SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30141.Seq
         (897 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT009962-1|AAQ22431.1|  425|Drosophila melanogaster RE74011p pro...   171   1e-42
AE014298-2065|AAN09344.1|  425|Drosophila melanogaster CG32593-P...   171   1e-42
AE014298-2064|AAN09343.1|  425|Drosophila melanogaster CG32593-P...   171   1e-42
AF044916-1|AAC39013.1|  376|Drosophila melanogaster flotillin-2 ...   169   6e-42
AE014298-2063|AAF48393.3|  438|Drosophila melanogaster CG32593-P...   157   2e-38
AE014298-2062|AAF48407.2|  438|Drosophila melanogaster CG32593-P...   157   2e-38
AY069755-1|AAL39900.1|  401|Drosophila melanogaster LP11503p pro...   113   4e-25
AE014298-2080|AAN09346.1|  401|Drosophila melanogaster CG32593-P...   113   4e-25
AY058794-1|AAL14023.1|  426|Drosophila melanogaster SD10657p pro...   100   2e-21
AF044734-1|AAC39012.1|  426|Drosophila melanogaster flotillin-1 ...   100   2e-21
AE013599-2081|AAF58120.1|  426|Drosophila melanogaster CG8200-PA...   100   2e-21
AE013599-2082|AAF58121.1|  430|Drosophila melanogaster CG8200-PB...    97   2e-20
AE014298-2082|AAN09348.1|  281|Drosophila melanogaster CG32593-P...    50   3e-06
AY118556-1|AAM49925.1|  708|Drosophila melanogaster LD36089p pro...    36   0.099
AE014296-764|AAG22245.1|  708|Drosophila melanogaster CG14991-PB...    36   0.099
AE014296-763|AAF47838.1|  708|Drosophila melanogaster CG14991-PA...    36   0.099
AF132145-1|AAD33592.1| 1140|Drosophila melanogaster damage-speci...    29   6.5  
AE014297-1629|AAF54901.1| 1140|Drosophila melanogaster CG7769-PA...    29   6.5  
BT003275-1|AAO25032.1|  772|Drosophila melanogaster LD14577p pro...    29   8.6  
AY113409-1|AAM29414.1|  525|Drosophila melanogaster RE13562p pro...    29   8.6  
AY071245-1|AAL48867.1|  529|Drosophila melanogaster RE28781p pro...    29   8.6  
AY060938-1|AAL28486.1|  277|Drosophila melanogaster GM08053p pro...    29   8.6  
AE014298-3149|AAF50807.1|  529|Drosophila melanogaster CG1644-PA...    29   8.6  
AE014298-1174|AAF46370.2|  525|Drosophila melanogaster CG12125-P...    29   8.6  
AE014297-661|AAN13384.1|  537|Drosophila melanogaster CG17816-PC...    29   8.6  
AE014297-660|AAF54155.1|  537|Drosophila melanogaster CG17816-PA...    29   8.6  
AE014297-659|AAN13383.1|  878|Drosophila melanogaster CG17816-PB...    29   8.6  
AE014297-658|AAS65123.2|  772|Drosophila melanogaster CG17816-PD...    29   8.6  

>BT009962-1|AAQ22431.1|  425|Drosophila melanogaster RE74011p
           protein.
          Length = 425

 Score =  171 bits (415), Expect = 1e-42
 Identities = 99/176 (56%), Positives = 111/176 (63%)
 Frame = +3

Query: 258 VMTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLE 437
           VMTLNPMCE VET+QGVPLTVTGVAQCKIM  DELL TA EQFLGK+VKEIK T+LQTLE
Sbjct: 49  VMTLNPMCENVETSQGVPLTVTGVAQCKIMKADELLGTASEQFLGKSVKEIKQTILQTLE 108

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GHLRAILGTLTVEEVYKDRDQFA    +                 ++         ASLG
Sbjct: 109 GHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLG 168

Query: 618 KFATANVKRDAERPCRSG*PRCWY*GSGIEKNAMDVKIFD*HPKLKDNRDSSKFQK 785
           K  TA VKRDA+              +  EK+AMDVK +    K++DN    K QK
Sbjct: 169 KAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVK-YSTDTKIEDNTRMYKLQK 223



 Score = 93.9 bits (223), Expect = 3e-19
 Identities = 41/47 (87%), Positives = 42/47 (89%)
 Frame = +1

Query: 115 MGNIHTVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           MGNIHT GPNEALIVSGGC G T KRTIVGGWAWAW LVTDVQR+SL
Sbjct: 1   MGNIHTTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSL 47


>AE014298-2065|AAN09344.1|  425|Drosophila melanogaster CG32593-PF,
           isoform F protein.
          Length = 425

 Score =  171 bits (415), Expect = 1e-42
 Identities = 99/176 (56%), Positives = 111/176 (63%)
 Frame = +3

Query: 258 VMTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLE 437
           VMTLNPMCE VET+QGVPLTVTGVAQCKIM  DELL TA EQFLGK+VKEIK T+LQTLE
Sbjct: 49  VMTLNPMCENVETSQGVPLTVTGVAQCKIMKADELLGTASEQFLGKSVKEIKQTILQTLE 108

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GHLRAILGTLTVEEVYKDRDQFA    +                 ++         ASLG
Sbjct: 109 GHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLG 168

Query: 618 KFATANVKRDAERPCRSG*PRCWY*GSGIEKNAMDVKIFD*HPKLKDNRDSSKFQK 785
           K  TA VKRDA+              +  EK+AMDVK +    K++DN    K QK
Sbjct: 169 KAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVK-YSTDTKIEDNTRMYKLQK 223



 Score = 93.9 bits (223), Expect = 3e-19
 Identities = 41/47 (87%), Positives = 42/47 (89%)
 Frame = +1

Query: 115 MGNIHTVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           MGNIHT GPNEALIVSGGC G T KRTIVGGWAWAW LVTDVQR+SL
Sbjct: 1   MGNIHTTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSL 47


>AE014298-2064|AAN09343.1|  425|Drosophila melanogaster CG32593-PB,
           isoform B protein.
          Length = 425

 Score =  171 bits (415), Expect = 1e-42
 Identities = 99/176 (56%), Positives = 111/176 (63%)
 Frame = +3

Query: 258 VMTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLE 437
           VMTLNPMCE VET+QGVPLTVTGVAQCKIM  DELL TA EQFLGK+VKEIK T+LQTLE
Sbjct: 49  VMTLNPMCENVETSQGVPLTVTGVAQCKIMKADELLGTASEQFLGKSVKEIKQTILQTLE 108

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GHLRAILGTLTVEEVYKDRDQFA    +                 ++         ASLG
Sbjct: 109 GHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLG 168

Query: 618 KFATANVKRDAERPCRSG*PRCWY*GSGIEKNAMDVKIFD*HPKLKDNRDSSKFQK 785
           K  TA VKRDA+              +  EK+AMDVK +    K++DN    K QK
Sbjct: 169 KAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVK-YSTDTKIEDNTRMYKLQK 223



 Score = 93.9 bits (223), Expect = 3e-19
 Identities = 41/47 (87%), Positives = 42/47 (89%)
 Frame = +1

Query: 115 MGNIHTVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           MGNIHT GPNEALIVSGGC G T KRTIVGGWAWAW LVTDVQR+SL
Sbjct: 1   MGNIHTTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSL 47


>AF044916-1|AAC39013.1|  376|Drosophila melanogaster flotillin-2
           protein.
          Length = 376

 Score =  169 bits (410), Expect = 6e-42
 Identities = 98/175 (56%), Positives = 110/175 (62%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLEG 440
           MTLNPMCE VET+QGVPLTVTGVAQCKIM  DELL TA EQFLGK+VKEIK T+LQTLEG
Sbjct: 1   MTLNPMCENVETSQGVPLTVTGVAQCKIMKADELLGTASEQFLGKSVKEIKQTILQTLEG 60

Query: 441 HLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLGK 620
           HLRAILGTLTVEEVYKDRDQFA    +                 ++         ASLGK
Sbjct: 61  HLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGK 120

Query: 621 FATANVKRDAERPCRSG*PRCWY*GSGIEKNAMDVKIFD*HPKLKDNRDSSKFQK 785
             TA VKRDA+              +  EK+AMDVK +    K++DN    K QK
Sbjct: 121 GQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVK-YSTDTKIEDNTRMYKLQK 174


>AE014298-2063|AAF48393.3|  438|Drosophila melanogaster CG32593-PE,
           isoform E protein.
          Length = 438

 Score =  157 bits (381), Expect = 2e-38
 Identities = 99/189 (52%), Positives = 111/189 (58%), Gaps = 13/189 (6%)
 Frame = +3

Query: 258 VMTLNPMCEYVETAQGVPLTVTGVAQCKIMNE-------------DELLTTACEQFLGKT 398
           VMTLNPMCE VET+QGVPLTVTGVAQCKIM               DELL TA EQFLGK+
Sbjct: 49  VMTLNPMCENVETSQGVPLTVTGVAQCKIMKSSSYKQTDYHNDEADELLGTASEQFLGKS 108

Query: 399 VKEIKMTVLQTLEGHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLR 578
           VKEIK T+LQTLEGHLRAILGTLTVEEVYKDRDQFA    +                 ++
Sbjct: 109 VKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIK 168

Query: 579 TSTTMSSIWASLGKFATANVKRDAERPCRSG*PRCWY*GSGIEKNAMDVKIFD*HPKLKD 758
                    ASLGK  TA VKRDA+              +  EK+AMDVK +    K++D
Sbjct: 169 DVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVK-YSTDTKIED 227

Query: 759 NRDSSKFQK 785
           N    K QK
Sbjct: 228 NTRMYKLQK 236



 Score = 93.9 bits (223), Expect = 3e-19
 Identities = 41/47 (87%), Positives = 42/47 (89%)
 Frame = +1

Query: 115 MGNIHTVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           MGNIHT GPNEALIVSGGC G T KRTIVGGWAWAW LVTDVQR+SL
Sbjct: 1   MGNIHTTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSL 47


>AE014298-2062|AAF48407.2|  438|Drosophila melanogaster CG32593-PA,
           isoform A protein.
          Length = 438

 Score =  157 bits (381), Expect = 2e-38
 Identities = 99/189 (52%), Positives = 111/189 (58%), Gaps = 13/189 (6%)
 Frame = +3

Query: 258 VMTLNPMCEYVETAQGVPLTVTGVAQCKIMNE-------------DELLTTACEQFLGKT 398
           VMTLNPMCE VET+QGVPLTVTGVAQCKIM               DELL TA EQFLGK+
Sbjct: 49  VMTLNPMCENVETSQGVPLTVTGVAQCKIMKSSSYKQTDYHNDEADELLGTASEQFLGKS 108

Query: 399 VKEIKMTVLQTLEGHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLR 578
           VKEIK T+LQTLEGHLRAILGTLTVEEVYKDRDQFA    +                 ++
Sbjct: 109 VKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIK 168

Query: 579 TSTTMSSIWASLGKFATANVKRDAERPCRSG*PRCWY*GSGIEKNAMDVKIFD*HPKLKD 758
                    ASLGK  TA VKRDA+              +  EK+AMDVK +    K++D
Sbjct: 169 DVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVK-YSTDTKIED 227

Query: 759 NRDSSKFQK 785
           N    K QK
Sbjct: 228 NTRMYKLQK 236



 Score = 93.9 bits (223), Expect = 3e-19
 Identities = 41/47 (87%), Positives = 42/47 (89%)
 Frame = +1

Query: 115 MGNIHTVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           MGNIHT GPNEALIVSGGC G T KRTIVGGWAWAW LVTDVQR+SL
Sbjct: 1   MGNIHTTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSL 47


>AY069755-1|AAL39900.1|  401|Drosophila melanogaster LP11503p
           protein.
          Length = 401

 Score =  113 bits (271), Expect = 4e-25
 Identities = 71/144 (49%), Positives = 82/144 (56%)
 Frame = +3

Query: 354 DELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEVYKDRDQFAGWYAKWLRR 533
           DELL TA EQFLGK+VKEIK T+LQTLEGHLRAILGTLTVEEVYKDRDQFA    +    
Sbjct: 57  DELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAP 116

Query: 534 TSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDAERPCRSG*PRCWY*GSGIEKN 713
                        ++         ASLGK  TA VKRDA+              +  EK+
Sbjct: 117 DVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKS 176

Query: 714 AMDVKIFD*HPKLKDNRDSSKFQK 785
           AMDVK +    K++DN    K QK
Sbjct: 177 AMDVK-YSTDTKIEDNTRMYKLQK 199


>AE014298-2080|AAN09346.1|  401|Drosophila melanogaster CG32593-PC,
           isoform C protein.
          Length = 401

 Score =  113 bits (271), Expect = 4e-25
 Identities = 71/144 (49%), Positives = 82/144 (56%)
 Frame = +3

Query: 354 DELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEVYKDRDQFAGWYAKWLRR 533
           DELL TA EQFLGK+VKEIK T+LQTLEGHLRAILGTLTVEEVYKDRDQFA    +    
Sbjct: 57  DELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAP 116

Query: 534 TSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDAERPCRSG*PRCWY*GSGIEKN 713
                        ++         ASLGK  TA VKRDA+              +  EK+
Sbjct: 117 DVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKS 176

Query: 714 AMDVKIFD*HPKLKDNRDSSKFQK 785
           AMDVK +    K++DN    K QK
Sbjct: 177 AMDVK-YSTDTKIEDNTRMYKLQK 199


>AY058794-1|AAL14023.1|  426|Drosophila melanogaster SD10657p
           protein.
          Length = 426

 Score =  100 bits (240), Expect = 2e-21
 Identities = 57/131 (43%), Positives = 75/131 (57%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDE-LLTTACEQFLGKTVKEIKMTVLQTLE 437
           MTL      V T+QGVP++VTG+AQ K+  ++E +L TACEQFLGK+  EI    L TLE
Sbjct: 49  MTLQVESPCVYTSQGVPISVTGIAQVKVQGQNEDMLLTACEQFLGKSEAEINHIALVTLE 108

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+G++TVEE+YKDR +F+    +                 ++          SLG
Sbjct: 109 GHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLANMGITVVSYTIKDLRDEEGYLRSLG 168

Query: 618 KFATANVKRDA 650
              TA VKRDA
Sbjct: 169 MARTAEVKRDA 179



 Score = 39.9 bits (89), Expect = 0.005
 Identities = 21/42 (50%), Positives = 26/42 (61%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEAL+VSG C+       + GG A+ W +   VQRISL
Sbjct: 7   TCGPNEALVVSGCCY--MKPLLVPGGRAFVWPVGQQVQRISL 46


>AF044734-1|AAC39012.1|  426|Drosophila melanogaster flotillin-1
           protein.
          Length = 426

 Score =  100 bits (240), Expect = 2e-21
 Identities = 57/131 (43%), Positives = 75/131 (57%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDE-LLTTACEQFLGKTVKEIKMTVLQTLE 437
           MTL      V T+QGVP++VTG+AQ K+  ++E +L TACEQFLGK+  EI    L TLE
Sbjct: 49  MTLQVESPCVYTSQGVPISVTGIAQVKVQGQNEDMLLTACEQFLGKSEAEINHIALVTLE 108

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+G++TVEE+YKDR +F+    +                 ++          SLG
Sbjct: 109 GHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLANMGITVVSYTIKDLRDEEGYLRSLG 168

Query: 618 KFATANVKRDA 650
              TA VKRDA
Sbjct: 169 MARTAEVKRDA 179



 Score = 39.9 bits (89), Expect = 0.005
 Identities = 21/42 (50%), Positives = 26/42 (61%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEAL+VSG C+       + GG A+ W +   VQRISL
Sbjct: 7   TCGPNEALVVSGCCY--MKPLLVPGGRAFVWPVGQQVQRISL 46


>AE013599-2081|AAF58120.1|  426|Drosophila melanogaster CG8200-PA,
           isoform A protein.
          Length = 426

 Score =  100 bits (240), Expect = 2e-21
 Identities = 57/131 (43%), Positives = 75/131 (57%), Gaps = 1/131 (0%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDE-LLTTACEQFLGKTVKEIKMTVLQTLE 437
           MTL      V T+QGVP++VTG+AQ K+  ++E +L TACEQFLGK+  EI    L TLE
Sbjct: 49  MTLQVESPCVYTSQGVPISVTGIAQVKVQGQNEDMLLTACEQFLGKSEAEINHIALVTLE 108

Query: 438 GHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASLG 617
           GH RAI+G++TVEE+YKDR +F+    +                 ++          SLG
Sbjct: 109 GHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLANMGITVVSYTIKDLRDEEGYLRSLG 168

Query: 618 KFATANVKRDA 650
              TA VKRDA
Sbjct: 169 MARTAEVKRDA 179



 Score = 39.9 bits (89), Expect = 0.005
 Identities = 21/42 (50%), Positives = 26/42 (61%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEAL+VSG C+       + GG A+ W +   VQRISL
Sbjct: 7   TCGPNEALVVSGCCY--MKPLLVPGGRAFVWPVGQQVQRISL 46


>AE013599-2082|AAF58121.1|  430|Drosophila melanogaster CG8200-PB,
           isoform B protein.
          Length = 430

 Score = 97.5 bits (232), Expect = 2e-20
 Identities = 47/83 (56%), Positives = 62/83 (74%), Gaps = 1/83 (1%)
 Frame = +3

Query: 261 MTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDE-LLTTACEQFLGKTVKEIKMTVLQTLE 437
           MTL      V T+QGVP++VTG+AQ K+  ++E +L TACEQFLGK+  EI    L TLE
Sbjct: 49  MTLQVESPCVYTSQGVPISVTGIAQVKVQGQNEDMLLTACEQFLGKSEAEINHIALVTLE 108

Query: 438 GHLRAILGTLTVEEVYKDRDQFA 506
           GH RAI+G++TVEE+YKDR +F+
Sbjct: 109 GHQRAIMGSMTVEEIYKDRKKFS 131



 Score = 39.9 bits (89), Expect = 0.005
 Identities = 21/42 (50%), Positives = 26/42 (61%)
 Frame = +1

Query: 130 TVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISL 255
           T GPNEAL+VSG C+       + GG A+ W +   VQRISL
Sbjct: 7   TCGPNEALVVSGCCY--MKPLLVPGGRAFVWPVGQQVQRISL 46



 Score = 34.7 bits (76), Expect = 0.17
 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 4/45 (8%)
 Frame = +2

Query: 512 VREVAAPDVGRMGIEILSFTIKDVYDD----VQYLGQLGEVRNGQ 634
           V EVA+ D+  MGI ++S+TIKD+ D+      YL  LG  R  +
Sbjct: 134 VFEVASSDLANMGITVVSYTIKDLRDEEGDSKGYLRSLGMARTAE 178


>AE014298-2082|AAN09348.1|  281|Drosophila melanogaster CG32593-PD,
           isoform D protein.
          Length = 281

 Score = 50.4 bits (115), Expect = 3e-06
 Identities = 36/116 (31%), Positives = 58/116 (50%), Gaps = 2/116 (1%)
 Frame = +2

Query: 545 MGIEILSFTIKDVYDDVQYLGQLGEVRNGQREEGR*TSVSLWLTEMLVLGKRX*EKRNGR 724
           MGIEILSFTIKDVYDDVQYL  LG+ +    +      V+    +    G R  E     
Sbjct: 1   MGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRD---AGIREAECEKSA 57

Query: 725 QNIRLT--PKIEGQQRLFKISERRHFDSRNLNXSLKRERAFWXYXLSSQRKIKPGE 886
            +++ +   KIE   R++K+ ++ +FD        + + A+       +++I+  E
Sbjct: 58  MDVKYSTDTKIEDNTRMYKL-QKANFDQEINTAKAESQLAYELQAAKIRQRIRNEE 112


>AY118556-1|AAM49925.1|  708|Drosophila melanogaster LD36089p
           protein.
          Length = 708

 Score = 35.5 bits (78), Expect = 0.099
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 4/62 (6%)
 Frame = +3

Query: 147 GANSFRWLFRADHETYHSGWMGMGLVSGYGRP----TYIPEVMTLNPMCEYVETAQGVPL 314
           G NS  W+ R D+E  ++ WM    ++  GR     +Y  EV ++  + +  + AQG PL
Sbjct: 481 GPNSEVWV-RCDNEEQYAKWMAACRLAAKGRSLADSSYDSEVSSIRSLLQMQKPAQGAPL 539

Query: 315 TV 320
           TV
Sbjct: 540 TV 541


>AE014296-764|AAG22245.1|  708|Drosophila melanogaster CG14991-PB,
           isoform B protein.
          Length = 708

 Score = 35.5 bits (78), Expect = 0.099
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 4/62 (6%)
 Frame = +3

Query: 147 GANSFRWLFRADHETYHSGWMGMGLVSGYGRP----TYIPEVMTLNPMCEYVETAQGVPL 314
           G NS  W+ R D+E  ++ WM    ++  GR     +Y  EV ++  + +  + AQG PL
Sbjct: 481 GPNSEVWV-RCDNEEQYAKWMAACRLAAKGRSLADSSYDSEVSSIRSLLQMQKPAQGAPL 539

Query: 315 TV 320
           TV
Sbjct: 540 TV 541


>AE014296-763|AAF47838.1|  708|Drosophila melanogaster CG14991-PA,
           isoform A protein.
          Length = 708

 Score = 35.5 bits (78), Expect = 0.099
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 4/62 (6%)
 Frame = +3

Query: 147 GANSFRWLFRADHETYHSGWMGMGLVSGYGRP----TYIPEVMTLNPMCEYVETAQGVPL 314
           G NS  W+ R D+E  ++ WM    ++  GR     +Y  EV ++  + +  + AQG PL
Sbjct: 481 GPNSEVWV-RCDNEEQYAKWMAACRLAAKGRSLADSSYDSEVSSIRSLLQMQKPAQGAPL 539

Query: 315 TV 320
           TV
Sbjct: 540 TV 541


>AF132145-1|AAD33592.1| 1140|Drosophila melanogaster damage-specific
           DNA binding proteinDDBa p127 subunit protein.
          Length = 1140

 Score = 29.5 bits (63), Expect = 6.5
 Identities = 14/27 (51%), Positives = 18/27 (66%)
 Frame = -3

Query: 640 FTLAVANFPKLAQILDIVVDVLNREGQ 560
           + + V NF  LA ILDI V  L+R+GQ
Sbjct: 344 YVVPVENFTNLAPILDIAVVDLDRQGQ 370


>AE014297-1629|AAF54901.1| 1140|Drosophila melanogaster CG7769-PA
           protein.
          Length = 1140

 Score = 29.5 bits (63), Expect = 6.5
 Identities = 14/27 (51%), Positives = 18/27 (66%)
 Frame = -3

Query: 640 FTLAVANFPKLAQILDIVVDVLNREGQ 560
           + + V NF  LA ILDI V  L+R+GQ
Sbjct: 344 YVVPVENFTNLAPILDIAVVDLDRQGQ 370


>BT003275-1|AAO25032.1|  772|Drosophila melanogaster LD14577p
           protein.
          Length = 772

 Score = 29.1 bits (62), Expect = 8.6
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 4/95 (4%)
 Frame = +2

Query: 557 ILSFTIKDVYDDVQYLGQLGEV--RNGQREEGR*TSVSLWLTEMLVLGKRX*EKRNGRQN 730
           + +  +KD  D+ Q  G+ G+V   NG        ++ LW  EM+ L K+  E +     
Sbjct: 199 VAAAALKDEVDNRQ-AGESGQVVVMNGSAPPHSKPNLDLWFKEMVELRKKAGEYKCRGWG 257

Query: 731 IRLTPKIEGQQRLF--KISERRHFDSRNLNXSLKR 829
           I + P++  +Q+    ++S+R    + +L  S+ R
Sbjct: 258 IEIDPELYKKQKDLWDQVSKRSSLSALSLASSVHR 292


>AY113409-1|AAM29414.1|  525|Drosophila melanogaster RE13562p
           protein.
          Length = 525

 Score = 29.1 bits (62), Expect = 8.6
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = +2

Query: 479 GVQRQGPIRGLVREVAAPDVGRMGIEILSFTIKDVYDD 592
           GVQ  GP   +V ++ A  +G MG+E L  T+ + ++D
Sbjct: 114 GVQNAGPGSSVVTQLTAQQLGMMGMEALD-TVINFWED 150


>AY071245-1|AAL48867.1|  529|Drosophila melanogaster RE28781p
           protein.
          Length = 529

 Score = 29.1 bits (62), Expect = 8.6
 Identities = 20/54 (37%), Positives = 25/54 (46%)
 Frame = -2

Query: 236 SVTRHQAHAHPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPFTVTFTIHTL 75
           S  + Q H HP T + F  GP+    T+   L   V +L ILN F V     TL
Sbjct: 450 SAEQRQQH-HPMTYLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCERTL 502


>AY060938-1|AAL28486.1|  277|Drosophila melanogaster GM08053p
           protein.
          Length = 277

 Score = 29.1 bits (62), Expect = 8.6
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = +2

Query: 479 GVQRQGPIRGLVREVAAPDVGRMGIEILSFTIKDVYDD 592
           GVQ  GP   +V ++ A  +G MG+E L  T+ + ++D
Sbjct: 114 GVQNAGPGSSVVTQLTAQQLGMMGMEALD-TVINFWED 150


>AE014298-3149|AAF50807.1|  529|Drosophila melanogaster CG1644-PA
           protein.
          Length = 529

 Score = 29.1 bits (62), Expect = 8.6
 Identities = 20/54 (37%), Positives = 25/54 (46%)
 Frame = -2

Query: 236 SVTRHQAHAHPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPFTVTFTIHTL 75
           S  + Q H HP T + F  GP+    T+   L   V +L ILN F V     TL
Sbjct: 450 SAEQRQQH-HPMTYLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCERTL 502


>AE014298-1174|AAF46370.2|  525|Drosophila melanogaster CG12125-PA
           protein.
          Length = 525

 Score = 29.1 bits (62), Expect = 8.6
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = +2

Query: 479 GVQRQGPIRGLVREVAAPDVGRMGIEILSFTIKDVYDD 592
           GVQ  GP   +V ++ A  +G MG+E L  T+ + ++D
Sbjct: 114 GVQNAGPGSSVVTQLTAQQLGMMGMEALD-TVINFWED 150


>AE014297-661|AAN13384.1|  537|Drosophila melanogaster CG17816-PC,
           isoform C protein.
          Length = 537

 Score = 29.1 bits (62), Expect = 8.6
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 4/95 (4%)
 Frame = +2

Query: 557 ILSFTIKDVYDDVQYLGQLGEV--RNGQREEGR*TSVSLWLTEMLVLGKRX*EKRNGRQN 730
           + +  +KD  D+ Q  G+ G+V   NG        ++ LW  EM+ L K+  E +     
Sbjct: 325 VAAAALKDEVDNRQ-AGESGQVVVMNGSAPPHSKPNLDLWFKEMVELRKKAGEYKCRGWG 383

Query: 731 IRLTPKIEGQQRLF--KISERRHFDSRNLNXSLKR 829
           I + P++  +Q+    ++S+R    + +L  S+ R
Sbjct: 384 IEIDPELYKKQKDLWDQVSKRSSLSALSLASSVHR 418


>AE014297-660|AAF54155.1|  537|Drosophila melanogaster CG17816-PA,
           isoform A protein.
          Length = 537

 Score = 29.1 bits (62), Expect = 8.6
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 4/95 (4%)
 Frame = +2

Query: 557 ILSFTIKDVYDDVQYLGQLGEV--RNGQREEGR*TSVSLWLTEMLVLGKRX*EKRNGRQN 730
           + +  +KD  D+ Q  G+ G+V   NG        ++ LW  EM+ L K+  E +     
Sbjct: 325 VAAAALKDEVDNRQ-AGESGQVVVMNGSAPPHSKPNLDLWFKEMVELRKKAGEYKCRGWG 383

Query: 731 IRLTPKIEGQQRLF--KISERRHFDSRNLNXSLKR 829
           I + P++  +Q+    ++S+R    + +L  S+ R
Sbjct: 384 IEIDPELYKKQKDLWDQVSKRSSLSALSLASSVHR 418


>AE014297-659|AAN13383.1|  878|Drosophila melanogaster CG17816-PB,
           isoform B protein.
          Length = 878

 Score = 29.1 bits (62), Expect = 8.6
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 4/95 (4%)
 Frame = +2

Query: 557 ILSFTIKDVYDDVQYLGQLGEV--RNGQREEGR*TSVSLWLTEMLVLGKRX*EKRNGRQN 730
           + +  +KD  D+ Q  G+ G+V   NG        ++ LW  EM+ L K+  E +     
Sbjct: 325 VAAAALKDEVDNRQ-AGESGQVVVMNGSAPPHSKPNLDLWFKEMVELRKKAGEYKCRGWG 383

Query: 731 IRLTPKIEGQQRLF--KISERRHFDSRNLNXSLKR 829
           I + P++  +Q+    ++S+R    + +L  S+ R
Sbjct: 384 IEIDPELYKKQKDLWDQVSKRSSLSALSLASSVHR 418


>AE014297-658|AAS65123.2|  772|Drosophila melanogaster CG17816-PD,
           isoform D protein.
          Length = 772

 Score = 29.1 bits (62), Expect = 8.6
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 4/95 (4%)
 Frame = +2

Query: 557 ILSFTIKDVYDDVQYLGQLGEV--RNGQREEGR*TSVSLWLTEMLVLGKRX*EKRNGRQN 730
           + +  +KD  D+ Q  G+ G+V   NG        ++ LW  EM+ L K+  E +     
Sbjct: 199 VAAAALKDEVDNRQ-AGESGQVVVMNGSAPPHSKPNLDLWFKEMVELRKKAGEYKCRGWG 257

Query: 731 IRLTPKIEGQQRLF--KISERRHFDSRNLNXSLKR 829
           I + P++  +Q+    ++S+R    + +L  S+ R
Sbjct: 258 IEIDPELYKKQKDLWDQVSKRSSLSALSLASSVHR 292


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 43,390,889
Number of Sequences: 53049
Number of extensions: 1025746
Number of successful extensions: 3738
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 3374
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3696
length of database: 24,988,368
effective HSP length: 85
effective length of database: 20,479,203
effective search space used: 4362070239
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -