SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30148.Seq
         (812 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY069481-1|AAL39626.1|  390|Drosophila melanogaster LD21662p pro...    30   3.3  
AE014296-1620|AAF50294.1|  390|Drosophila melanogaster CG4452-PA...    30   3.3  
M74078-1|AAA28498.1|  878|Drosophila melanogaster ecdysone recep...    29   5.7  
BT015234-1|AAT94463.1|  878|Drosophila melanogaster RE06878p pro...    29   5.7  
BT012469-1|AAS93740.1|  878|Drosophila melanogaster RE33854p pro...    29   5.7  
AY075461-1|AAL68274.1|  872|Drosophila melanogaster RE16656p pro...    29   5.7  
AE013599-153|AAF57280.2|  878|Drosophila melanogaster CG1765-PB,...    29   5.7  
AE013599-152|AAM68347.1|  669|Drosophila melanogaster CG1765-PC,...    29   5.7  
AE013599-151|AAM68346.1|  849|Drosophila melanogaster CG1765-PE,...    29   5.7  
AE013599-150|AAG22334.2|  849|Drosophila melanogaster CG1765-PD,...    29   5.7  
AE013599-149|AAF57278.3|  849|Drosophila melanogaster CG1765-PA,...    29   5.7  

>AY069481-1|AAL39626.1|  390|Drosophila melanogaster LD21662p
           protein.
          Length = 390

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = -2

Query: 640 SGRFLFRCCLRFSCYFGSSCHSGACVCRGCSG 545
           SG+ LF C   FS +      SG  +C+GC G
Sbjct: 2   SGKVLFACSKCFSRHLYEELSSGQQLCKGCRG 33


>AE014296-1620|AAF50294.1|  390|Drosophila melanogaster CG4452-PA,
           isoform A protein.
          Length = 390

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = -2

Query: 640 SGRFLFRCCLRFSCYFGSSCHSGACVCRGCSG 545
           SG+ LF C   FS +      SG  +C+GC G
Sbjct: 2   SGKVLFACSKCFSRHLYEELSSGQQLCKGCRG 33


>M74078-1|AAA28498.1|  878|Drosophila melanogaster ecdysone receptor
           protein.
          Length = 878

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 15/34 (44%), Positives = 17/34 (50%)
 Frame = -2

Query: 589 SSCHSGACVCRGCSGYGGF*RRSLTSSTFACRKY 488
           S  H  A  C GC G   F RRS+T S   C K+
Sbjct: 272 SGYHYNALTCEGCKG---FFRRSVTKSAVYCCKF 302


>BT015234-1|AAT94463.1|  878|Drosophila melanogaster RE06878p
           protein.
          Length = 878

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 15/34 (44%), Positives = 17/34 (50%)
 Frame = -2

Query: 589 SSCHSGACVCRGCSGYGGF*RRSLTSSTFACRKY 488
           S  H  A  C GC G   F RRS+T S   C K+
Sbjct: 272 SGYHYNALTCEGCKG---FFRRSVTKSAVYCCKF 302


>BT012469-1|AAS93740.1|  878|Drosophila melanogaster RE33854p
           protein.
          Length = 878

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 15/34 (44%), Positives = 17/34 (50%)
 Frame = -2

Query: 589 SSCHSGACVCRGCSGYGGF*RRSLTSSTFACRKY 488
           S  H  A  C GC G   F RRS+T S   C K+
Sbjct: 272 SGYHYNALTCEGCKG---FFRRSVTKSAVYCCKF 302


>AY075461-1|AAL68274.1|  872|Drosophila melanogaster RE16656p
           protein.
          Length = 872

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 15/34 (44%), Positives = 17/34 (50%)
 Frame = -2

Query: 589 SSCHSGACVCRGCSGYGGF*RRSLTSSTFACRKY 488
           S  H  A  C GC G   F RRS+T S   C K+
Sbjct: 243 SGYHYNALTCEGCKG---FFRRSVTKSAVYCCKF 273


>AE013599-153|AAF57280.2|  878|Drosophila melanogaster CG1765-PB,
           isoform B protein.
          Length = 878

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 15/34 (44%), Positives = 17/34 (50%)
 Frame = -2

Query: 589 SSCHSGACVCRGCSGYGGF*RRSLTSSTFACRKY 488
           S  H  A  C GC G   F RRS+T S   C K+
Sbjct: 272 SGYHYNALTCEGCKG---FFRRSVTKSAVYCCKF 302


>AE013599-152|AAM68347.1|  669|Drosophila melanogaster CG1765-PC,
           isoform C protein.
          Length = 669

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 15/34 (44%), Positives = 17/34 (50%)
 Frame = -2

Query: 589 SSCHSGACVCRGCSGYGGF*RRSLTSSTFACRKY 488
           S  H  A  C GC G   F RRS+T S   C K+
Sbjct: 63  SGYHYNALTCEGCKG---FFRRSVTKSAVYCCKF 93


>AE013599-151|AAM68346.1|  849|Drosophila melanogaster CG1765-PE,
           isoform E protein.
          Length = 849

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 15/34 (44%), Positives = 17/34 (50%)
 Frame = -2

Query: 589 SSCHSGACVCRGCSGYGGF*RRSLTSSTFACRKY 488
           S  H  A  C GC G   F RRS+T S   C K+
Sbjct: 243 SGYHYNALTCEGCKG---FFRRSVTKSAVYCCKF 273


>AE013599-150|AAG22334.2|  849|Drosophila melanogaster CG1765-PD,
           isoform D protein.
          Length = 849

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 15/34 (44%), Positives = 17/34 (50%)
 Frame = -2

Query: 589 SSCHSGACVCRGCSGYGGF*RRSLTSSTFACRKY 488
           S  H  A  C GC G   F RRS+T S   C K+
Sbjct: 243 SGYHYNALTCEGCKG---FFRRSVTKSAVYCCKF 273


>AE013599-149|AAF57278.3|  849|Drosophila melanogaster CG1765-PA,
           isoform A protein.
          Length = 849

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 15/34 (44%), Positives = 17/34 (50%)
 Frame = -2

Query: 589 SSCHSGACVCRGCSGYGGF*RRSLTSSTFACRKY 488
           S  H  A  C GC G   F RRS+T S   C K+
Sbjct: 243 SGYHYNALTCEGCKG---FFRRSVTKSAVYCCKF 273


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,209,875
Number of Sequences: 53049
Number of extensions: 618862
Number of successful extensions: 1657
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1555
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1648
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3818998872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -