SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30139.Seq
         (697 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY118676-1|AAM50536.1|  990|Drosophila melanogaster AT06247p pro...   125   5e-29
AY118338-1|AAM48367.1|  975|Drosophila melanogaster LD43649p pro...   125   5e-29
AE013599-1855|AAF58273.2|  975|Drosophila melanogaster CG8494-PA...   125   5e-29
AY058707-1|AAL13936.1|  703|Drosophila melanogaster LD43147p pro...    56   3e-08
AF179590-1|AAD53181.1|  735|Drosophila melanogaster ubiquitin-sp...    56   3e-08
AE014296-3035|AAF49249.1|  735|Drosophila melanogaster CG4166-PA...    56   3e-08
BT010235-1|AAQ23553.1|  424|Drosophila melanogaster RE52890p pro...    48   9e-06
AE014297-3238|AAN13921.1|  364|Drosophila melanogaster CG7023-PA...    48   9e-06
AE014297-3237|AAF56066.1|  424|Drosophila melanogaster CG7023-PB...    48   9e-06
BT003648-1|AAO39652.1|  938|Drosophila melanogaster AT11044p pro...    48   1e-05
AY069803-1|AAL39948.1|  856|Drosophila melanogaster SD04280p pro...    48   1e-05
AE014298-3178|AAN09567.1|  337|Drosophila melanogaster CG14619-P...    48   1e-05
AE014298-3177|AAN09566.1|  938|Drosophila melanogaster CG14619-P...    48   1e-05
AE014298-3176|AAN09565.1|  856|Drosophila melanogaster CG14619-P...    48   1e-05
AE014298-3175|AAN09564.1|  856|Drosophila melanogaster CG14619-P...    48   1e-05
AE014298-3174|AAF50952.2|  856|Drosophila melanogaster CG14619-P...    48   1e-05
AE014297-2941|AAF55858.2|  896|Drosophila melanogaster CG5798-PA...    47   2e-05
AY122247-1|AAM52759.1|  896|Drosophila melanogaster SD04548p pro...    47   3e-05
BT010041-1|AAQ22510.1|  852|Drosophila melanogaster LD36231p pro...    46   4e-05
AE013599-1490|AAM68683.1|  852|Drosophila melanogaster CG8830-PB...    46   4e-05
AE013599-1489|AAF58508.1|  852|Drosophila melanogaster CG8830-PA...    46   4e-05
X99211-1|CAA67601.1|  898|Drosophila melanogaster ubiquitin-spec...    44   2e-04
BT003784-1|AAO41467.1| 1556|Drosophila melanogaster LD26783p pro...    44   2e-04
AY060809-1|AAL28357.1| 1272|Drosophila melanogaster GH27809p pro...    44   2e-04
AE014296-3238|AAF49100.3| 1736|Drosophila melanogaster CG8334-PA...    44   2e-04
AE014296-993|AAS65076.1| 1556|Drosophila melanogaster CG5486-PC,...    44   2e-04
AE014296-992|AAN12105.1| 1556|Drosophila melanogaster CG5486-PB,...    44   2e-04
AE014296-991|AAF50752.2| 1556|Drosophila melanogaster CG5486-PA,...    44   2e-04
AE013599-3941|AAF47260.2| 1272|Drosophila melanogaster CG30421-P...    44   2e-04
AE014297-3585|AAS65209.1| 2832|Drosophila melanogaster CG5794-PE...    43   3e-04
AE014297-3584|AAN14009.1| 3703|Drosophila melanogaster CG5794-PB...    43   3e-04
AE014297-3583|AAF56319.2| 3912|Drosophila melanogaster CG5794-PD...    43   3e-04
BT010120-1|AAQ22589.1|  948|Drosophila melanogaster AT24152p pro...    40   0.003
BT004507-1|AAO42671.1| 1038|Drosophila melanogaster AT31021p pro...    40   0.003
AY051916-1|AAK93340.1|  968|Drosophila melanogaster LD40339p pro...    40   0.003
AE014296-1003|AAN12111.1|  968|Drosophila melanogaster CG5505-PB...    40   0.003
AE014296-1002|AAN12110.1| 1015|Drosophila melanogaster CG5505-PE...    40   0.003
AE014296-1001|AAN12109.1|  948|Drosophila melanogaster CG5505-PC...    40   0.003
AE014296-1000|AAN12108.1|  995|Drosophila melanogaster CG5505-PF...    40   0.003
AE014296-999|AAN12107.1| 1038|Drosophila melanogaster CG5505-PD,...    40   0.003
AE014296-998|AAF50748.2| 1085|Drosophila melanogaster CG5505-PA,...    40   0.003
L04960-2|AAF01347.1| 2711|Drosophila melanogaster fat facets sho...    39   0.007
L04960-1|AAF01348.1| 2747|Drosophila melanogaster fat facets lon...    39   0.007
L04959-1|AAF01345.1| 2747|Drosophila melanogaster fat facets lon...    39   0.007
L04958-1|AAF01346.1| 2711|Drosophila melanogaster fat facets sho...    39   0.007
AF145677-1|AAD38652.1| 1689|Drosophila melanogaster BcDNA.LD2258...    39   0.007
AE014297-4810|AAN14291.1| 2711|Drosophila melanogaster CG1945-PC...    39   0.007
AE014297-4809|AAF57198.1| 2778|Drosophila melanogaster CG1945-PA...    39   0.007
AY051846-1|AAK93270.1| 1126|Drosophila melanogaster LD34905p pro...    35   0.092
AE014298-743|AAN09142.1| 1126|Drosophila melanogaster CG4165-PD,...    35   0.092
AE014298-742|AAN09141.1| 1126|Drosophila melanogaster CG4165-PC,...    35   0.092
AE014298-741|AAN09140.1| 1126|Drosophila melanogaster CG4165-PB,...    35   0.092
AE014298-740|AAF46033.1| 1126|Drosophila melanogaster CG4165-PA,...    35   0.092
AE014298-1743|AAF48134.1| 1129|Drosophila melanogaster CG1490-PB...    35   0.12 
BT001496-1|AAN71251.1| 1078|Drosophila melanogaster LD32685p pro...    34   0.16 
AF181650-1|AAD55436.1| 1078|Drosophila melanogaster BcDNA.LD2291...    34   0.16 
AE014297-4360|AAN14167.1| 1078|Drosophila melanogaster CG15817-P...    34   0.16 
AE014297-4359|AAF56881.1| 1084|Drosophila melanogaster CG15817-P...    34   0.16 
BT025074-1|ABE73245.1|  325|Drosophila melanogaster IP15289p pro...    29   6.0  
AY069300-1|AAL39445.1|  508|Drosophila melanogaster HL02756p pro...    29   6.0  
AB043038-1|BAB32536.1|  195|Drosophila melanogaster alpha-amylas...    29   8.0  

>AY118676-1|AAM50536.1|  990|Drosophila melanogaster AT06247p
           protein.
          Length = 990

 Score =  125 bits (302), Expect = 5e-29
 Identities = 59/110 (53%), Positives = 75/110 (68%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           YGP V+L DC+A+FFSADELKGDNMYSC RC KLR G+K S ++ LP VLC+HLKRFR++
Sbjct: 404 YGPSVTLYDCMASFFSADELKGDNMYSCERCNKLRTGIKYSRVLTLPEVLCIHLKRFRND 463

Query: 477 LLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           L +S+K+          +  R    K     V+ Y+L +VI H GTVGGG
Sbjct: 464 LSYSSKISSDVYFPLEGFDMRPYIHKDCKSEVAIYNLSSVICHHGTVGGG 513



 Score = 81.4 bits (192), Expect = 1e-15
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query: 7   PNSARAKSGSSGDGSNVKY-RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           P   + K+ SS +   ++  RSIISDVF GKLLS+VQCL CDRVSTR ETFQDLSLPIP+
Sbjct: 301 PLQHQQKNVSSAEQKPIEAARSIISDVFDGKLLSSVQCLTCDRVSTREETFQDLSLPIPN 360

Query: 184 REHLAVL 204
           R+ L VL
Sbjct: 361 RDFLNVL 367


>AY118338-1|AAM48367.1|  975|Drosophila melanogaster LD43649p
           protein.
          Length = 975

 Score =  125 bits (302), Expect = 5e-29
 Identities = 59/110 (53%), Positives = 75/110 (68%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           YGP V+L DC+A+FFSADELKGDNMYSC RC KLR G+K S ++ LP VLC+HLKRFR++
Sbjct: 389 YGPSVTLYDCMASFFSADELKGDNMYSCERCNKLRTGIKYSRVLTLPEVLCIHLKRFRND 448

Query: 477 LLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           L +S+K+          +  R    K     V+ Y+L +VI H GTVGGG
Sbjct: 449 LSYSSKISSDVYFPLEGFDMRPYIHKDCKSEVAIYNLSSVICHHGTVGGG 498



 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query: 7   PNSARAKSGSSGDGSNVKY-RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           P   + K+ SS +   ++  RSIISDVF GKLLS+VQCL CDRVSTR ETFQDLSLPIP+
Sbjct: 286 PLQHQQKNASSAEQKPIEAARSIISDVFDGKLLSSVQCLTCDRVSTREETFQDLSLPIPN 345

Query: 184 REHLAVL 204
           R+ L VL
Sbjct: 346 RDFLNVL 352


>AE013599-1855|AAF58273.2|  975|Drosophila melanogaster CG8494-PA
           protein.
          Length = 975

 Score =  125 bits (302), Expect = 5e-29
 Identities = 59/110 (53%), Positives = 75/110 (68%)
 Frame = +3

Query: 297 YGPVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           YGP V+L DC+A+FFSADELKGDNMYSC RC KLR G+K S ++ LP VLC+HLKRFR++
Sbjct: 389 YGPSVTLYDCMASFFSADELKGDNMYSCERCNKLRTGIKYSRVLTLPEVLCIHLKRFRND 448

Query: 477 LLFSAKVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           L +S+K+          +  R    K     V+ Y+L +VI H GTVGGG
Sbjct: 449 LSYSSKISSDVYFPLEGFDMRPYIHKDCKSEVAIYNLSSVICHHGTVGGG 498



 Score = 82.6 bits (195), Expect = 5e-16
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query: 7   PNSARAKSGSSGDGSNVKY-RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPS 183
           P   + K+ SS +   ++  RSIISDVF GKLLS+VQCL CDRVSTR ETFQDLSLPIP+
Sbjct: 286 PLQHQQKNASSAEQKPIEAARSIISDVFDGKLLSSVQCLTCDRVSTREETFQDLSLPIPN 345

Query: 184 REHLAVL 204
           R+ L VL
Sbjct: 346 RDFLNVL 352


>AY058707-1|AAL13936.1|  703|Drosophila melanogaster LD43147p
           protein.
          Length = 703

 Score = 56.4 bits (130), Expect = 3e-08
 Identities = 32/105 (30%), Positives = 44/105 (41%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           +L DCL  +  A+ L       CS CK  +   K   +  LP V+  HLKRF H  L   
Sbjct: 552 TLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDR 611

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           K+                  K       R+SL AV++H+GT+  G
Sbjct: 612 KISSFIQFPVEFDMTPFMSEKKNAYGDFRFSLYAVVNHVGTIDTG 656



 Score = 35.9 bits (79), Expect = 0.053
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 5/61 (8%)
 Frame = +1

Query: 10  NSARAKSGSSGDGSNVKY-----RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLP 174
           NS+ + SG++   S+  +       II  +F G L S V C  C+ VST  + F D+SL 
Sbjct: 479 NSSGSGSGTNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLD 538

Query: 175 I 177
           +
Sbjct: 539 L 539


>AF179590-1|AAD53181.1|  735|Drosophila melanogaster
           ubiquitin-specific protease nonstopprotein.
          Length = 735

 Score = 56.4 bits (130), Expect = 3e-08
 Identities = 32/105 (30%), Positives = 44/105 (41%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           +L DCL  +  A+ L       CS CK  +   K   +  LP V+  HLKRF H  L   
Sbjct: 584 TLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDR 643

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           K+                  K       R+SL AV++H+GT+  G
Sbjct: 644 KISSFIQFPVEFDMTPFMSEKKNAYGDFRFSLYAVVNHVGTIDTG 688



 Score = 35.9 bits (79), Expect = 0.053
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 5/61 (8%)
 Frame = +1

Query: 10  NSARAKSGSSGDGSNVKY-----RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLP 174
           NS+ + SG++   S+  +       II  +F G L S V C  C+ VST  + F D+SL 
Sbjct: 511 NSSGSGSGTNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLD 570

Query: 175 I 177
           +
Sbjct: 571 L 571


>AE014296-3035|AAF49249.1|  735|Drosophila melanogaster CG4166-PA
           protein.
          Length = 735

 Score = 56.4 bits (130), Expect = 3e-08
 Identities = 32/105 (30%), Positives = 44/105 (41%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           +L DCL  +  A+ L       CS CK  +   K   +  LP V+  HLKRF H  L   
Sbjct: 584 TLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDR 643

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           K+                  K       R+SL AV++H+GT+  G
Sbjct: 644 KISSFIQFPVEFDMTPFMSEKKNAYGDFRFSLYAVVNHVGTIDTG 688



 Score = 35.9 bits (79), Expect = 0.053
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 5/61 (8%)
 Frame = +1

Query: 10  NSARAKSGSSGDGSNVKY-----RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLP 174
           NS+ + SG++   S+  +       II  +F G L S V C  C+ VST  + F D+SL 
Sbjct: 511 NSSGSGSGTNSSNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLD 570

Query: 175 I 177
           +
Sbjct: 571 L 571


>BT010235-1|AAQ23553.1|  424|Drosophila melanogaster RE52890p
           protein.
          Length = 424

 Score = 48.4 bits (110), Expect = 9e-06
 Identities = 26/101 (25%), Positives = 42/101 (41%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           S+  CL  F + + L  DN + C  C   +   K   +  LP +L +HLKRF++   F+ 
Sbjct: 263 SITHCLRCFSNTETLCSDNKFKCDNCCSYQEAQKRMRVKKLPMILALHLKRFKYMEQFNR 322

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGT 614
            +         +       +  A      Y L AV+ H G+
Sbjct: 323 HIKVSHRVVFPLELRLFNTSDDAVNPDRLYDLTAVVIHCGS 363


>AE014297-3238|AAN13921.1|  364|Drosophila melanogaster CG7023-PA,
           isoform A protein.
          Length = 364

 Score = 48.4 bits (110), Expect = 9e-06
 Identities = 26/101 (25%), Positives = 42/101 (41%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           S+  CL  F + + L  DN + C  C   +   K   +  LP +L +HLKRF++   F+ 
Sbjct: 203 SITHCLRCFSNTETLCSDNKFKCDNCCSYQEAQKRMRVKKLPMILALHLKRFKYMEQFNR 262

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGT 614
            +         +       +  A      Y L AV+ H G+
Sbjct: 263 HIKVSHRVVFPLELRLFNTSDDAVNPDRLYDLTAVVIHCGS 303


>AE014297-3237|AAF56066.1|  424|Drosophila melanogaster CG7023-PB,
           isoform B protein.
          Length = 424

 Score = 48.4 bits (110), Expect = 9e-06
 Identities = 26/101 (25%), Positives = 42/101 (41%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           S+  CL  F + + L  DN + C  C   +   K   +  LP +L +HLKRF++   F+ 
Sbjct: 263 SITHCLRCFSNTETLCSDNKFKCDNCCSYQEAQKRMRVKKLPMILALHLKRFKYMEQFNR 322

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGT 614
            +         +       +  A      Y L AV+ H G+
Sbjct: 323 HIKVSHRVVFPLELRLFNTSDDAVNPDRLYDLTAVVIHCGS 363


>BT003648-1|AAO39652.1|  938|Drosophila melanogaster AT11044p protein.
          Length = 938

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%)
 Frame = +3

Query: 315  LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
            L+ CL  F   + L GD M +C++CK  R   K   I   P  L +HLKRF  E  +S K
Sbjct: 793  LEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKRF-SETRWS-K 850

Query: 495  VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            +        +     +    +       YSL A+ +HMG+  GG
Sbjct: 851  LSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGG 894



 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 17/48 (35%), Positives = 27/48 (56%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           S++ D+F G+L S ++C  C   S   + F DLS+P+PS     +  C
Sbjct: 749 SLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSSSRCKLEAC 796


>AY069803-1|AAL39948.1|  856|Drosophila melanogaster SD04280p protein.
          Length = 856

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%)
 Frame = +3

Query: 315  LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
            L+ CL  F   + L GD M +C++CK  R   K   I   P  L +HLKRF  E  +S K
Sbjct: 711  LEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKRF-SETRWS-K 768

Query: 495  VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            +        +     +    +       YSL A+ +HMG+  GG
Sbjct: 769  LSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGG 812



 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 17/48 (35%), Positives = 27/48 (56%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           S++ D+F G+L S ++C  C   S   + F DLS+P+PS     +  C
Sbjct: 667 SLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSSSRCKLEAC 714


>AE014298-3178|AAN09567.1|  337|Drosophila melanogaster CG14619-PB,
           isoform B protein.
          Length = 337

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%)
 Frame = +3

Query: 315 LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
           L+ CL  F   + L GD M +C++CK  R   K   I   P  L +HLKRF  E  +S K
Sbjct: 192 LEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKRF-SETRWS-K 249

Query: 495 VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
           +        +     +    +       YSL A+ +HMG+  GG
Sbjct: 250 LSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGG 293



 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 17/48 (35%), Positives = 27/48 (56%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           S++ D+F G+L S ++C  C   S   + F DLS+P+PS     +  C
Sbjct: 148 SLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSSSRCKLEAC 195


>AE014298-3177|AAN09566.1|  938|Drosophila melanogaster CG14619-PC,
            isoform C protein.
          Length = 938

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%)
 Frame = +3

Query: 315  LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
            L+ CL  F   + L GD M +C++CK  R   K   I   P  L +HLKRF  E  +S K
Sbjct: 793  LEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKRF-SETRWS-K 850

Query: 495  VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            +        +     +    +       YSL A+ +HMG+  GG
Sbjct: 851  LSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGG 894



 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 17/48 (35%), Positives = 27/48 (56%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           S++ D+F G+L S ++C  C   S   + F DLS+P+PS     +  C
Sbjct: 749 SLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSSSRCKLEAC 796


>AE014298-3176|AAN09565.1|  856|Drosophila melanogaster CG14619-PE,
            isoform E protein.
          Length = 856

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%)
 Frame = +3

Query: 315  LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
            L+ CL  F   + L GD M +C++CK  R   K   I   P  L +HLKRF  E  +S K
Sbjct: 711  LEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKRF-SETRWS-K 768

Query: 495  VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            +        +     +    +       YSL A+ +HMG+  GG
Sbjct: 769  LSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGG 812



 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 17/48 (35%), Positives = 27/48 (56%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           S++ D+F G+L S ++C  C   S   + F DLS+P+PS     +  C
Sbjct: 667 SLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSSSRCKLEAC 714


>AE014298-3175|AAN09564.1|  856|Drosophila melanogaster CG14619-PD,
            isoform D protein.
          Length = 856

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%)
 Frame = +3

Query: 315  LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
            L+ CL  F   + L GD M +C++CK  R   K   I   P  L +HLKRF  E  +S K
Sbjct: 711  LEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKRF-SETRWS-K 768

Query: 495  VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            +        +     +    +       YSL A+ +HMG+  GG
Sbjct: 769  LSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGG 812



 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 17/48 (35%), Positives = 27/48 (56%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           S++ D+F G+L S ++C  C   S   + F DLS+P+PS     +  C
Sbjct: 667 SLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSSSRCKLEAC 714


>AE014298-3174|AAF50952.2|  856|Drosophila melanogaster CG14619-PA,
            isoform A protein.
          Length = 856

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 33/104 (31%), Positives = 47/104 (45%)
 Frame = +3

Query: 315  LQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
            L+ CL  F   + L GD M +C++CK  R   K   I   P  L +HLKRF  E  +S K
Sbjct: 711  LEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKRF-SETRWS-K 768

Query: 495  VXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
            +        +     +    +       YSL A+ +HMG+  GG
Sbjct: 769  LSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGG 812



 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 17/48 (35%), Positives = 27/48 (56%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           S++ D+F G+L S ++C  C   S   + F DLS+P+PS     +  C
Sbjct: 667 SLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSSSRCKLEAC 714


>AE014297-2941|AAF55858.2|  896|Drosophila melanogaster CG5798-PA
            protein.
          Length = 896

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 34/112 (30%), Positives = 49/112 (43%), Gaps = 5/112 (4%)
 Frame = +3

Query: 306  VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF----RH 473
            V  L  C+  +FS + + G   ++C  CK  R+ +K   I  LP VL VHLKRF     +
Sbjct: 738  VCQLNQCMDMYFSGERIHG---WNCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSN 794

Query: 474  ELLFSAKVXXXXXXXXTI-WT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
               +  K          +     + R +S       Y L AV +H GT+ GG
Sbjct: 795  SGSYMKKQNYLRFPLENLDMNPYIARAESRAVTPKTYQLYAVSNHYGTMEGG 846



 Score = 37.9 bits (84), Expect = 0.013
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 1/60 (1%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVL-RCQQPMLNHHAAH 243
           S+I  +F G++ S V+C+ C + S   E+F +LSL +P   ++  L +C     +    H
Sbjct: 696 SMILHLFYGQMKSTVKCVACHKESATYESFSNLSLELPPNSNVCQLNQCMDMYFSGERIH 755


>AY122247-1|AAM52759.1|  896|Drosophila melanogaster SD04548p protein.
          Length = 896

 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 34/112 (30%), Positives = 48/112 (42%), Gaps = 5/112 (4%)
 Frame = +3

Query: 306  VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF----RH 473
            V  L  C+  +FS + + G   + C  CK  R+ +K   I  LP VL VHLKRF     +
Sbjct: 738  VCQLNQCMDMYFSGERIHG---WKCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSN 794

Query: 474  ELLFSAKVXXXXXXXXTI-WT*RLTRTKSAPRXVSRYSLXAVISHMGTVGGG 626
               +  K          +     + R +S       Y L AV +H GT+ GG
Sbjct: 795  SGSYMKKQNYLRFPLENLDMNPYIARAESRAVTPKTYQLYAVSNHYGTMEGG 846



 Score = 37.9 bits (84), Expect = 0.013
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 1/60 (1%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVL-RCQQPMLNHHAAH 243
           S+I  +F G++ S V+C+ C + S   E+F +LSL +P   ++  L +C     +    H
Sbjct: 696 SMILHLFYGQMKSTVKCVACHKESATYESFSNLSLELPPNSNVCQLNQCMDMYFSGERIH 755


>BT010041-1|AAQ22510.1|  852|Drosophila melanogaster LD36231p
           protein.
          Length = 852

 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 20/55 (36%), Positives = 34/55 (61%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           S+QD +  + S ++L GDN Y C +CKKL +  +  G+   P  L + LK+F+++
Sbjct: 588 SVQDLIEYYCSPEKLDGDNQYFCPQCKKLCDAERHIGVTQAPKNLILTLKQFKYD 642



 Score = 31.1 bits (67), Expect = 1.5
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 3/57 (5%)
 Frame = +1

Query: 19  RAKSGSSGDGSNV---KYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           +A +G    G  V   K  S I   F GKL +  +CL C   S   ++F++L L  P
Sbjct: 520 KATNGLKQQGQQVDQAKPPSTIDKTFAGKLSTTYRCLNCGWESRNEDSFRELQLSFP 576


>AE013599-1490|AAM68683.1|  852|Drosophila melanogaster CG8830-PB,
           isoform B protein.
          Length = 852

 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 20/55 (36%), Positives = 34/55 (61%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           S+QD +  + S ++L GDN Y C +CKKL +  +  G+   P  L + LK+F+++
Sbjct: 588 SVQDLIEYYCSPEKLDGDNQYFCPQCKKLCDAERHIGVTQAPKNLILTLKQFKYD 642



 Score = 31.1 bits (67), Expect = 1.5
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 3/57 (5%)
 Frame = +1

Query: 19  RAKSGSSGDGSNV---KYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           +A +G    G  V   K  S I   F GKL +  +CL C   S   ++F++L L  P
Sbjct: 520 KATNGLKQQGQQVDQAKPPSTIDKTFAGKLSTTYRCLNCGWESRNEDSFRELQLSFP 576


>AE013599-1489|AAF58508.1|  852|Drosophila melanogaster CG8830-PA,
           isoform A protein.
          Length = 852

 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 20/55 (36%), Positives = 34/55 (61%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           S+QD +  + S ++L GDN Y C +CKKL +  +  G+   P  L + LK+F+++
Sbjct: 588 SVQDLIEYYCSPEKLDGDNQYFCPQCKKLCDAERHIGVTQAPKNLILTLKQFKYD 642



 Score = 31.1 bits (67), Expect = 1.5
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 3/57 (5%)
 Frame = +1

Query: 19  RAKSGSSGDGSNV---KYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           +A +G    G  V   K  S I   F GKL +  +CL C   S   ++F++L L  P
Sbjct: 520 KATNGLKQQGQQVDQAKPPSTIDKTFAGKLSTTYRCLNCGWESRNEDSFRELQLSFP 576


>X99211-1|CAA67601.1|  898|Drosophila melanogaster
           ubiquitin-specific protease protein.
          Length = 898

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 20/52 (38%), Positives = 29/52 (55%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+++ L AF   + L G+N Y C +CKK  +  K       P +L +HLKRF
Sbjct: 207 SIEEALRAFVQPETLDGNNQYLCEKCKKKCDAHKGLHFKSFPYILTLHLKRF 258



 Score = 34.3 bits (75), Expect = 0.16
 Identities = 16/43 (37%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +1

Query: 52  NVKYRSIISDVFXGKLLSAVQCLICDRVSTRIE-TFQDLSLPI 177
           N K  ++IS+++ GK+ + V+CL C+      E TF D+ LP+
Sbjct: 154 NTKQANLISNLYEGKMNAYVKCLGCNTEKNDCEDTFLDIPLPV 196


>BT003784-1|AAO41467.1| 1556|Drosophila melanogaster LD26783p
           protein.
          Length = 1556

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 20/52 (38%), Positives = 29/52 (55%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+++ L AF   + L G+N Y C +CKK  +  K       P +L +HLKRF
Sbjct: 548 SIEEALRAFVQPETLDGNNQYLCEKCKKKCDAHKGLHFKSFPYILTLHLKRF 599



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 17/42 (40%), Positives = 28/42 (66%)
 Frame = +1

Query: 52  NVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           N K  ++IS+++ GK+   V+CL C+   TR +TF D+ LP+
Sbjct: 496 NTKQANLISNLYEGKMNDYVKCLECNTEKTREDTFLDIPLPV 537


>AY060809-1|AAL28357.1| 1272|Drosophila melanogaster GH27809p
           protein.
          Length = 1272

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 19/54 (35%), Positives = 31/54 (57%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           ++L+ CL  +  A+ L  ++ + C  C++    VK  G+  LP +L VH KRFR
Sbjct: 722 LTLEQCLEHYTKAETLSAEDAWRCPHCQQYLPVVKTLGLWSLPDILVVHFKRFR 775


>AE014296-3238|AAF49100.3| 1736|Drosophila melanogaster CG8334-PA
            protein.
          Length = 1736

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 24/53 (45%), Positives = 29/53 (54%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
            V L  CL AF S ++L  +  Y CS CK  +   K   I  LP +L VHLKRF
Sbjct: 1445 VDLNHCLRAFTSEEKL--EQWYHCSHCKGKKPATKKLQIWKLPPILIVHLKRF 1495



 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 20/48 (41%), Positives = 29/48 (60%)
 Frame = +1

Query: 52  NVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           + + +SII D+F G+L S V CL C   S R + F  LSLP+P   ++
Sbjct: 815 HARNQSIIIDLFYGQLKSKVSCLGCGHESVRFDPFSLLSLPLPVENYI 862


>AE014296-993|AAS65076.1| 1556|Drosophila melanogaster CG5486-PC,
           isoform C protein.
          Length = 1556

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 20/52 (38%), Positives = 29/52 (55%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+++ L AF   + L G+N Y C +CKK  +  K       P +L +HLKRF
Sbjct: 548 SIEEALRAFVQPETLDGNNQYLCEKCKKKCDAHKGLHFKSFPYILTLHLKRF 599



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 17/42 (40%), Positives = 28/42 (66%)
 Frame = +1

Query: 52  NVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           N K  ++IS+++ GK+   V+CL C+   TR +TF D+ LP+
Sbjct: 496 NTKQANLISNLYEGKMNDYVKCLECNTEKTREDTFLDIPLPV 537


>AE014296-992|AAN12105.1| 1556|Drosophila melanogaster CG5486-PB,
           isoform B protein.
          Length = 1556

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 20/52 (38%), Positives = 29/52 (55%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+++ L AF   + L G+N Y C +CKK  +  K       P +L +HLKRF
Sbjct: 548 SIEEALRAFVQPETLDGNNQYLCEKCKKKCDAHKGLHFKSFPYILTLHLKRF 599



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 17/42 (40%), Positives = 28/42 (66%)
 Frame = +1

Query: 52  NVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           N K  ++IS+++ GK+   V+CL C+   TR +TF D+ LP+
Sbjct: 496 NTKQANLISNLYEGKMNDYVKCLECNTEKTREDTFLDIPLPV 537


>AE014296-991|AAF50752.2| 1556|Drosophila melanogaster CG5486-PA,
           isoform A protein.
          Length = 1556

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 20/52 (38%), Positives = 29/52 (55%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           S+++ L AF   + L G+N Y C +CKK  +  K       P +L +HLKRF
Sbjct: 548 SIEEALRAFVQPETLDGNNQYLCEKCKKKCDAHKGLHFKSFPYILTLHLKRF 599



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 17/42 (40%), Positives = 28/42 (66%)
 Frame = +1

Query: 52  NVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           N K  ++IS+++ GK+   V+CL C+   TR +TF D+ LP+
Sbjct: 496 NTKQANLISNLYEGKMNDYVKCLECNTEKTREDTFLDIPLPV 537


>AE013599-3941|AAF47260.2| 1272|Drosophila melanogaster CG30421-PA
           protein.
          Length = 1272

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 19/54 (35%), Positives = 31/54 (57%)
 Frame = +3

Query: 309 VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFR 470
           ++L+ CL  +  A+ L  ++ + C  C++    VK  G+  LP +L VH KRFR
Sbjct: 722 LTLEQCLEHYTKAETLSAEDAWRCPHCQQYLPVVKTLGLWSLPDILVVHFKRFR 775


>AE014297-3585|AAS65209.1| 2832|Drosophila melanogaster CG5794-PE,
            isoform E protein.
          Length = 2832

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            +LQ+ L      D L+GDNMY+CS+C K     K +    LP +LC +  R+   ++   
Sbjct: 2161 NLQESLDEVTVKDTLEGDNMYTCSQCGKKVRAEKRACFKKLPQILCFNTMRYTFNMVTML 2220

Query: 492  K 494
            K
Sbjct: 2221 K 2221


>AE014297-3584|AAN14009.1| 3703|Drosophila melanogaster CG5794-PB,
            isoform B protein.
          Length = 3703

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            +LQ+ L      D L+GDNMY+CS+C K     K +    LP +LC +  R+   ++   
Sbjct: 1952 NLQESLDEVTVKDTLEGDNMYTCSQCGKKVRAEKRACFKKLPQILCFNTMRYTFNMVTML 2011

Query: 492  K 494
            K
Sbjct: 2012 K 2012


>AE014297-3583|AAF56319.2| 3912|Drosophila melanogaster CG5794-PD,
            isoform D protein.
          Length = 3912

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
            +LQ+ L      D L+GDNMY+CS+C K     K +    LP +LC +  R+   ++   
Sbjct: 2161 NLQESLDEVTVKDTLEGDNMYTCSQCGKKVRAEKRACFKKLPQILCFNTMRYTFNMVTML 2220

Query: 492  K 494
            K
Sbjct: 2221 K 2221


>BT010120-1|AAQ22589.1|  948|Drosophila melanogaster AT24152p
           protein.
          Length = 948

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 26/100 (26%), Positives = 44/100 (44%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL+D     FS + L+ D  Y C  CKK  +  K   +   P  LC+ LKRF   ++ + 
Sbjct: 246 SLEDAFEGHFSRERLE-DMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRF--SMIGNK 302

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
                        +    R+++A      Y L ++++H+G
Sbjct: 303 LTKQISFKSRIDLSKYAARSQAAQAQPLTYRLVSMVTHLG 342



 Score = 37.5 bits (83), Expect = 0.017
 Identities = 19/47 (40%), Positives = 26/47 (55%)
 Frame = +1

Query: 55  VKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           VK  + +  +F G L S V+CL C+ VS   + FQDL L I   + L
Sbjct: 201 VKETTPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADSL 247


>BT004507-1|AAO42671.1| 1038|Drosophila melanogaster AT31021p
           protein.
          Length = 1038

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 26/100 (26%), Positives = 44/100 (44%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL+D     FS + L+ D  Y C  CKK  +  K   +   P  LC+ LKRF   ++ + 
Sbjct: 336 SLEDAFEGHFSRERLE-DMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRF--SMIGNK 392

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
                        +    R+++A      Y L ++++H+G
Sbjct: 393 LTKQISFKSRIDLSKYAARSQAAQAQPLTYRLVSMVTHLG 432



 Score = 37.5 bits (83), Expect = 0.017
 Identities = 19/47 (40%), Positives = 26/47 (55%)
 Frame = +1

Query: 55  VKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           VK  + +  +F G L S V+CL C+ VS   + FQDL L I   + L
Sbjct: 291 VKETTPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADSL 337


>AY051916-1|AAK93340.1|  968|Drosophila melanogaster LD40339p
           protein.
          Length = 968

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 26/100 (26%), Positives = 44/100 (44%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL+D     FS + L+ D  Y C  CKK  +  K   +   P  LC+ LKRF   ++ + 
Sbjct: 266 SLEDAFEGHFSRERLE-DMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRF--SMIGNK 322

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
                        +    R+++A      Y L ++++H+G
Sbjct: 323 LTKQISFKSRIDLSKYAARSQAAQAQPLTYRLVSMVTHLG 362



 Score = 37.5 bits (83), Expect = 0.017
 Identities = 19/47 (40%), Positives = 26/47 (55%)
 Frame = +1

Query: 55  VKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           VK  + +  +F G L S V+CL C+ VS   + FQDL L I   + L
Sbjct: 221 VKETTPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADSL 267


>AE014296-1003|AAN12111.1|  968|Drosophila melanogaster CG5505-PB,
           isoform B protein.
          Length = 968

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 26/100 (26%), Positives = 44/100 (44%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL+D     FS + L+ D  Y C  CKK  +  K   +   P  LC+ LKRF   ++ + 
Sbjct: 266 SLEDAFEGHFSRERLE-DMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRF--SMIGNK 322

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
                        +    R+++A      Y L ++++H+G
Sbjct: 323 LTKQISFKSRIDLSKYAARSQAAQAQPLTYRLVSMVTHLG 362



 Score = 37.5 bits (83), Expect = 0.017
 Identities = 19/47 (40%), Positives = 26/47 (55%)
 Frame = +1

Query: 55  VKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           VK  + +  +F G L S V+CL C+ VS   + FQDL L I   + L
Sbjct: 221 VKETTPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADSL 267


>AE014296-1002|AAN12110.1| 1015|Drosophila melanogaster CG5505-PE,
           isoform E protein.
          Length = 1015

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 26/100 (26%), Positives = 44/100 (44%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL+D     FS + L+ D  Y C  CKK  +  K   +   P  LC+ LKRF   ++ + 
Sbjct: 266 SLEDAFEGHFSRERLE-DMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRF--SMIGNK 322

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
                        +    R+++A      Y L ++++H+G
Sbjct: 323 LTKQISFKSRIDLSKYAARSQAAQAQPLTYRLVSMVTHLG 362



 Score = 37.5 bits (83), Expect = 0.017
 Identities = 19/47 (40%), Positives = 26/47 (55%)
 Frame = +1

Query: 55  VKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           VK  + +  +F G L S V+CL C+ VS   + FQDL L I   + L
Sbjct: 221 VKETTPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADSL 267


>AE014296-1001|AAN12109.1|  948|Drosophila melanogaster CG5505-PC,
           isoform C protein.
          Length = 948

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 26/100 (26%), Positives = 44/100 (44%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL+D     FS + L+ D  Y C  CKK  +  K   +   P  LC+ LKRF   ++ + 
Sbjct: 246 SLEDAFEGHFSRERLE-DMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRF--SMIGNK 302

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
                        +    R+++A      Y L ++++H+G
Sbjct: 303 LTKQISFKSRIDLSKYAARSQAAQAQPLTYRLVSMVTHLG 342



 Score = 37.5 bits (83), Expect = 0.017
 Identities = 19/47 (40%), Positives = 26/47 (55%)
 Frame = +1

Query: 55  VKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           VK  + +  +F G L S V+CL C+ VS   + FQDL L I   + L
Sbjct: 201 VKETTPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADSL 247


>AE014296-1000|AAN12108.1|  995|Drosophila melanogaster CG5505-PF,
           isoform F protein.
          Length = 995

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 26/100 (26%), Positives = 44/100 (44%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL+D     FS + L+ D  Y C  CKK  +  K   +   P  LC+ LKRF   ++ + 
Sbjct: 246 SLEDAFEGHFSRERLE-DMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRF--SMIGNK 302

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
                        +    R+++A      Y L ++++H+G
Sbjct: 303 LTKQISFKSRIDLSKYAARSQAAQAQPLTYRLVSMVTHLG 342



 Score = 37.5 bits (83), Expect = 0.017
 Identities = 19/47 (40%), Positives = 26/47 (55%)
 Frame = +1

Query: 55  VKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           VK  + +  +F G L S V+CL C+ VS   + FQDL L I   + L
Sbjct: 201 VKETTPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADSL 247


>AE014296-999|AAN12107.1| 1038|Drosophila melanogaster CG5505-PD,
           isoform D protein.
          Length = 1038

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 26/100 (26%), Positives = 44/100 (44%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL+D     FS + L+ D  Y C  CKK  +  K   +   P  LC+ LKRF   ++ + 
Sbjct: 336 SLEDAFEGHFSRERLE-DMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRF--SMIGNK 392

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
                        +    R+++A      Y L ++++H+G
Sbjct: 393 LTKQISFKSRIDLSKYAARSQAAQAQPLTYRLVSMVTHLG 432



 Score = 37.5 bits (83), Expect = 0.017
 Identities = 19/47 (40%), Positives = 26/47 (55%)
 Frame = +1

Query: 55  VKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           VK  + +  +F G L S V+CL C+ VS   + FQDL L I   + L
Sbjct: 291 VKETTPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADSL 337


>AE014296-998|AAF50748.2| 1085|Drosophila melanogaster CG5505-PA,
           isoform A protein.
          Length = 1085

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 26/100 (26%), Positives = 44/100 (44%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSA 491
           SL+D     FS + L+ D  Y C  CKK  +  K   +   P  LC+ LKRF   ++ + 
Sbjct: 336 SLEDAFEGHFSRERLE-DMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRF--SMIGNK 392

Query: 492 KVXXXXXXXXTIWT*RLTRTKSAPRXVSRYSLXAVISHMG 611
                        +    R+++A      Y L ++++H+G
Sbjct: 393 LTKQISFKSRIDLSKYAARSQAAQAQPLTYRLVSMVTHLG 432



 Score = 37.5 bits (83), Expect = 0.017
 Identities = 19/47 (40%), Positives = 26/47 (55%)
 Frame = +1

Query: 55  VKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           VK  + +  +F G L S V+CL C+ VS   + FQDL L I   + L
Sbjct: 291 VKETTPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADSL 337


>L04960-2|AAF01347.1| 2711|Drosophila melanogaster fat facets short
            isoform protein.
          Length = 2711

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
            SL + L  +   + L+G + Y C +C K    VK   +  LP VL + LKRF ++
Sbjct: 1864 SLTESLEQYVKGELLEGADAYHCDKCDKKVVTVKRVCVKKLPPVLAIQLKRFEYD 1918


>L04960-1|AAF01348.1| 2747|Drosophila melanogaster fat facets long
            isoform protein.
          Length = 2747

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
            SL + L  +   + L+G + Y C +C K    VK   +  LP VL + LKRF ++
Sbjct: 1864 SLTESLEQYVKGELLEGADAYHCDKCDKKVVTVKRVCVKKLPPVLAIQLKRFEYD 1918


>L04959-1|AAF01345.1| 2747|Drosophila melanogaster fat facets long
            isoform protein.
          Length = 2747

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
            SL + L  +   + L+G + Y C +C K    VK   +  LP VL + LKRF ++
Sbjct: 1864 SLTESLEQYVKGELLEGADAYHCDKCDKKVVTVKRVCVKKLPPVLAIQLKRFEYD 1918


>L04958-1|AAF01346.1| 2711|Drosophila melanogaster fat facets short
            isoform protein.
          Length = 2711

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
            SL + L  +   + L+G + Y C +C K    VK   +  LP VL + LKRF ++
Sbjct: 1864 SLTESLEQYVKGELLEGADAYHCDKCDKKVVTVKRVCVKKLPPVLAIQLKRFEYD 1918


>AF145677-1|AAD38652.1| 1689|Drosophila melanogaster BcDNA.LD22582
           protein.
          Length = 1689

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           SL + L  +   + L+G + Y C +C K    VK   +  LP VL + LKRF ++
Sbjct: 775 SLTESLEQYVKGELLEGADAYHCDKCDKKVVTVKRVCVKKLPPVLAIQLKRFEYD 829


>AE014297-4810|AAN14291.1| 2711|Drosophila melanogaster CG1945-PC,
            isoform C protein.
          Length = 2711

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
            SL + L  +   + L+G + Y C +C K    VK   +  LP VL + LKRF ++
Sbjct: 1864 SLTESLEQYVKGELLEGADAYHCDKCDKKVVTVKRVCVKKLPPVLAIQLKRFEYD 1918


>AE014297-4809|AAF57198.1| 2778|Drosophila melanogaster CG1945-PA,
            isoform A protein.
          Length = 2778

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
            SL + L  +   + L+G + Y C +C K    VK   +  LP VL + LKRF ++
Sbjct: 1864 SLTESLEQYVKGELLEGADAYHCDKCDKKVVTVKRVCVKKLPPVLAIQLKRFEYD 1918


>AY051846-1|AAK93270.1| 1126|Drosophila melanogaster LD34905p
           protein.
          Length = 1126

 Score = 35.1 bits (77), Expect = 0.092
 Identities = 16/32 (50%), Positives = 21/32 (65%)
 Frame = +1

Query: 82  VFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           VF G L+S + C  C  VS+R E F D+SLP+
Sbjct: 478 VFRGFLVSTLTCQDCHNVSSRHEYFLDMSLPV 509


>AE014298-743|AAN09142.1| 1126|Drosophila melanogaster CG4165-PD,
           isoform D protein.
          Length = 1126

 Score = 35.1 bits (77), Expect = 0.092
 Identities = 16/32 (50%), Positives = 21/32 (65%)
 Frame = +1

Query: 82  VFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           VF G L+S + C  C  VS+R E F D+SLP+
Sbjct: 478 VFRGFLVSTLTCQDCHNVSSRHEYFLDMSLPV 509


>AE014298-742|AAN09141.1| 1126|Drosophila melanogaster CG4165-PC,
           isoform C protein.
          Length = 1126

 Score = 35.1 bits (77), Expect = 0.092
 Identities = 16/32 (50%), Positives = 21/32 (65%)
 Frame = +1

Query: 82  VFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           VF G L+S + C  C  VS+R E F D+SLP+
Sbjct: 478 VFRGFLVSTLTCQDCHNVSSRHEYFLDMSLPV 509


>AE014298-741|AAN09140.1| 1126|Drosophila melanogaster CG4165-PB,
           isoform B protein.
          Length = 1126

 Score = 35.1 bits (77), Expect = 0.092
 Identities = 16/32 (50%), Positives = 21/32 (65%)
 Frame = +1

Query: 82  VFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           VF G L+S + C  C  VS+R E F D+SLP+
Sbjct: 478 VFRGFLVSTLTCQDCHNVSSRHEYFLDMSLPV 509


>AE014298-740|AAF46033.1| 1126|Drosophila melanogaster CG4165-PA,
           isoform A protein.
          Length = 1126

 Score = 35.1 bits (77), Expect = 0.092
 Identities = 16/32 (50%), Positives = 21/32 (65%)
 Frame = +1

Query: 82  VFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           VF G L+S + C  C  VS+R E F D+SLP+
Sbjct: 478 VFRGFLVSTLTCQDCHNVSSRHEYFLDMSLPV 509


>AE014298-1743|AAF48134.1| 1129|Drosophila melanogaster CG1490-PB
           protein.
          Length = 1129

 Score = 34.7 bits (76), Expect = 0.12
 Identities = 16/41 (39%), Positives = 25/41 (60%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           I  +F GK+ S ++C   D  STR ETF D+ L I  ++++
Sbjct: 347 IPGLFEGKMSSYIKCKNVDYNSTRYETFYDIQLNIKDKKNI 387


>BT001496-1|AAN71251.1| 1078|Drosophila melanogaster LD32685p
           protein.
          Length = 1078

 Score = 34.3 bits (75), Expect = 0.16
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +3

Query: 357 KGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           +G+N YSC++C      ++     VLP +L + L RF
Sbjct: 722 RGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRF 758



 Score = 28.7 bits (61), Expect = 8.0
 Identities = 10/38 (26%), Positives = 22/38 (57%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           +  S  F G ++   +CL C+ ++ + +   D+S+P+P
Sbjct: 657 NFFSSDFEGIVVLTTKCLSCETITRQKQGMLDISVPVP 694


>AF181650-1|AAD55436.1| 1078|Drosophila melanogaster BcDNA.LD22910
           protein.
          Length = 1078

 Score = 34.3 bits (75), Expect = 0.16
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +3

Query: 357 KGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           +G+N YSC++C      ++     VLP +L + L RF
Sbjct: 722 RGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRF 758



 Score = 28.7 bits (61), Expect = 8.0
 Identities = 10/38 (26%), Positives = 22/38 (57%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           +  S  F G ++   +CL C+ ++ + +   D+S+P+P
Sbjct: 657 NFFSSDFEGIVVLTTKCLSCETITRQKQGMLDISVPVP 694


>AE014297-4360|AAN14167.1| 1078|Drosophila melanogaster CG15817-PA,
           isoform A protein.
          Length = 1078

 Score = 34.3 bits (75), Expect = 0.16
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +3

Query: 357 KGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           +G+N YSC++C      ++     VLP +L + L RF
Sbjct: 722 RGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRF 758



 Score = 28.7 bits (61), Expect = 8.0
 Identities = 10/38 (26%), Positives = 22/38 (57%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           +  S  F G ++   +CL C+ ++ + +   D+S+P+P
Sbjct: 657 NFFSSDFEGIVVLTTKCLSCETITRQKQGMLDISVPVP 694


>AE014297-4359|AAF56881.1| 1084|Drosophila melanogaster CG15817-PB,
           isoform B protein.
          Length = 1084

 Score = 34.3 bits (75), Expect = 0.16
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +3

Query: 357 KGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           +G+N YSC++C      ++     VLP +L + L RF
Sbjct: 728 RGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRF 764



 Score = 28.7 bits (61), Expect = 8.0
 Identities = 10/38 (26%), Positives = 22/38 (57%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           +  S  F G ++   +CL C+ ++ + +   D+S+P+P
Sbjct: 663 NFFSSDFEGIVVLTTKCLSCETITRQKQGMLDISVPVP 700


>BT025074-1|ABE73245.1|  325|Drosophila melanogaster IP15289p
           protein.
          Length = 325

 Score = 29.1 bits (62), Expect = 6.0
 Identities = 16/48 (33%), Positives = 23/48 (47%)
 Frame = +3

Query: 543 TRTKSAPRXVSRYSLXAVISHMGTVGGGALQRXXVPPXPXLVTPSNEP 686
           T TK  P+ V+   L AV  ++GT  GG      + P P  + P + P
Sbjct: 225 TTTKKQPQAVADAVLSAVGGNVGTAVGGGTISSLLGPEPLPIMPHHLP 272


>AY069300-1|AAL39445.1|  508|Drosophila melanogaster HL02756p
           protein.
          Length = 508

 Score = 29.1 bits (62), Expect = 6.0
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = +3

Query: 552 KSAPRXVSRYSLXAVISHMGTVGGG 626
           K     V+ Y+L +VI H GTVGGG
Sbjct: 7   KDCKSEVAIYNLSSVICHHGTVGGG 31


>AB043038-1|BAB32536.1|  195|Drosophila melanogaster alpha-amylase
           protein.
          Length = 195

 Score = 28.7 bits (61), Expect = 8.0
 Identities = 14/29 (48%), Positives = 15/29 (51%)
 Frame = +1

Query: 307 WCRCKTVWPPSSAPTNSKATTCTAAPAAR 393
           W    T WPP+ APT   A     APAAR
Sbjct: 114 WTWSSTTWPPTEAPTALAA--APPAPAAR 140


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,837,405
Number of Sequences: 53049
Number of extensions: 536768
Number of successful extensions: 1955
Number of sequences better than 10.0: 61
Number of HSP's better than 10.0 without gapping: 1767
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1944
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3046624548
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -