
AE014296-2731|AAF49466.1|  717|Drosophila melanogaster CG13035-P...    62   9e-10

>AE014296-2732|AAN11752.1|  739|Drosophila melanogaster CG13035-PB,
           isoform B protein.
          Length = 739

 Score = 62.1 bits (144), Expect = 9e-10
 Identities = 27/63 (42%), Positives = 39/63 (61%)
 Frame = +2

Query: 308 GPVWDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVXXDVFRYKCVLDQAMDDXEFLAD 487
           G  W +  +  AA+LL KPP  VDF++E EMR  +S+  DVFRYK V+  A+ D  F  +
Sbjct: 116 GARWTLPTIANAAKLLRKPPILVDFQNEHEMRLAFSLIYDVFRYKVVMSNALADVSFFEE 175

Query: 488 YPQ 496
           + +
Sbjct: 176 HTE 178


>AE014296-2731|AAF49466.1|  717|Drosophila melanogaster CG13035-PA,
           isoform A protein.
          Length = 717

 Score = 62.1 bits (144), Expect = 9e-10
 Identities = 27/63 (42%), Positives = 39/63 (61%)
 Frame = +2

Query: 308 GPVWDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVXXDVFRYKCVLDQAMDDXEFLAD 487
           G  W +  +  AA+LL KPP  VDF++E EMR  +S+  DVFRYK V+  A+ D  F  +
Sbjct: 116 GARWTLPTIANAAKLLRKPPILVDFQNEHEMRLAFSLIYDVFRYKVVMSNALADVSFFEE 175

Query: 488 YPQ 496
           + +
Sbjct: 176 HTE 178


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,556,775
Number of Sequences: 53049
Number of extensions: 548633
Number of successful extensions: 1196
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1160
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1196
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3880595628
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -