SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30137.Seq
         (875 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF181634-1|AAD55420.1|  558|Drosophila melanogaster BcDNA.GH0645...   166   3e-41
AE014134-3050|AAF53768.1|  558|Drosophila melanogaster CG10687-P...   166   3e-41
AE013599-1738|AAF58362.1|  375|Drosophila melanogaster CG13331-P...    32   1.2  
AE013599-1737|AAM68588.1|  430|Drosophila melanogaster CG13331-P...    32   1.2  
AE014297-327|AAF51973.2|  648|Drosophila melanogaster CG2179-PB,...    31   2.1  
AE014297-326|AAF51972.2|  783|Drosophila melanogaster CG2179-PA,...    31   2.1  
BT023498-1|AAY84898.1| 1190|Drosophila melanogaster LD32453p pro...    30   3.6  
AY069344-1|AAL39489.2|  985|Drosophila melanogaster LD05471p pro...    30   3.6  
AF179287-1|AAD52673.1| 1179|Drosophila melanogaster SMC2 protein.      30   3.6  
AE013599-1965|AAF58197.1| 1179|Drosophila melanogaster CG10212-P...    30   3.6  
AF160911-1|AAD46851.1| 1028|Drosophila melanogaster BcDNA.LD0556...    29   6.4  
AE014296-1819|AAF50157.1| 1028|Drosophila melanogaster CG6539-PA...    29   6.4  
BT001557-1|AAN71312.1|  631|Drosophila melanogaster RE12423p pro...    29   8.4  
AY119239-1|AAM51099.1|  638|Drosophila melanogaster SD19435p pro...    29   8.4  
AF250926-1|AAF74722.1|  631|Drosophila melanogaster PNGase protein.    29   8.4  
AE013599-132|AAF57293.2|  631|Drosophila melanogaster CG7865-PA,...    29   8.4  
AE013599-131|AAM68339.2|  638|Drosophila melanogaster CG7865-PB,...    29   8.4  

>AF181634-1|AAD55420.1|  558|Drosophila melanogaster BcDNA.GH06451
           protein.
          Length = 558

 Score =  166 bits (404), Expect = 3e-41
 Identities = 79/109 (72%), Positives = 87/109 (79%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGK 690
           WVHRLRRQGKSL F+TLRDGTG+LQCVL+  LCQTY+AL LSTESSVVL+G L+ VPEGK
Sbjct: 143 WVHRLRRQGKSLIFITLRDGTGFLQCVLNDQLCQTYDALTLSTESSVVLFGTLKLVPEGK 202

Query: 691 KAPGGHELTADYWGIDWTRTTRWCDAILNEEALPDVQLDHRXIMIRXEN 837
            APGGHEL  DYW +         DAILNEEA PDVQLD+R IMIR EN
Sbjct: 203 TAPGGHELNVDYWELIGLAPPGGADAILNEEAQPDVQLDNRHIMIRGEN 251



 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 44/84 (52%), Positives = 60/84 (71%), Gaps = 6/84 (7%)
 Frame = +2

Query: 266 DTKD------YDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQ 427
           DTKD      Y+ AAKSQLKKIQK++VRE++K  DK + E E+ EKR QNL++A+K+ + 
Sbjct: 55  DTKDPNAAEPYEPAAKSQLKKIQKLFVRESHKNADKLQREAEDAEKRQQNLEDARKVKIS 114

Query: 428 EDPSLPKATVVKICETTEHRGQRI 499
           EDPSLP A  ++I E T +R  R+
Sbjct: 115 EDPSLPVARKIRIYEGTANRDSRV 138



 Score = 56.0 bits (129), Expect = 6e-08
 Identities = 27/52 (51%), Positives = 31/52 (59%)
 Frame = +3

Query: 108 VGNLSLSEIYTSXXXXXXXXXXXXXEKPFKTILKAMHHAGKEPFPTIYVTQK 263
           +  L+L  I+TS              KPFKTIL+AM HAGKEPFPTIYV  K
Sbjct: 6   LAELTLGAIFTSEKKGSDESGDGSESKPFKTILQAMRHAGKEPFPTIYVDTK 57


>AE014134-3050|AAF53768.1|  558|Drosophila melanogaster CG10687-PA
           protein.
          Length = 558

 Score =  166 bits (404), Expect = 3e-41
 Identities = 79/109 (72%), Positives = 87/109 (79%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGK 690
           WVHRLRRQGKSL F+TLRDGTG+LQCVL+  LCQTY+AL LSTESSVVL+G L+ VPEGK
Sbjct: 143 WVHRLRRQGKSLIFITLRDGTGFLQCVLNDQLCQTYDALTLSTESSVVLFGTLKLVPEGK 202

Query: 691 KAPGGHELTADYWGIDWTRTTRWCDAILNEEALPDVQLDHRXIMIRXEN 837
            APGGHEL  DYW +         DAILNEEA PDVQLD+R IMIR EN
Sbjct: 203 TAPGGHELNVDYWELIGLAPPGGADAILNEEAQPDVQLDNRHIMIRGEN 251



 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 44/84 (52%), Positives = 60/84 (71%), Gaps = 6/84 (7%)
 Frame = +2

Query: 266 DTKD------YDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQ 427
           DTKD      Y+ AAKSQLKKIQK++VRE++K  DK + E E+ EKR QNL++A+K+ + 
Sbjct: 55  DTKDPNAAEPYEPAAKSQLKKIQKLFVRESHKNADKLQREAEDAEKRQQNLEDARKVKIS 114

Query: 428 EDPSLPKATVVKICETTEHRGQRI 499
           EDPSLP A  ++I E T +R  R+
Sbjct: 115 EDPSLPVARKIRIYEGTANRDSRV 138



 Score = 56.0 bits (129), Expect = 6e-08
 Identities = 27/52 (51%), Positives = 31/52 (59%)
 Frame = +3

Query: 108 VGNLSLSEIYTSXXXXXXXXXXXXXEKPFKTILKAMHHAGKEPFPTIYVTQK 263
           +  L+L  I+TS              KPFKTIL+AM HAGKEPFPTIYV  K
Sbjct: 6   LAELTLGAIFTSEKKGSDESGDGSESKPFKTILQAMRHAGKEPFPTIYVDTK 57


>AE013599-1738|AAF58362.1|  375|Drosophila melanogaster CG13331-PA,
           isoform A protein.
          Length = 375

 Score = 31.9 bits (69), Expect = 1.2
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 5/81 (6%)
 Frame = +2

Query: 218 SCWQRAISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQN 397
           S WQ AI       +    DY+   + + K+ QK  +R NY+  +  +  E++ E   + 
Sbjct: 16  SVWQEAIGR-----RHFILDYEPRQRQRWKR-QKTRLRGNYQQSESYEILEQSVEDSVEY 69

Query: 398 LDE-----AKKILLQEDPSLP 445
           LDE     A K+ LQ+  SLP
Sbjct: 70  LDEYLLLDATKLTLQQQQSLP 90


>AE013599-1737|AAM68588.1|  430|Drosophila melanogaster CG13331-PB,
           isoform B protein.
          Length = 430

 Score = 31.9 bits (69), Expect = 1.2
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 5/81 (6%)
 Frame = +2

Query: 218 SCWQRAISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQN 397
           S WQ AI       +    DY+   + + K+ QK  +R NY+  +  +  E++ E   + 
Sbjct: 71  SVWQEAIGR-----RHFILDYEPRQRQRWKR-QKTRLRGNYQQSESYEILEQSVEDSVEY 124

Query: 398 LDE-----AKKILLQEDPSLP 445
           LDE     A K+ LQ+  SLP
Sbjct: 125 LDEYLLLDATKLTLQQQQSLP 145


>AE014297-327|AAF51973.2|  648|Drosophila melanogaster CG2179-PB,
           isoform B protein.
          Length = 648

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 25/84 (29%), Positives = 38/84 (45%)
 Frame = +2

Query: 245 NLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILL 424
           N+C S D  K    +   + ++I+K       K + KAKAE+E  EK  +  +E      
Sbjct: 120 NICVSFDKQKHLSDSNIQRRERIRK-------KFIAKAKAEDEEREKLKKQQEEELDRER 172

Query: 425 QEDPSLPKATVVKICETTEHRGQR 496
           Q+   L KA   K  E  E R ++
Sbjct: 173 QKQEELKKAEAEKQREREERRKEK 196


>AE014297-326|AAF51972.2|  783|Drosophila melanogaster CG2179-PA,
           isoform A protein.
          Length = 783

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 25/84 (29%), Positives = 38/84 (45%)
 Frame = +2

Query: 245 NLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILL 424
           N+C S D  K    +   + ++I+K       K + KAKAE+E  EK  +  +E      
Sbjct: 255 NICVSFDKQKHLSDSNIQRRERIRK-------KFIAKAKAEDEEREKLKKQQEEELDRER 307

Query: 425 QEDPSLPKATVVKICETTEHRGQR 496
           Q+   L KA   K  E  E R ++
Sbjct: 308 QKQEELKKAEAEKQREREERRKEK 331


>BT023498-1|AAY84898.1| 1190|Drosophila melanogaster LD32453p protein.
          Length = 1190

 Score = 30.3 bits (65), Expect = 3.6
 Identities = 20/70 (28%), Positives = 35/70 (50%)
 Frame = +2

Query: 260  KDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPS 439
            KD  +D +   ++QL K +K+ ++EN +   + K +E   +K S +  EAKK +   +  
Sbjct: 888  KDKLRDQNKEMRNQLVKKEKM-LKENQEIELEVKKKENEQKKISSDAKEAKKRMEALEAK 946

Query: 440  LPKATVVKIC 469
             P     K C
Sbjct: 947  YPWIPEEKNC 956


>AY069344-1|AAL39489.2|  985|Drosophila melanogaster LD05471p
           protein.
          Length = 985

 Score = 30.3 bits (65), Expect = 3.6
 Identities = 20/70 (28%), Positives = 35/70 (50%)
 Frame = +2

Query: 260 KDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPS 439
           KD  +D +   ++QL K +K+ ++EN +   + K +E   +K S +  EAKK +   +  
Sbjct: 683 KDKLRDQNKEMRNQLVKKEKM-LKENQEIELEVKKKENEQKKISSDAKEAKKRMEALEAK 741

Query: 440 LPKATVVKIC 469
            P     K C
Sbjct: 742 YPWIPEEKNC 751


>AF179287-1|AAD52673.1| 1179|Drosophila melanogaster SMC2 protein.
          Length = 1179

 Score = 30.3 bits (65), Expect = 3.6
 Identities = 20/70 (28%), Positives = 35/70 (50%)
 Frame = +2

Query: 260  KDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPS 439
            KD  +D +   ++QL K +K+ ++EN +   + K +E   +K S +  EAKK +   +  
Sbjct: 877  KDKLRDQNKEMRNQLVKKEKM-LKENQEIELEVKKKENEQKKISSDAKEAKKRMEALEAK 935

Query: 440  LPKATVVKIC 469
             P     K C
Sbjct: 936  YPWIPEEKNC 945


>AE013599-1965|AAF58197.1| 1179|Drosophila melanogaster CG10212-PA
            protein.
          Length = 1179

 Score = 30.3 bits (65), Expect = 3.6
 Identities = 20/70 (28%), Positives = 35/70 (50%)
 Frame = +2

Query: 260  KDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPS 439
            KD  +D +   ++QL K +K+ ++EN +   + K +E   +K S +  EAKK +   +  
Sbjct: 877  KDKLRDQNKEMRNQLVKKEKM-LKENQEIELEVKKKENEQKKISSDAKEAKKRMEALEAK 935

Query: 440  LPKATVVKIC 469
             P     K C
Sbjct: 936  YPWIPEEKNC 945


>AF160911-1|AAD46851.1| 1028|Drosophila melanogaster BcDNA.LD05563
           protein.
          Length = 1028

 Score = 29.5 bits (63), Expect = 6.4
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +2

Query: 257 SKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED- 433
           +K+  K +  A K  LK I      +NY++ + +++EEE  E++      +  +  Q D 
Sbjct: 811 AKERKKHFKEAMKESLKSI------DNYESQESSESEEEEEEEKDLKNKLSVHVTNQMDI 864

Query: 434 PSLPKATV 457
           P +P+A V
Sbjct: 865 PPMPQAAV 872


>AE014296-1819|AAF50157.1| 1028|Drosophila melanogaster CG6539-PA
           protein.
          Length = 1028

 Score = 29.5 bits (63), Expect = 6.4
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +2

Query: 257 SKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQED- 433
           +K+  K +  A K  LK I      +NY++ + +++EEE  E++      +  +  Q D 
Sbjct: 811 AKERKKHFKEAMKESLKSI------DNYESQESSESEEEEEEEKDLKNKLSVHVTNQMDI 864

Query: 434 PSLPKATV 457
           P +P+A V
Sbjct: 865 PPMPQAAV 872


>BT001557-1|AAN71312.1|  631|Drosophila melanogaster RE12423p
           protein.
          Length = 631

 Score = 29.1 bits (62), Expect = 8.4
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = +2

Query: 224 WQRAISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLD 403
           W+R I + L YS+DD +D      +  +KI  + +R+     +  +  +    KR QN  
Sbjct: 356 WKRHIDYILAYSRDDIQDVTWRYTNDHQKI--LHLRKLCGEKEMVQTLDAIRAKRRQNCT 413

Query: 404 EAKKILLQE 430
             +K+ L +
Sbjct: 414 ADRKLFLSQ 422


>AY119239-1|AAM51099.1|  638|Drosophila melanogaster SD19435p
           protein.
          Length = 638

 Score = 29.1 bits (62), Expect = 8.4
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = +2

Query: 224 WQRAISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLD 403
           W+R I + L YS+DD +D      +  +KI  + +R+     +  +  +    KR QN  
Sbjct: 363 WKRHIDYILAYSRDDIQDVTWRYTNDHQKI--LHLRKLCGEKEMVQTLDAIRAKRRQNCT 420

Query: 404 EAKKILLQE 430
             +K+ L +
Sbjct: 421 ADRKLFLSQ 429


>AF250926-1|AAF74722.1|  631|Drosophila melanogaster PNGase protein.
          Length = 631

 Score = 29.1 bits (62), Expect = 8.4
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = +2

Query: 224 WQRAISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLD 403
           W+R I + L YS+DD +D      +  +KI  + +R+     +  +  +    KR QN  
Sbjct: 356 WKRHIDYILAYSRDDIQDVTWRYTNDHQKI--LHLRKLCGEKEMVQTLDAIRAKRRQNCT 413

Query: 404 EAKKILLQE 430
             +K+ L +
Sbjct: 414 ADRKLFLSQ 422


>AE013599-132|AAF57293.2|  631|Drosophila melanogaster CG7865-PA,
           isoform A protein.
          Length = 631

 Score = 29.1 bits (62), Expect = 8.4
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = +2

Query: 224 WQRAISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLD 403
           W+R I + L YS+DD +D      +  +KI  + +R+     +  +  +    KR QN  
Sbjct: 356 WKRHIDYILAYSRDDIQDVTWRYTNDHQKI--LHLRKLCGEKEMVQTLDAIRAKRRQNCT 413

Query: 404 EAKKILLQE 430
             +K+ L +
Sbjct: 414 ADRKLFLSQ 422


>AE013599-131|AAM68339.2|  638|Drosophila melanogaster CG7865-PB,
           isoform B protein.
          Length = 638

 Score = 29.1 bits (62), Expect = 8.4
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = +2

Query: 224 WQRAISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLD 403
           W+R I + L YS+DD +D      +  +KI  + +R+     +  +  +    KR QN  
Sbjct: 363 WKRHIDYILAYSRDDIQDVTWRYTNDHQKI--LHLRKLCGEKEMVQTLDAIRAKRRQNCT 420

Query: 404 EAKKILLQE 430
             +K+ L +
Sbjct: 421 ADRKLFLSQ 429


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 39,439,106
Number of Sequences: 53049
Number of extensions: 857114
Number of successful extensions: 3061
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 2455
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3055
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4250176164
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -