SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30147.Seq
         (878 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT015202-1|AAT94431.1|  462|Drosophila melanogaster RE68984p pro...   303   1e-82
AE014297-4793|AAS65236.1|  462|Drosophila melanogaster CG1873-PD...   303   1e-82
AE014297-4792|AAS65235.1|  462|Drosophila melanogaster CG1873-PC...   303   1e-82
AE014297-4791|AAN14285.1|  462|Drosophila melanogaster CG1873-PB...   303   1e-82
AE014297-4790|AAF57185.1|  462|Drosophila melanogaster CG1873-PA...   303   1e-82
X06870-1|CAA29994.1|  462|Drosophila melanogaster EF-1-alpha pro...   301   1e-81
BT011039-1|AAR30199.1|  463|Drosophila melanogaster LP10071p pro...   298   6e-81
AE013599-1358|AAM68698.1|  463|Drosophila melanogaster CG8280-PB...   298   6e-81
AE013599-1357|AAF58608.1|  463|Drosophila melanogaster CG8280-PA...   298   6e-81
X06869-1|CAA29993.1|  463|Drosophila melanogaster EF-1-alpha pro...   287   1e-77
M11744-1|AAA28526.1|  463|Drosophila melanogaster protein ( D.me...   287   1e-77
BT001873-1|AAN71645.1|  362|Drosophila melanogaster SD08285p pro...   236   3e-62
AY089522-1|AAL90260.1|  362|Drosophila melanogaster GM14559p pro...   236   3e-62
U88868-1|AAC24943.1|  619|Drosophila melanogaster elongation fac...   127   2e-29
AY070979-1|AAL48601.1|  619|Drosophila melanogaster RE07731p pro...   126   4e-29
AE014134-2205|AAF53194.1|  619|Drosophila melanogaster CG6382-PA...   126   4e-29
BT003766-1|AAO41445.1|  670|Drosophila melanogaster RE29053p pro...   112   7e-25
AE014296-376|AAF47584.2|  670|Drosophila melanogaster CG1898-PA ...   112   7e-25
BT003749-1|AAO41413.1|  489|Drosophila melanogaster RH68252p pro...    73   4e-13
AY058493-1|AAL13722.1|  300|Drosophila melanogaster GM14682p pro...    73   4e-13
AE013599-1732|AAF58366.1|  489|Drosophila melanogaster CG6050-PA...    73   4e-13
BT010319-1|AAQ23637.1|  456|Drosophila melanogaster AT01345p pro...    68   1e-11
AY058330-1|AAL13559.1|  456|Drosophila melanogaster GH10272p pro...    68   1e-11
AE013599-436|AAF59240.1|  456|Drosophila melanogaster CG12736-PA...    68   1e-11
AY119138-1|AAM50998.1|  696|Drosophila melanogaster RE37995p pro...    44   3e-04
AE014297-4239|AAF56796.2|  696|Drosophila melanogaster CG12413-P...    43   5e-04
AY071627-1|AAL49249.1|  511|Drosophila melanogaster RE67487p pro...    41   0.003
AE013599-3196|AAF46721.1|  511|Drosophila melanogaster CG9841-PA...    41   0.003
X80069-1|CAA56375.1|  475|Drosophila melanogaster 51KDa protein ...    38   0.014
BT012446-1|AAS93717.1|  467|Drosophila melanogaster RE71279p pro...    38   0.014
AY061102-1|AAL28650.1|  475|Drosophila melanogaster LD09025p pro...    38   0.014
AJ290956-1|CAB93767.1|  475|Drosophila melanogaster eukaryotic t...    38   0.014
AE014297-1977|AAN13641.1|  467|Drosophila melanogaster CG6476-PC...    38   0.014
AE014297-1976|AAF55153.1|  475|Drosophila melanogaster CG6476-PB...    38   0.014
X15805-1|CAA33804.1|  844|Drosophila melanogaster protein ( Dros...    34   0.30 
AY075481-1|AAL68292.1|  844|Drosophila melanogaster RE38659p pro...    34   0.30 
AE014134-3534|AAN11135.1|  832|Drosophila melanogaster CG2238-PC...    34   0.30 
AE014134-3533|AAG22125.2|  832|Drosophila melanogaster CG2238-PB...    34   0.30 
AE014134-3532|AAF57226.2|  844|Drosophila melanogaster CG2238-PA...    34   0.30 
AY058769-1|AAL13998.1|  949|Drosophila melanogaster SD04694p pro...    32   1.2  
AE014296-2740|AAF49461.3| 1033|Drosophila melanogaster CG33158-P...    32   1.2  
BT023763-1|AAZ41771.1|  639|Drosophila melanogaster RE37786p pro...    31   2.1  
AE014134-1251|AAF52495.2|  745|Drosophila melanogaster CG4567-PA...    31   2.1  
AE014297-3196|AAF56031.2|  692|Drosophila melanogaster CG31159-P...    31   2.8  
BT003552-1|AAO39556.1|  676|Drosophila melanogaster LP12382p pro...    30   4.8  
AF017777-7|AAC28402.1|  679|Drosophila melanogaster waclaw protein.    30   4.8  
AE014298-3127|AAF50824.2|  696|Drosophila melanogaster CG1410-PA...    30   4.8  
BT023767-1|AAZ41775.1| 1144|Drosophila melanogaster RE11051p pro...    29   6.4  
AF143207-1|AAF36532.1| 1144|Drosophila melanogaster IF2 protein ...    29   6.4  
AE014296-661|AAF47774.2| 1144|Drosophila melanogaster CG10840-PB...    29   6.4  

>BT015202-1|AAT94431.1|  462|Drosophila melanogaster RE68984p
           protein.
          Length = 462

 Score =  303 bits (745), Expect = 1e-82
 Identities = 144/195 (73%), Positives = 157/195 (80%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ
Sbjct: 73  IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQLIVGVNKMDS           + +++     +++GYNPA+VAFVP
Sbjct: 133 TREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPS KMPWFKGW VERKEGKA+GKCLI+ALDAILPP RP   P   P + 
Sbjct: 193 ISGWHGDNMLEPSEKMPWFKGWSVERKEGKAEGKCLIDALDAILPPQRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AE014297-4793|AAS65236.1|  462|Drosophila melanogaster CG1873-PD,
           isoform D protein.
          Length = 462

 Score =  303 bits (745), Expect = 1e-82
 Identities = 144/195 (73%), Positives = 157/195 (80%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ
Sbjct: 73  IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQLIVGVNKMDS           + +++     +++GYNPA+VAFVP
Sbjct: 133 TREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPS KMPWFKGW VERKEGKA+GKCLI+ALDAILPP RP   P   P + 
Sbjct: 193 ISGWHGDNMLEPSEKMPWFKGWSVERKEGKAEGKCLIDALDAILPPQRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AE014297-4792|AAS65235.1|  462|Drosophila melanogaster CG1873-PC,
           isoform C protein.
          Length = 462

 Score =  303 bits (745), Expect = 1e-82
 Identities = 144/195 (73%), Positives = 157/195 (80%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ
Sbjct: 73  IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQLIVGVNKMDS           + +++     +++GYNPA+VAFVP
Sbjct: 133 TREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPS KMPWFKGW VERKEGKA+GKCLI+ALDAILPP RP   P   P + 
Sbjct: 193 ISGWHGDNMLEPSEKMPWFKGWSVERKEGKAEGKCLIDALDAILPPQRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AE014297-4791|AAN14285.1|  462|Drosophila melanogaster CG1873-PB,
           isoform B protein.
          Length = 462

 Score =  303 bits (745), Expect = 1e-82
 Identities = 144/195 (73%), Positives = 157/195 (80%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ
Sbjct: 73  IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQLIVGVNKMDS           + +++     +++GYNPA+VAFVP
Sbjct: 133 TREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPS KMPWFKGW VERKEGKA+GKCLI+ALDAILPP RP   P   P + 
Sbjct: 193 ISGWHGDNMLEPSEKMPWFKGWSVERKEGKAEGKCLIDALDAILPPQRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AE014297-4790|AAF57185.1|  462|Drosophila melanogaster CG1873-PA,
           isoform A protein.
          Length = 462

 Score =  303 bits (745), Expect = 1e-82
 Identities = 144/195 (73%), Positives = 157/195 (80%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ
Sbjct: 73  IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQLIVGVNKMDS           + +++     +++GYNPA+VAFVP
Sbjct: 133 TREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPS KMPWFKGW VERKEGKA+GKCLI+ALDAILPP RP   P   P + 
Sbjct: 193 ISGWHGDNMLEPSEKMPWFKGWSVERKEGKAEGKCLIDALDAILPPQRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>X06870-1|CAA29994.1|  462|Drosophila melanogaster EF-1-alpha
           protein.
          Length = 462

 Score =  301 bits (738), Expect = 1e-81
 Identities = 143/195 (73%), Positives = 156/195 (80%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLI AAGTGEFEAGISKNGQ
Sbjct: 73  IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIDAAGTGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQLIVGVNKMDS           + +++     +++GYNPA+VAFVP
Sbjct: 133 TREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPS KMPWFKGW VERKEGKA+GKCLI+ALDAILPP RP   P   P + 
Sbjct: 193 ISGWHGDNMLEPSEKMPWFKGWSVERKEGKAEGKCLIDALDAILPPQRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BT011039-1|AAR30199.1|  463|Drosophila melanogaster LP10071p
           protein.
          Length = 463

 Score =  298 bits (732), Expect = 6e-81
 Identities = 143/195 (73%), Positives = 156/195 (80%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ
Sbjct: 73  IDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQLIVGVNKMDS           + +++     +++GYNPAAVAFVP
Sbjct: 133 TREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPST MPWFKGW+VERKEG ADGK LI+ALDAILPPARP       P + 
Sbjct: 193 ISGWHGDNMLEPSTNMPWFKGWKVERKEGNADGKTLIDALDAILPPARPTDKALRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AE013599-1358|AAM68698.1|  463|Drosophila melanogaster CG8280-PB,
           isoform B protein.
          Length = 463

 Score =  298 bits (732), Expect = 6e-81
 Identities = 143/195 (73%), Positives = 156/195 (80%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ
Sbjct: 73  IDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQLIVGVNKMDS           + +++     +++GYNPAAVAFVP
Sbjct: 133 TREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPST MPWFKGW+VERKEG ADGK LI+ALDAILPPARP       P + 
Sbjct: 193 ISGWHGDNMLEPSTNMPWFKGWKVERKEGNADGKTLIDALDAILPPARPTDKALRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AE013599-1357|AAF58608.1|  463|Drosophila melanogaster CG8280-PA,
           isoform A protein.
          Length = 463

 Score =  298 bits (732), Expect = 6e-81
 Identities = 143/195 (73%), Positives = 156/195 (80%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ
Sbjct: 73  IDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQLIVGVNKMDS           + +++     +++GYNPAAVAFVP
Sbjct: 133 TREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPST MPWFKGW+VERKEG ADGK LI+ALDAILPPARP       P + 
Sbjct: 193 ISGWHGDNMLEPSTNMPWFKGWKVERKEGNADGKTLIDALDAILPPARPTDKALRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>X06869-1|CAA29993.1|  463|Drosophila melanogaster EF-1-alpha
           protein.
          Length = 463

 Score =  287 bits (704), Expect = 1e-77
 Identities = 138/195 (70%), Positives = 152/195 (77%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KYYVTIIDAPGHRDFIKNMITGTSQADCAV I AAGTGEFEAGISKN Q
Sbjct: 73  IDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVQIDAAGTGEFEAGISKNDQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQLIVGVNKMDS           + +++     +++GYNPAAVAFVP
Sbjct: 133 TREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKVGYNPAAVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPST MPWFKGW+V RKEG ADGK L++ALDAILPPARP       P + 
Sbjct: 193 ISGWHGDNMLEPSTNMPWFKGWEVGRKEGNADGKTLVDALDAILPPARPTDKALRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>M11744-1|AAA28526.1|  463|Drosophila melanogaster protein (
           D.melanogaster 50 kDaprotein F1 gene, complete cds. ).
          Length = 463

 Score =  287 bits (704), Expect = 1e-77
 Identities = 138/195 (70%), Positives = 152/195 (77%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KYYVTIIDAPGHRDFIKNMITGTSQADCAV I AAGTGEFEAGISKN Q
Sbjct: 73  IDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVQIDAAGTGEFEAGISKNDQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQLIVGVNKMDS           + +++     +++GYNPAAVAFVP
Sbjct: 133 TREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKVGYNPAAVAFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPST MPWFKGW+V RKEG ADGK L++ALDAILPPARP       P + 
Sbjct: 193 ISGWHGDNMLEPSTNMPWFKGWEVGRKEGNADGKTLVDALDAILPPARPTDKALRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BT001873-1|AAN71645.1|  362|Drosophila melanogaster SD08285p
           protein.
          Length = 362

 Score =  236 bits (578), Expect = 3e-62
 Identities = 115/166 (69%), Positives = 127/166 (76%)
 Frame = +1

Query: 343 MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSLNHH 522
           MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDS    
Sbjct: 1   MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPP 60

Query: 523 TVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEG 702
                  + +++     +++GYNPAAVAFVPISGWHGDNMLEPST MPWFKGW+VERKEG
Sbjct: 61  YSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEG 120

Query: 703 KADGKCLIEALDAILPPARPLTSPCVFPARRIXNSVVXVPCPSGRI 840
            ADGK LI+ALDAILPPARP       P + +         P GR+
Sbjct: 121 NADGKTLIDALDAILPPARPTDKALRLPLQDVYKIGGIGTVPVGRV 166


>AY089522-1|AAL90260.1|  362|Drosophila melanogaster GM14559p
           protein.
          Length = 362

 Score =  236 bits (578), Expect = 3e-62
 Identities = 115/166 (69%), Positives = 127/166 (76%)
 Frame = +1

Query: 343 MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSLNHH 522
           MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDS    
Sbjct: 1   MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPP 60

Query: 523 TVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEG 702
                  + +++     +++GYNPAAVAFVPISGWHGDNMLEPST MPWFKGW+VERKEG
Sbjct: 61  YSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEG 120

Query: 703 KADGKCLIEALDAILPPARPLTSPCVFPARRIXNSVVXVPCPSGRI 840
            ADGK LI+ALDAILPPARP       P + +         P GR+
Sbjct: 121 NADGKTLIDALDAILPPARPTDKALRLPLQDVYKIGGIGTVPVGRV 166


>U88868-1|AAC24943.1|  619|Drosophila melanogaster elongation factor
           1 alpha-likefactor protein.
          Length = 619

 Score =  127 bits (306), Expect = 2e-29
 Identities = 63/137 (45%), Positives = 87/137 (63%), Gaps = 3/137 (2%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 456
           FET + + TI+DAPGH+ F+ NMI G +QAD AVL+++A  GEFE G  + GQTREHA+L
Sbjct: 268 FETDRKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEFETGFDRGGQTREHAML 327

Query: 457 AFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA-VAFVPISGWHG 633
           A T GVK L+V VNKMD    +       + + K     ++LG+NPA  + F+P SG  G
Sbjct: 328 AKTAGVKHLVVLVNKMDDPTVNWDQTRYNECKDKILPYLKKLGFNPAKDLTFMPCSGLSG 387

Query: 634 DNMLE--PSTKMPWFKG 678
             + +  P T  PW++G
Sbjct: 388 TGLKDQIPETLCPWYRG 404



 Score = 68.5 bits (160), Expect = 1e-11
 Identities = 29/65 (44%), Positives = 46/65 (70%)
 Frame = +3

Query: 51  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 230
           ++ H+N+V IGHVD+GKST  G ++   G + KRT+EK+E+EA+E  + S+  +W LD  
Sbjct: 192 KREHVNVVFIGHVDAGKSTIGGQIMSLTGMVHKRTLEKYEREAREKSRESWYLSWGLDTN 251

Query: 231 KAERE 245
           + ER+
Sbjct: 252 QEERD 256


>AY070979-1|AAL48601.1|  619|Drosophila melanogaster RE07731p
           protein.
          Length = 619

 Score =  126 bits (304), Expect = 4e-29
 Identities = 63/137 (45%), Positives = 87/137 (63%), Gaps = 3/137 (2%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 456
           FET + + TI+DAPGH+ F+ NMI G +QAD AVL+++A  GEFE G  + GQTREHA+L
Sbjct: 268 FETDRKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEFETGFDRGGQTREHAML 327

Query: 457 AFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA-VAFVPISGWHG 633
           A T GVK L+V VNKMD    +       + + K     ++LG+NPA  + F+P SG  G
Sbjct: 328 AKTAGVKHLVVLVNKMDDPTVNWDQTRYNECKDKILPYLKKLGFNPAKDLTFMPCSGLSG 387

Query: 634 DNMLE--PSTKMPWFKG 678
             + +  P T  PW++G
Sbjct: 388 YGLKDQIPETLCPWYRG 404



 Score = 72.5 bits (170), Expect = 7e-13
 Identities = 30/65 (46%), Positives = 47/65 (72%)
 Frame = +3

Query: 51  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 230
           ++ H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  + S+  +W LD  
Sbjct: 192 KREHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSRESWYLSWALDTN 251

Query: 231 KAERE 245
           + ER+
Sbjct: 252 QEERD 256


>AE014134-2205|AAF53194.1|  619|Drosophila melanogaster CG6382-PA
           protein.
          Length = 619

 Score =  126 bits (304), Expect = 4e-29
 Identities = 63/137 (45%), Positives = 87/137 (63%), Gaps = 3/137 (2%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 456
           FET + + TI+DAPGH+ F+ NMI G +QAD AVL+++A  GEFE G  + GQTREHA+L
Sbjct: 268 FETDRKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEFETGFDRGGQTREHAML 327

Query: 457 AFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA-VAFVPISGWHG 633
           A T GVK L+V VNKMD    +       + + K     ++LG+NPA  + F+P SG  G
Sbjct: 328 AKTAGVKHLVVLVNKMDDPTVNWDQTRYNECKDKILPYLKKLGFNPAKDLTFMPCSGLSG 387

Query: 634 DNMLE--PSTKMPWFKG 678
             + +  P T  PW++G
Sbjct: 388 YGLKDQIPETLCPWYRG 404



 Score = 72.5 bits (170), Expect = 7e-13
 Identities = 30/65 (46%), Positives = 47/65 (72%)
 Frame = +3

Query: 51  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 230
           ++ H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  + S+  +W LD  
Sbjct: 192 KREHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSRESWYLSWALDTN 251

Query: 231 KAERE 245
           + ER+
Sbjct: 252 QEERD 256


>BT003766-1|AAO41445.1|  670|Drosophila melanogaster RE29053p
           protein.
          Length = 670

 Score =  112 bits (269), Expect = 7e-25
 Identities = 67/195 (34%), Positives = 101/195 (51%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D+   + ET    VT++DAPGH+DFI NMI+G +QAD A+L+V A  GEFE+G    GQ
Sbjct: 313 MDVGQSRIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVVDATRGEFESGFELGGQ 372

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHA+L  +LGV QL V +NK+D++          +   K     +  G+  + V+F P
Sbjct: 373 TREHAILVRSLGVNQLGVVINKLDTVGWS--QDRFTEIVTKLKSFLKLAGFKDSDVSFTP 430

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
            SG  G+N+ + + + P    W          G+ L++ ++    P R +  P       
Sbjct: 431 CSGLTGENLTKKAQE-PALTNWY--------SGRHLLDVIENFKIPERAIDRPLRMSVSD 481

Query: 796 IXNSVVXVPCPSGRI 840
           I        C SGR+
Sbjct: 482 IYKGTGSGFCISGRV 496



 Score = 83.8 bits (198), Expect = 3e-16
 Identities = 34/64 (53%), Positives = 50/64 (78%)
 Frame = +3

Query: 51  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 230
           +K+HI+++VIGHVD+GKST  GHL+Y  G + +R + K E+E++++GK SF YAWVLD+ 
Sbjct: 244 QKSHIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDET 303

Query: 231 KAER 242
             ER
Sbjct: 304 GEER 307


>AE014296-376|AAF47584.2|  670|Drosophila melanogaster CG1898-PA
           protein.
          Length = 670

 Score =  112 bits (269), Expect = 7e-25
 Identities = 67/195 (34%), Positives = 101/195 (51%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D+   + ET    VT++DAPGH+DFI NMI+G +QAD A+L+V A  GEFE+G    GQ
Sbjct: 313 MDVGQSRIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVVDATRGEFESGFELGGQ 372

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHA+L  +LGV QL V +NK+D++          +   K     +  G+  + V+F P
Sbjct: 373 TREHAILVRSLGVNQLGVVINKLDTVGWS--QDRFTEIVTKLKSFLKLAGFKDSDVSFTP 430

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
            SG  G+N+ + + + P    W          G+ L++ ++    P R +  P       
Sbjct: 431 CSGLTGENLTKKAQE-PALTNWY--------SGRHLLDVIENFKIPERAIDRPLRMSVSD 481

Query: 796 IXNSVVXVPCPSGRI 840
           I        C SGR+
Sbjct: 482 IYKGTGSGFCISGRV 496



 Score = 83.8 bits (198), Expect = 3e-16
 Identities = 34/64 (53%), Positives = 50/64 (78%)
 Frame = +3

Query: 51  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 230
           +K+HI+++VIGHVD+GKST  GHL+Y  G + +R + K E+E++++GK SF YAWVLD+ 
Sbjct: 244 QKSHIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDET 303

Query: 231 KAER 242
             ER
Sbjct: 304 GEER 307


>BT003749-1|AAO41413.1|  489|Drosophila melanogaster RH68252p
           protein.
          Length = 489

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 38/91 (41%), Positives = 56/91 (61%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I++A  +++T   +    D PGH D+IKNMITGT+Q D A+L+VAA  G          Q
Sbjct: 133 INVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMP-------Q 185

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTV 528
           TREH LLA  +G+  ++V +NK+D+ +   V
Sbjct: 186 TREHMLLAKQIGIDHIVVFINKVDAADEEMV 216



 Score = 30.7 bits (66), Expect = 2.8
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTT 113
           + K H N+  IGHVD GK+T T
Sbjct: 78  RTKPHCNVGTIGHVDHGKTTLT 99


>AY058493-1|AAL13722.1|  300|Drosophila melanogaster GM14682p
           protein.
          Length = 300

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 38/91 (41%), Positives = 56/91 (61%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I++A  +++T   +    D PGH D+IKNMITGT+Q D A+L+VAA  G          Q
Sbjct: 133 INVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMP-------Q 185

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTV 528
           TREH LLA  +G+  ++V +NK+D+ +   V
Sbjct: 186 TREHMLLAKQIGIDHIVVFINKVDAADEEMV 216



 Score = 30.7 bits (66), Expect = 2.8
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTT 113
           + K H N+  IGHVD GK+T T
Sbjct: 78  RTKPHCNVGTIGHVDHGKTTLT 99


>AE013599-1732|AAF58366.1|  489|Drosophila melanogaster CG6050-PA
           protein.
          Length = 489

 Score = 73.3 bits (172), Expect = 4e-13
 Identities = 38/91 (41%), Positives = 56/91 (61%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I++A  +++T   +    D PGH D+IKNMITGT+Q D A+L+VAA  G          Q
Sbjct: 133 INVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMP-------Q 185

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTV 528
           TREH LLA  +G+  ++V +NK+D+ +   V
Sbjct: 186 TREHMLLAKQIGIDHIVVFINKVDAADEEMV 216



 Score = 30.7 bits (66), Expect = 2.8
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTT 113
           + K H N+  IGHVD GK+T T
Sbjct: 78  RTKPHCNVGTIGHVDHGKTTLT 99


>BT010319-1|AAQ23637.1|  456|Drosophila melanogaster AT01345p
           protein.
          Length = 456

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 35/84 (41%), Positives = 52/84 (61%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 456
           + T++      D PGH D+IKNMI+G SQ D A+L+VAA  G+         QTREH LL
Sbjct: 115 YSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMP-------QTREHLLL 167

Query: 457 AFTLGVKQLIVGVNKMDSLNHHTV 528
           A  +G++++IV +NK D ++   +
Sbjct: 168 AKQVGIQRIIVFINKADLVDQEVL 191



 Score = 30.3 bits (65), Expect = 3.7
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTT 113
           +E  H N+  IGHVD GK+T T
Sbjct: 53  RELPHCNVGTIGHVDHGKTTLT 74


>AY058330-1|AAL13559.1|  456|Drosophila melanogaster GH10272p
           protein.
          Length = 456

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 35/84 (41%), Positives = 52/84 (61%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 456
           + T++      D PGH D+IKNMI+G SQ D A+L+VAA  G+         QTREH LL
Sbjct: 115 YSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMP-------QTREHLLL 167

Query: 457 AFTLGVKQLIVGVNKMDSLNHHTV 528
           A  +G++++IV +NK D ++   +
Sbjct: 168 AKQVGIQRIIVFINKADLVDQEVL 191



 Score = 30.3 bits (65), Expect = 3.7
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTT 113
           +E  H N+  IGHVD GK+T T
Sbjct: 53  RELPHCNVGTIGHVDHGKTTLT 74


>AE013599-436|AAF59240.1|  456|Drosophila melanogaster CG12736-PA
           protein.
          Length = 456

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 35/84 (41%), Positives = 52/84 (61%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 456
           + T++      D PGH D+IKNMI+G SQ D A+L+VAA  G+         QTREH LL
Sbjct: 115 YSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMP-------QTREHLLL 167

Query: 457 AFTLGVKQLIVGVNKMDSLNHHTV 528
           A  +G++++IV +NK D ++   +
Sbjct: 168 AKQVGIQRIIVFINKADLVDQEVL 191



 Score = 30.3 bits (65), Expect = 3.7
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTT 113
           +E  H N+  IGHVD GK+T T
Sbjct: 53  RELPHCNVGTIGHVDHGKTTLT 74


>AY119138-1|AAM50998.1|  696|Drosophila melanogaster RE37995p
           protein.
          Length = 696

 Score = 44.0 bits (99), Expect = 3e-04
 Identities = 38/115 (33%), Positives = 52/115 (45%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           VT +D PGH  F      G    D  VL+VAA     E G+    QTRE   LA    V 
Sbjct: 212 VTFLDTPGHAAFSAMRARGAVATDIIVLVVAA-----EDGVM--AQTREVIQLAKEAQV- 263

Query: 478 QLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNM 642
            +IV +NK+D         +++KS+R+       L  +   V  +PIS   G N+
Sbjct: 264 PIIVALNKIDK-----PEANIKKSKRELAQMGLALEEHGGDVQVIPISALKGTNL 313


>AE014297-4239|AAF56796.2|  696|Drosophila melanogaster CG12413-PA
           protein.
          Length = 696

 Score = 43.2 bits (97), Expect = 5e-04
 Identities = 38/115 (33%), Positives = 51/115 (44%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           VT +D PGH  F      G    D  VL+VAA     E G+    QTRE   LA    V 
Sbjct: 212 VTFLDTPGHAAFSAMRARGAVATDIIVLVVAA-----EDGVM--AQTREVIQLAKEAQV- 263

Query: 478 QLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNM 642
            +IV +NK+D         ++ KS+R+       L  +   V  +PIS   G N+
Sbjct: 264 PIIVALNKIDK-----PEANIEKSKRELAQMGLALEEHGGDVQVIPISALKGTNL 313


>AY071627-1|AAL49249.1|  511|Drosophila melanogaster RE67487p
           protein.
          Length = 511

 Score = 40.7 bits (91), Expect = 0.003
 Identities = 34/116 (29%), Positives = 50/116 (43%)
 Frame = +1

Query: 301 TIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQ 480
           T +D PGH   I+ +I G    D  +L+V A  G       K  QT E  L+   L  K+
Sbjct: 70  TFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKG-------KQTQTAE-CLIIGELLQKK 121

Query: 481 LIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLE 648
           LIV +NK+D    +  +  L K R +   T     +    V    +S   G ++ E
Sbjct: 122 LIVVINKIDVYPENQRASKLEKLRLRLAKTLEATTFG-GQVPICAVSALQGTHIAE 176


>AE013599-3196|AAF46721.1|  511|Drosophila melanogaster CG9841-PA
           protein.
          Length = 511

 Score = 40.7 bits (91), Expect = 0.003
 Identities = 34/116 (29%), Positives = 50/116 (43%)
 Frame = +1

Query: 301 TIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQ 480
           T +D PGH   I+ +I G    D  +L+V A  G       K  QT E  L+   L  K+
Sbjct: 70  TFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKG-------KQTQTAE-CLIIGELLQKK 121

Query: 481 LIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLE 648
           LIV +NK+D    +  +  L K R +   T     +    V    +S   G ++ E
Sbjct: 122 LIVVINKIDVYPENQRASKLEKLRLRLAKTLEATTFG-GQVPICAVSALQGTHIAE 176


>X80069-1|CAA56375.1|  475|Drosophila melanogaster 51KDa protein
           protein.
          Length = 475

 Score = 38.3 bits (85), Expect = 0.014
 Identities = 20/71 (28%), Positives = 35/71 (49%)
 Frame = +1

Query: 295 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 474
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 181

Query: 475 KQLIVGVNKMD 507
           KQ+++  NK+D
Sbjct: 182 KQILILQNKID 192


>BT012446-1|AAS93717.1|  467|Drosophila melanogaster RE71279p
           protein.
          Length = 467

 Score = 38.3 bits (85), Expect = 0.014
 Identities = 20/71 (28%), Positives = 35/71 (49%)
 Frame = +1

Query: 295 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 474
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 120 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 173

Query: 475 KQLIVGVNKMD 507
           KQ+++  NK+D
Sbjct: 174 KQILILQNKID 184


>AY061102-1|AAL28650.1|  475|Drosophila melanogaster LD09025p
           protein.
          Length = 475

 Score = 38.3 bits (85), Expect = 0.014
 Identities = 20/71 (28%), Positives = 35/71 (49%)
 Frame = +1

Query: 295 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 474
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 181

Query: 475 KQLIVGVNKMD 507
           KQ+++  NK+D
Sbjct: 182 KQILILQNKID 192


>AJ290956-1|CAB93767.1|  475|Drosophila melanogaster eukaryotic
           translation initiationfactor 2 gamma subunit protein.
          Length = 475

 Score = 38.3 bits (85), Expect = 0.014
 Identities = 20/71 (28%), Positives = 35/71 (49%)
 Frame = +1

Query: 295 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 474
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 181

Query: 475 KQLIVGVNKMD 507
           KQ+++  NK+D
Sbjct: 182 KQILILQNKID 192


>AE014297-1977|AAN13641.1|  467|Drosophila melanogaster CG6476-PC,
           isoform C protein.
          Length = 467

 Score = 38.3 bits (85), Expect = 0.014
 Identities = 20/71 (28%), Positives = 35/71 (49%)
 Frame = +1

Query: 295 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 474
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 120 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 173

Query: 475 KQLIVGVNKMD 507
           KQ+++  NK+D
Sbjct: 174 KQILILQNKID 184


>AE014297-1976|AAF55153.1|  475|Drosophila melanogaster CG6476-PB,
           isoform B protein.
          Length = 475

 Score = 38.3 bits (85), Expect = 0.014
 Identities = 20/71 (28%), Positives = 35/71 (49%)
 Frame = +1

Query: 295 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 474
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 181

Query: 475 KQLIVGVNKMD 507
           KQ+++  NK+D
Sbjct: 182 KQILILQNKID 192


>X15805-1|CAA33804.1|  844|Drosophila melanogaster protein (
           Drosophila DMEF2 genefor the translation elongation
           factor 2. ).
          Length = 844

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 137
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 44



 Score = 29.1 bits (62), Expect = 8.5
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = +1

Query: 280 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           E   + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 98  ECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 138


>AY075481-1|AAL68292.1|  844|Drosophila melanogaster RE38659p
           protein.
          Length = 844

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 137
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 44



 Score = 29.1 bits (62), Expect = 8.5
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = +1

Query: 280 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           E   + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 98  ECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 138


>AE014134-3534|AAN11135.1|  832|Drosophila melanogaster CG2238-PC,
           isoform C protein.
          Length = 832

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 137
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 32



 Score = 29.1 bits (62), Expect = 8.5
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = +1

Query: 280 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           E   + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 86  ECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 126


>AE014134-3533|AAG22125.2|  832|Drosophila melanogaster CG2238-PB,
           isoform B protein.
          Length = 832

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 137
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 32



 Score = 29.1 bits (62), Expect = 8.5
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = +1

Query: 280 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           E   + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 86  ECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 126


>AE014134-3532|AAF57226.2|  844|Drosophila melanogaster CG2238-PA,
           isoform A protein.
          Length = 844

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 137
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 44



 Score = 29.1 bits (62), Expect = 8.5
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = +1

Query: 280 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           E   + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 98  ECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 138


>AY058769-1|AAL13998.1|  949|Drosophila melanogaster SD04694p
           protein.
          Length = 949

 Score = 31.9 bits (69), Expect = 1.2
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +1

Query: 292 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 387
           Y + +ID+PGH DF   + T     D A+++V
Sbjct: 7   YLINLIDSPGHVDFSSEVSTAVRLCDGAIVVV 38


>AE014296-2740|AAF49461.3| 1033|Drosophila melanogaster CG33158-PB
           protein.
          Length = 1033

 Score = 31.9 bits (69), Expect = 1.2
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +1

Query: 292 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 387
           Y + +ID+PGH DF   + T     D A+++V
Sbjct: 91  YLINLIDSPGHVDFSSEVSTAVRLCDGAIVVV 122


>BT023763-1|AAZ41771.1|  639|Drosophila melanogaster RE37786p
           protein.
          Length = 639

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 20/60 (33%), Positives = 30/60 (50%)
 Frame = +1

Query: 268 LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREH 447
           LWK +T+   + IID PGH DF   +       D AVL++ A  G     ++ N Q + +
Sbjct: 106 LWK-DTN---INIIDTPGHVDFTVEVERALRVLDGAVLVLCAVGGVQSETLTVNRQMKRY 161


>AE014134-1251|AAF52495.2|  745|Drosophila melanogaster CG4567-PA
           protein.
          Length = 745

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 20/60 (33%), Positives = 30/60 (50%)
 Frame = +1

Query: 268 LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREH 447
           LWK +T+   + IID PGH DF   +       D AVL++ A  G     ++ N Q + +
Sbjct: 106 LWK-DTN---INIIDTPGHVDFTVEVERALRVLDGAVLVLCAVGGVQSQTLTVNRQMKRY 161


>AE014297-3196|AAF56031.2|  692|Drosophila melanogaster CG31159-PA
           protein.
          Length = 692

 Score = 30.7 bits (66), Expect = 2.8
 Identities = 10/24 (41%), Positives = 18/24 (75%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCG 137
           NI ++ H+D+GK+TTT  +++  G
Sbjct: 35  NIGILAHIDAGKTTTTERMLFYAG 58


>BT003552-1|AAO39556.1|  676|Drosophila melanogaster LP12382p
           protein.
          Length = 676

 Score = 29.9 bits (64), Expect = 4.8
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = +1

Query: 292 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           Y + +ID PGH DF   +    +  D  VL+V A  G
Sbjct: 145 YLLNLIDTPGHVDFSNEVSRSLAACDGVVLLVDACHG 181


>AF017777-7|AAC28402.1|  679|Drosophila melanogaster waclaw protein.
          Length = 679

 Score = 29.9 bits (64), Expect = 4.8
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = +1

Query: 292 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           Y + +ID PGH DF   +    +  D  VL+V A  G
Sbjct: 165 YLLNLIDTPGHVDFSNEVSRSLAACDGVVLLVDACHG 201


>AE014298-3127|AAF50824.2|  696|Drosophila melanogaster CG1410-PA,
           isoform A protein.
          Length = 696

 Score = 29.9 bits (64), Expect = 4.8
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = +1

Query: 292 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           Y + +ID PGH DF   +    +  D  VL+V A  G
Sbjct: 165 YLLNLIDTPGHVDFSNEVSRSLAACDGVVLLVDACHG 201


>BT023767-1|AAZ41775.1| 1144|Drosophila melanogaster RE11051p
           protein.
          Length = 1144

 Score = 29.5 bits (63), Expect = 6.4
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIV 387
           IID PGH  F      G+S  D A+L+V
Sbjct: 624 IIDTPGHESFSNLRNRGSSLCDIAILVV 651


>AF143207-1|AAF36532.1| 1144|Drosophila melanogaster IF2 protein
           protein.
          Length = 1144

 Score = 29.5 bits (63), Expect = 6.4
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIV 387
           IID PGH  F      G+S  D A+L+V
Sbjct: 624 IIDTPGHESFSNLRNRGSSLCDIAILVV 651


>AE014296-661|AAF47774.2| 1144|Drosophila melanogaster CG10840-PB
           protein.
          Length = 1144

 Score = 29.5 bits (63), Expect = 6.4
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIV 387
           IID PGH  F      G+S  D A+L+V
Sbjct: 624 IIDTPGHESFSNLRNRGSSLCDIAILVV 651


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 40,762,973
Number of Sequences: 53049
Number of extensions: 886686
Number of successful extensions: 2536
Number of sequences better than 10.0: 50
Number of HSP's better than 10.0 without gapping: 2299
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2478
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4270708416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -