SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30136.Seq
         (884 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014298-774|AAF46061.1|  310|Drosophila melanogaster CG15778-PA...    30   4.9  
AE014296-2897|AAF49349.4|  926|Drosophila melanogaster CG13731-P...    30   4.9  

>AE014298-774|AAF46061.1|  310|Drosophila melanogaster CG15778-PA
           protein.
          Length = 310

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 16/40 (40%), Positives = 19/40 (47%)
 Frame = -3

Query: 738 PARRLKWGNARGFPSHDVVXRRPRECNTTH*GRIGYRAPP 619
           PA R    N R F S++ V  RPR    T   R+   APP
Sbjct: 249 PAIRFPVANPRSFTSNNYVAPRPRYYRDTEPMRVNVMAPP 288


>AE014296-2897|AAF49349.4|  926|Drosophila melanogaster CG13731-PA
           protein.
          Length = 926

 Score = 29.9 bits (64), Expect = 4.9
 Identities = 13/30 (43%), Positives = 13/30 (43%)
 Frame = +2

Query: 5   PVTEQQSPHTAALPPRTTRIHNPPTTPIRP 94
           P      P T  LPP T R   PP  P RP
Sbjct: 822 PTRPPTKPPTTYLPPPTVRTTRPPPPPTRP 851



 Score = 29.5 bits (63), Expect = 6.5
 Identities = 13/30 (43%), Positives = 13/30 (43%)
 Frame = +2

Query: 5   PVTEQQSPHTAALPPRTTRIHNPPTTPIRP 94
           P      P T  LPP T R   PP  P RP
Sbjct: 405 PTKPPTRPPTTYLPPPTVRTTRPPPPPTRP 434



 Score = 29.5 bits (63), Expect = 6.5
 Identities = 13/30 (43%), Positives = 13/30 (43%)
 Frame = +2

Query: 5   PVTEQQSPHTAALPPRTTRIHNPPTTPIRP 94
           P      P T  LPP T R   PP  P RP
Sbjct: 508 PTKPPTRPPTTYLPPPTVRTTRPPPPPTRP 537



 Score = 29.5 bits (63), Expect = 6.5
 Identities = 13/30 (43%), Positives = 13/30 (43%)
 Frame = +2

Query: 5   PVTEQQSPHTAALPPRTTRIHNPPTTPIRP 94
           P      P T  LPP T R   PP  P RP
Sbjct: 719 PTKPPTRPPTTYLPPPTVRTTRPPPPPTRP 748


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 33,185,095
Number of Sequences: 53049
Number of extensions: 606318
Number of successful extensions: 1855
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1759
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1855
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4311772920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -