SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30149.Seq
         (867 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014296-2732|AAN11752.1|  739|Drosophila melanogaster CG13035-P...    73   4e-13
AE014296-2731|AAF49466.1|  717|Drosophila melanogaster CG13035-P...    73   4e-13
AY060861-1|AAL28409.1|  441|Drosophila melanogaster GM03427p pro...    32   0.89 
AE014297-2624|AAF55634.2| 1784|Drosophila melanogaster CG6040-PA...    30   4.7  
AY113418-1|AAM29423.1|  660|Drosophila melanogaster RE17456p pro...    29   8.3  
AF323977-1|AAL55992.1|  660|Drosophila melanogaster fused lobes ...    29   8.3  
AE013599-1505|AAM68692.1|  660|Drosophila melanogaster CG8824-PC...    29   8.3  
AE013599-1504|AAM68691.2|  673|Drosophila melanogaster CG8824-PB...    29   8.3  

>AE014296-2732|AAN11752.1|  739|Drosophila melanogaster CG13035-PB,
           isoform B protein.
          Length = 739

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 43/148 (29%), Positives = 71/148 (47%)
 Frame = +2

Query: 308 GPVWDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVIYDVFRYKCVLDQAMDDIEFLAD 487
           G  W +  +  AA+LL KPP  VDF++E EMR  +S+IYDVFRYK V+  A+ D+ F  +
Sbjct: 116 GARWTLPTIANAAKLLRKPPILVDFQNEHEMRLAFSLIYDVFRYKVVMSNALADVSFFEE 175

Query: 488 YPQYTGNVT*FGYS*WS*RDVAGRPDQGQSKNALHNYWKALDNHLRKWRTLSGKQRVHFX 667
           + +   +        +   D   +    + K+     +K  ++ + +   L  + R+   
Sbjct: 176 HTELKNDEQRIWLMLFELYDRQFKGRNSEEKDLQARLYK--ESEVTELADLLWQHRIRLA 233

Query: 668 XXXXXXXXKNXALSLSDLLPPHCVRERI 751
                   +  AL LS LLP H   E++
Sbjct: 234 ASISRMRIQVGALRLSQLLPIHLQNEKV 261


>AE014296-2731|AAF49466.1|  717|Drosophila melanogaster CG13035-PA,
           isoform A protein.
          Length = 717

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 43/148 (29%), Positives = 71/148 (47%)
 Frame = +2

Query: 308 GPVWDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVIYDVFRYKCVLDQAMDDIEFLAD 487
           G  W +  +  AA+LL KPP  VDF++E EMR  +S+IYDVFRYK V+  A+ D+ F  +
Sbjct: 116 GARWTLPTIANAAKLLRKPPILVDFQNEHEMRLAFSLIYDVFRYKVVMSNALADVSFFEE 175

Query: 488 YPQYTGNVT*FGYS*WS*RDVAGRPDQGQSKNALHNYWKALDNHLRKWRTLSGKQRVHFX 667
           + +   +        +   D   +    + K+     +K  ++ + +   L  + R+   
Sbjct: 176 HTELKNDEQRIWLMLFELYDRQFKGRNSEEKDLQARLYK--ESEVTELADLLWQHRIRLA 233

Query: 668 XXXXXXXXKNXALSLSDLLPPHCVRERI 751
                   +  AL LS LLP H   E++
Sbjct: 234 ASISRMRIQVGALRLSQLLPIHLQNEKV 261


>AY060861-1|AAL28409.1|  441|Drosophila melanogaster GM03427p
           protein.
          Length = 441

 Score = 32.3 bits (70), Expect = 0.89
 Identities = 16/40 (40%), Positives = 26/40 (65%)
 Frame = -3

Query: 568 LVWPPSDVSLTPSGIAKLCDVAGVLWVVSQELNIVHGLVQ 449
           ++W PSDV+LT  G AK  ++A   W+  +   ++HGLV+
Sbjct: 360 VLWGPSDVALT--GSAKERELALQRWLDLERATVLHGLVR 397


>AE014297-2624|AAF55634.2| 1784|Drosophila melanogaster CG6040-PA
            protein.
          Length = 1784

 Score = 29.9 bits (64), Expect = 4.7
 Identities = 15/40 (37%), Positives = 25/40 (62%)
 Frame = -3

Query: 568  LVWPPSDVSLTPSGIAKLCDVAGVLWVVSQELNIVHGLVQ 449
            ++W PSDV+LT  G AK  ++    W+  +   ++HGLV+
Sbjct: 1703 VLWGPSDVALT--GSAKERELDLQRWLDLERATVLHGLVR 1740


>AY113418-1|AAM29423.1|  660|Drosophila melanogaster RE17456p
           protein.
          Length = 660

 Score = 29.1 bits (62), Expect = 8.3
 Identities = 23/79 (29%), Positives = 29/79 (36%)
 Frame = +3

Query: 261 LRRILMHHHRFPLKLPAQFGTSDRS*KRLVFSASHHSKSISRTNKKCVSFILLFMTFSDI 440
           L R   HH      +P +   + +          HH KS  R     VSFI   MT  D+
Sbjct: 41  LERPHSHHDASGFPIPVEKSWTYKCENDRCMRVGHHGKSAKR-----VSFISCSMTCGDV 95

Query: 441 NVSWTRPWTILSSWLTTHS 497
           N+ W  P         THS
Sbjct: 96  NI-WPHPTQKFLLSSQTHS 113


>AF323977-1|AAL55992.1|  660|Drosophila melanogaster fused lobes
           protein.
          Length = 660

 Score = 29.1 bits (62), Expect = 8.3
 Identities = 23/79 (29%), Positives = 29/79 (36%)
 Frame = +3

Query: 261 LRRILMHHHRFPLKLPAQFGTSDRS*KRLVFSASHHSKSISRTNKKCVSFILLFMTFSDI 440
           L R   HH      +P +   + +          HH KS  R     VSFI   MT  D+
Sbjct: 41  LERPHSHHDASGFPIPVEKSWTYKCENDRCMRVGHHGKSAKR-----VSFISCSMTCGDV 95

Query: 441 NVSWTRPWTILSSWLTTHS 497
           N+ W  P         THS
Sbjct: 96  NI-WPHPTQKFLLSSQTHS 113


>AE013599-1505|AAM68692.1|  660|Drosophila melanogaster CG8824-PC,
           isoform C protein.
          Length = 660

 Score = 29.1 bits (62), Expect = 8.3
 Identities = 23/79 (29%), Positives = 29/79 (36%)
 Frame = +3

Query: 261 LRRILMHHHRFPLKLPAQFGTSDRS*KRLVFSASHHSKSISRTNKKCVSFILLFMTFSDI 440
           L R   HH      +P +   + +          HH KS  R     VSFI   MT  D+
Sbjct: 41  LERPHSHHDASGFPIPVEKSWTYKCENDRCMRVGHHGKSAKR-----VSFISCSMTCGDV 95

Query: 441 NVSWTRPWTILSSWLTTHS 497
           N+ W  P         THS
Sbjct: 96  NI-WPHPTQKFLLSSQTHS 113


>AE013599-1504|AAM68691.2|  673|Drosophila melanogaster CG8824-PB,
           isoform B protein.
          Length = 673

 Score = 29.1 bits (62), Expect = 8.3
 Identities = 23/79 (29%), Positives = 29/79 (36%)
 Frame = +3

Query: 261 LRRILMHHHRFPLKLPAQFGTSDRS*KRLVFSASHHSKSISRTNKKCVSFILLFMTFSDI 440
           L R   HH      +P +   + +          HH KS  R     VSFI   MT  D+
Sbjct: 54  LERPHSHHDASGFPIPVEKSWTYKCENDRCMRVGHHGKSAKR-----VSFISCSMTCGDV 108

Query: 441 NVSWTRPWTILSSWLTTHS 497
           N+ W  P         THS
Sbjct: 109 NI-WPHPTQKFLLSSQTHS 126


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 37,173,632
Number of Sequences: 53049
Number of extensions: 770345
Number of successful extensions: 1783
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1713
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1781
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4188579408
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -