SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30135.Seq
         (856 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

K00670-1|AAA28314.1|  376|Drosophila melanogaster protein ( D.me...   185   6e-47
K00667-1|AAA28316.1|  376|Drosophila melanogaster protein ( D.me...   185   6e-47
AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p pro...   185   6e-47
AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p pro...   185   6e-47
AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,...   185   6e-47
AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,...   185   6e-47
AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,...   185   6e-47
AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,...   185   6e-47
AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA...   185   6e-47
M18830-1|AAA28321.1|  376|Drosophila melanogaster protein ( D.me...   183   2e-46
M18826-1|AAA28323.1|  376|Drosophila melanogaster protein ( D.me...   183   2e-46
K00673-1|AAA28319.1|  376|Drosophila melanogaster protein ( D.me...   183   2e-46
AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p pro...   183   2e-46
AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA...   183   2e-46
AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-P...   183   2e-46
AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.    183   2e-46
X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin prot...   183   3e-46
K00674-1|AAA28320.1|  376|Drosophila melanogaster protein ( D.me...   183   3e-46
BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p pro...   183   3e-46
AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p pro...   183   3e-46
AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-P...   183   3e-46
AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-P...   183   3e-46
M18829-1|AAA28318.1|  376|Drosophila melanogaster protein ( D.me...   181   1e-45
M18827-1|AAA28317.1|  376|Drosophila melanogaster protein ( D.me...   181   1e-45
AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p pro...   181   1e-45
AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA...   181   1e-45
AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p pro...   131   1e-30
BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p pro...   130   2e-30
AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA...   130   2e-30
X06383-1|CAA29681.1|   84|Drosophila melanogaster protein ( Dros...   130   3e-30
X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related ...   129   4e-30
X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related ...   113   3e-25
AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p pro...   113   3e-25
AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA...   113   3e-25
X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related ...    94   2e-19
AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p pro...    94   2e-19
AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA...    94   2e-19
AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p pro...    91   1e-18
AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA...    91   1e-18
X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related ...    88   2e-17
AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p pro...    73   7e-13
AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA...    73   7e-13
AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p pro...    57   4e-08
AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA...    57   4e-08
L25314-1|AAA17685.1|  398|Drosophila melanogaster actin-related ...    37   0.041
AY058726-1|AAL13955.1|  398|Drosophila melanogaster LD47054p pro...    37   0.041
AE014298-2201|AAF48499.1|  398|Drosophila melanogaster CG11678-P...    37   0.041
AF156227-1|AAD43809.1|  258|Drosophila melanogaster salivary gla...    35   0.16 
AE014298-1527|AAF47979.1|  592|Drosophila melanogaster CG2145-PA...    34   0.22 
AY075406-1|AAL68233.1|  388|Drosophila melanogaster LD32741p pro...    33   0.50 
AE014134-1061|AAF52351.2|  471|Drosophila melanogaster CG13990-P...    33   0.66 
AE014296-2272|AAN11836.1|  626|Drosophila melanogaster CG32121-P...    32   0.87 
AE013599-3087|AAM68186.2|   36|Drosophila melanogaster CG10067-P...    32   0.87 
AY075568-1|AAL68375.1|  806|Drosophila melanogaster SD01878p pro...    31   1.5  
AF434683-1|AAL30427.1|  806|Drosophila melanogaster DUNC-115l pr...    31   1.5  
AE014297-1009|AAF54427.4|  806|Drosophila melanogaster CG31352-P...    31   1.5  
AE014134-808|AAF50957.4| 1286|Drosophila melanogaster CG3047-PA ...    31   1.5  
DQ991915-1|ABJ09588.1| 2176|Drosophila melanogaster eyes shut pr...    31   2.0  
DQ780942-1|ABH07112.1| 2165|Drosophila melanogaster spacemaker p...    31   2.0  
AY051551-1|AAK92975.1|  634|Drosophila melanogaster GH20023p pro...    31   2.0  
AE014296-2474|AAF49664.3|  634|Drosophila melanogaster CG13458-P...    31   2.0  
AE014134-390|AAZ83988.1| 1984|Drosophila melanogaster CG33955-PB...    31   2.0  
EF108315-1|ABL09495.1|  528|Drosophila melanogaster serine-pepti...    31   2.7  
AY058771-1|AAL14000.1|  885|Drosophila melanogaster SD05329p pro...    31   2.7  
AE014296-3638|AAF51794.1|  885|Drosophila melanogaster CG7143-PA...    31   2.7  
AB049433-1|BAB15799.1|  885|Drosophila melanogaster dpol-eta pro...    31   2.7  
AB036766-1|BAB20905.1|  885|Drosophila melanogaster DNA polymera...    31   2.7  
AE014296-1913|AAN11902.1|  130|Drosophila melanogaster CG32077-P...    30   3.5  
L42514-1|AAA98918.1| 1039|Drosophila melanogaster male-specific ...    30   4.7  
BT023828-1|AAZ86749.1| 1039|Drosophila melanogaster RE18093p pro...    30   4.7  
AE014296-1693|AAF50239.2| 1937|Drosophila melanogaster CG3280-PA...    30   4.7  
AE014134-2958|AAF53689.1| 1039|Drosophila melanogaster CG10385-P...    30   4.7  
M96575-1|AAB59184.1| 1775|Drosophila melanogaster type IV collag...    29   6.2  
M28334-1|AAA28422.1|  421|Drosophila melanogaster type VI-relate...    29   6.2  
M23704-1|AAA28404.1| 1775|Drosophila melanogaster alpha-1 type I...    29   6.2  
L05080-1|AAA28420.1|  873|Drosophila melanogaster calphotin prot...    29   6.2  
L02111-1|AAA28405.1|  865|Drosophila melanogaster calcium-bindin...    29   6.2  
J02727-1|AAA28423.1| 1775|Drosophila melanogaster type IV pro-co...    29   6.2  
AY058315-1|AAL13544.1|  864|Drosophila melanogaster GH08002p pro...    29   6.2  
AE014298-2947|AAF49026.2| 2529|Drosophila melanogaster CG32529-P...    29   6.2  
AE014297-1457|AAF54754.1|  864|Drosophila melanogaster CG4795-PB...    29   6.2  
AE014297-1456|AAF54755.1|  842|Drosophila melanogaster CG4795-PA...    29   6.2  
AE014296-1901|AAF50098.3|  137|Drosophila melanogaster CG12522-P...    29   6.2  
AE014134-846|AAN10520.1| 1779|Drosophila melanogaster CG4145-PC,...    29   6.2  
AE014134-845|AAN10519.1| 1779|Drosophila melanogaster CG4145-PB,...    29   6.2  
AE014134-844|AAF52204.1| 1779|Drosophila melanogaster CG4145-PA,...    29   6.2  
AY071278-1|AAL48900.1|  347|Drosophila melanogaster RE30702p pro...    29   8.1  
AE014298-394|AAS65251.1| 1535|Drosophila melanogaster CG14047-PB...    29   8.1  
AE014298-393|AAF45777.2| 1395|Drosophila melanogaster CG14047-PA...    29   8.1  

>K00670-1|AAA28314.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 42A. ).
          Length = 376

 Score =  185 bits (451), Expect = 6e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  130 bits (313), Expect = 3e-30
 Identities = 59/62 (95%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>K00667-1|AAA28316.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 5C. ).
          Length = 376

 Score =  185 bits (451), Expect = 6e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  130 bits (313), Expect = 3e-30
 Identities = 59/62 (95%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>AY118907-1|AAM50767.1|  376|Drosophila melanogaster LD18090p
           protein.
          Length = 376

 Score =  185 bits (451), Expect = 6e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  130 bits (313), Expect = 3e-30
 Identities = 59/62 (95%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>AY089562-1|AAL90300.1|  376|Drosophila melanogaster RE02927p
           protein.
          Length = 376

 Score =  185 bits (451), Expect = 6e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  130 bits (313), Expect = 3e-30
 Identities = 59/62 (95%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>AE014298-815|AAX52480.1|  376|Drosophila melanogaster CG4027-PD,
           isoform D protein.
          Length = 376

 Score =  185 bits (451), Expect = 6e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  130 bits (313), Expect = 3e-30
 Identities = 59/62 (95%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>AE014298-814|AAX52479.1|  376|Drosophila melanogaster CG4027-PC,
           isoform C protein.
          Length = 376

 Score =  185 bits (451), Expect = 6e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  130 bits (313), Expect = 3e-30
 Identities = 59/62 (95%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>AE014298-813|AAN09154.1|  376|Drosophila melanogaster CG4027-PB,
           isoform B protein.
          Length = 376

 Score =  185 bits (451), Expect = 6e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  130 bits (313), Expect = 3e-30
 Identities = 59/62 (95%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>AE014298-812|AAF46098.1|  376|Drosophila melanogaster CG4027-PA,
           isoform A protein.
          Length = 376

 Score =  185 bits (451), Expect = 6e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  130 bits (313), Expect = 3e-30
 Identities = 59/62 (95%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>AE013599-130|AAF57294.1|  376|Drosophila melanogaster CG12051-PA
           protein.
          Length = 376

 Score =  185 bits (451), Expect = 6e-47
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  130 bits (313), Expect = 3e-30
 Identities = 59/62 (95%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>M18830-1|AAA28321.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  183 bits (446), Expect = 2e-46
 Identities = 83/85 (97%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNSPAMYVAIQAVLSL 143



 Score =  128 bits (310), Expect = 7e-30
 Identities = 64/78 (82%), Positives = 67/78 (85%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEG+ALPHAILRLD +   LTDYLMKILTERGY+F T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILTERGYTFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI   T KEKLCYV
Sbjct: 204 TAEREIVRDT-KEKLCYV 220



 Score =  124 bits (298), Expect = 2e-28
 Identities = 54/62 (87%), Positives = 59/62 (95%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>M18826-1|AAA28323.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 88F. ).
          Length = 376

 Score =  183 bits (446), Expect = 2e-46
 Identities = 83/85 (97%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNSPAMYVAIQAVLSL 143



 Score =  129 bits (311), Expect = 5e-30
 Identities = 64/78 (82%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEG+ALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  124 bits (298), Expect = 2e-28
 Identities = 54/62 (87%), Positives = 59/62 (95%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>K00673-1|AAA28319.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 57A. ).
          Length = 376

 Score =  183 bits (446), Expect = 2e-46
 Identities = 83/85 (97%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNSPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  128 bits (310), Expect = 7e-30
 Identities = 58/62 (93%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>AY089535-1|AAL90273.1|  360|Drosophila melanogaster LD04994p
           protein.
          Length = 360

 Score =  183 bits (446), Expect = 2e-46
 Identities = 83/85 (97%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 43  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 102

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 103 KMTQIMFETFNSPAMYVAIQAVLSL 127



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 128 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 187

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 188 TAEREIVR-DIKEKLCYV 204



 Score = 97.1 bits (231), Expect = 3e-20
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +1

Query: 130 MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 46


>AE014297-2046|AAF55198.1|  376|Drosophila melanogaster CG5178-PA
           protein.
          Length = 376

 Score =  183 bits (446), Expect = 2e-46
 Identities = 83/85 (97%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNSPAMYVAIQAVLSL 143



 Score =  129 bits (311), Expect = 5e-30
 Identities = 64/78 (82%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEG+ALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  124 bits (298), Expect = 2e-28
 Identities = 54/62 (87%), Positives = 59/62 (95%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>AE013599-3086|AAF46640.1|  376|Drosophila melanogaster CG10067-PA,
           isoform A protein.
          Length = 376

 Score =  183 bits (446), Expect = 2e-46
 Identities = 83/85 (97%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNSPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  128 bits (310), Expect = 7e-30
 Identities = 58/62 (93%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>AB003910-1|BAA20058.1|  376|Drosophila melanogaster actin protein.
          Length = 376

 Score =  183 bits (446), Expect = 2e-46
 Identities = 83/85 (97%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNSPAMYVAIQAVLSL 143



 Score =  129 bits (311), Expect = 5e-30
 Identities = 64/78 (82%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEG+ALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  124 bits (298), Expect = 2e-28
 Identities = 54/62 (87%), Positives = 59/62 (95%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD++  ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>X12452-1|CAA30982.1|  376|Drosophila melanogaster 87E actin
           protein.
          Length = 376

 Score =  183 bits (445), Expect = 3e-46
 Identities = 83/85 (97%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNAPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  128 bits (310), Expect = 7e-30
 Identities = 58/62 (93%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>K00674-1|AAA28320.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 87E. ).
          Length = 376

 Score =  183 bits (445), Expect = 3e-46
 Identities = 83/85 (97%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNAPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  128 bits (310), Expect = 7e-30
 Identities = 58/62 (93%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>BT016152-1|AAV37037.1|  376|Drosophila melanogaster AT14584p
           protein.
          Length = 376

 Score =  183 bits (445), Expect = 3e-46
 Identities = 83/85 (97%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNAPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  128 bits (310), Expect = 7e-30
 Identities = 58/62 (93%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>AY089587-1|AAL90325.1|  376|Drosophila melanogaster RE14441p
           protein.
          Length = 376

 Score =  183 bits (445), Expect = 3e-46
 Identities = 83/85 (97%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNAPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  128 bits (310), Expect = 7e-30
 Identities = 58/62 (93%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>AE014297-1691|AAN13567.1|  376|Drosophila melanogaster CG18290-PB,
           isoform B protein.
          Length = 376

 Score =  183 bits (445), Expect = 3e-46
 Identities = 83/85 (97%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNAPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  128 bits (310), Expect = 7e-30
 Identities = 58/62 (93%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>AE014297-1690|AAF54950.2|  376|Drosophila melanogaster CG18290-PA,
           isoform A protein.
          Length = 376

 Score =  183 bits (445), Expect = 3e-46
 Identities = 83/85 (97%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNAPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  128 bits (310), Expect = 7e-30
 Identities = 58/62 (93%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>M18829-1|AAA28318.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, complete cds, locus 79B. ).
          Length = 376

 Score =  181 bits (441), Expect = 1e-45
 Identities = 81/85 (95%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNSPAMYVAIQAVLSL 143



 Score =  131 bits (317), Expect = 1e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRHLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  125 bits (301), Expect = 9e-29
 Identities = 56/62 (90%), Positives = 59/62 (95%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDE +
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>M18827-1|AAA28317.1|  376|Drosophila melanogaster protein (
           D.melanogaster actingene, exon 2, locus 79B. ).
          Length = 376

 Score =  181 bits (441), Expect = 1e-45
 Identities = 81/85 (95%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNSPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  125 bits (301), Expect = 9e-29
 Identities = 56/62 (90%), Positives = 59/62 (95%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDE +
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>AY118735-1|AAM50595.1|  376|Drosophila melanogaster GH04529p
           protein.
          Length = 376

 Score =  181 bits (441), Expect = 1e-45
 Identities = 81/85 (95%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNSPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  125 bits (301), Expect = 9e-29
 Identities = 56/62 (90%), Positives = 59/62 (95%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDE +
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>AE014296-3645|AAF51800.1|  376|Drosophila melanogaster CG7478-PA
           protein.
          Length = 376

 Score =  181 bits (441), Expect = 1e-45
 Identities = 81/85 (95%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGIL+LKYPIEHGI+TNWDDMEK+WHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILSLKYPIEHGIITNWDDMEKVWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNSPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  125 bits (301), Expect = 9e-29
 Identities = 56/62 (90%), Positives = 59/62 (95%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCDEE +ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD YVGDE +
Sbjct: 1   MCDEEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>AY113405-1|AAM29410.1|  341|Drosophila melanogaster RE12057p
           protein.
          Length = 341

 Score =  131 bits (316), Expect = 1e-30
 Identities = 60/61 (98%), Positives = 60/61 (98%)
 Frame = +3

Query: 327 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS 506
           MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLS
Sbjct: 48  MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLS 107

Query: 507 L 509
           L
Sbjct: 108 L 108



 Score =  130 bits (315), Expect = 2e-30
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 109 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 168

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 169 TAEREIVR-DIKEKLCYV 185



 Score =  105 bits (251), Expect = 1e-22
 Identities = 47/48 (97%), Positives = 48/48 (100%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM 225
           MCD+EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM
Sbjct: 1   MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM 48


>BT023874-1|AAZ86795.1|  368|Drosophila melanogaster AT26678p
           protein.
          Length = 368

 Score =  130 bits (314), Expect = 2e-30
 Identities = 61/85 (71%), Positives = 67/85 (78%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           A  KRGILTLKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEAPLNPK NRE
Sbjct: 56  AARKRGILTLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNRE 114

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMT+IMFE F  PA YVA+QAVLSL
Sbjct: 115 KMTEIMFEHFQVPAFYVAVQAVLSL 139



 Score =  107 bits (257), Expect = 2e-23
 Identities = 56/99 (56%), Positives = 69/99 (69%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GRT GIV+DSGDGV+HTVPIYEG+ALPHA +R+D +   LTDYL K+L ERG +  T
Sbjct: 140 YATGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKLLLERGVTMGT 199

Query: 689 NAXREIRS*TFKEKLCYVGS*LSKQXIGXRLHSKXFPFE 805
           +A REI     KEKLCYV    +K+     LH K   +E
Sbjct: 200 SAEREIVR-EIKEKLCYVSMNYAKE---MDLHGKVETYE 234



 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 32/51 (62%), Positives = 41/51 (80%)
 Frame = +1

Query: 100 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 252
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G+
Sbjct: 4   AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGE 54


>AE013599-2340|AAF57954.1|  376|Drosophila melanogaster CG5409-PA
           protein.
          Length = 376

 Score =  130 bits (314), Expect = 2e-30
 Identities = 61/85 (71%), Positives = 67/85 (78%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           A  KRGILTLKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEAPLNPK NRE
Sbjct: 64  AARKRGILTLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNRE 122

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMT+IMFE F  PA YVA+QAVLSL
Sbjct: 123 KMTEIMFEHFQVPAFYVAVQAVLSL 147



 Score =  107 bits (257), Expect = 2e-23
 Identities = 56/99 (56%), Positives = 69/99 (69%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GRT GIV+DSGDGV+HTVPIYEG+ALPHA +R+D +   LTDYL K+L ERG +  T
Sbjct: 148 YATGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKLLLERGVTMGT 207

Query: 689 NAXREIRS*TFKEKLCYVGS*LSKQXIGXRLHSKXFPFE 805
           +A REI     KEKLCYV    +K+     LH K   +E
Sbjct: 208 SAEREIVR-EIKEKLCYVSMNYAKE---MDLHGKVETYE 242



 Score = 73.7 bits (173), Expect = 3e-13
 Identities = 32/51 (62%), Positives = 41/51 (80%)
 Frame = +1

Query: 100 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 252
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G+
Sbjct: 12  AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGE 62


>X06383-1|CAA29681.1|   84|Drosophila melanogaster protein (
           Drosophila 5C actingene exon 2 and exon 3 (part.). ).
          Length = 84

 Score =  130 bits (313), Expect = 3e-30
 Identities = 59/62 (95%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62



 Score = 60.5 bits (140), Expect = 3e-09
 Identities = 26/26 (100%), Positives = 26/26 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDME 332
           AQSKRGILTLKYPIEHGIVTNWDDME
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDME 84


>X78487-1|CAA55239.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score =  129 bits (312), Expect = 4e-30
 Identities = 60/82 (73%), Positives = 66/82 (80%)
 Frame = +3

Query: 264 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 443
           KRGILTLKYPIEHG+V NWD+ME +W HT Y  LR  P + P LLTEAPLNPK NREKMT
Sbjct: 67  KRGILTLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNREKMT 125

Query: 444 QIMFETFNTPAMYVAIQAVLSL 509
           +IMFE F  PA YVA+QAVLSL
Sbjct: 126 EIMFEHFQVPAFYVAVQAVLSL 147



 Score =  103 bits (246), Expect = 4e-22
 Identities = 54/97 (55%), Positives = 67/97 (69%)
 Frame = +2

Query: 515 SGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNA 694
           +GRT GIV+DSGDGV+HTVPIYEG+ALPHA +R+D +   LTDYL K+L ERG +  T+A
Sbjct: 150 TGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKLLLERGVTMGTSA 209

Query: 695 XREIRS*TFKEKLCYVGS*LSKQXIGXRLHSKXFPFE 805
            REI     KEKLCYV    +K+     LH K   +E
Sbjct: 210 EREIVR-EIKEKLCYVSMNYAKE---MDLHGKVETYE 242



 Score = 74.5 bits (175), Expect = 2e-13
 Identities = 33/56 (58%), Positives = 42/56 (75%)
 Frame = +1

Query: 100 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           AA+V+DNGSG+CKAGF+ +D PRAVFPSIVGRPRH  V++     DS +G+    K
Sbjct: 12  AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGERQPEK 67


>X78488-1|CAA55240.1|  376|Drosophila melanogaster actin related
           protein protein.
          Length = 376

 Score =  113 bits (272), Expect = 3e-25
 Identities = 49/86 (56%), Positives = 67/86 (77%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANR 431
           A+  RG+L+++YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEAPLNP+ NR
Sbjct: 62  AEEHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNR 121

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EK  +  FE  N PA++V++QAVLSL
Sbjct: 122 EKAAEFFFEGINAPALFVSMQAVLSL 147



 Score = 91.5 bits (217), Expect = 1e-18
 Identities = 40/80 (50%), Positives = 59/80 (73%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GR TG+VLDSGDGV+H VPIYEG+A+PH+I+R+D +   +T YL  ++   G++F +
Sbjct: 148 YATGRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRREGFNFRS 207

Query: 689 NAXREIRS*TFKEKLCYVGS 748
            A  EI   + KEK+CY+ +
Sbjct: 208 TAEFEIVR-SIKEKVCYLAT 226



 Score = 62.5 bits (145), Expect = 7e-10
 Identities = 28/55 (50%), Positives = 39/55 (70%), Gaps = 3/55 (5%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG---DEHR 261
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG   +EHR
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHR 66


>AY070666-1|AAL48137.1|  376|Drosophila melanogaster RH04757p
           protein.
          Length = 376

 Score =  113 bits (272), Expect = 3e-25
 Identities = 49/86 (56%), Positives = 67/86 (77%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANR 431
           A+  RG+L+++YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEAPLNP+ NR
Sbjct: 62  AEEHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNR 121

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EK  +  FE  N PA++V++QAVLSL
Sbjct: 122 EKAAEFFFEGINAPALFVSMQAVLSL 147



 Score = 91.5 bits (217), Expect = 1e-18
 Identities = 40/80 (50%), Positives = 59/80 (73%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GR TG+VLDSGDGV+H VPIYEG+A+PH+I+R+D +   +T YL  ++   G++F +
Sbjct: 148 YATGRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRREGFNFRS 207

Query: 689 NAXREIRS*TFKEKLCYVGS 748
            A  EI   + KEK+CY+ +
Sbjct: 208 TAEFEIVR-SIKEKVCYLAT 226



 Score = 62.5 bits (145), Expect = 7e-10
 Identities = 28/55 (50%), Positives = 39/55 (70%), Gaps = 3/55 (5%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG---DEHR 261
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG   +EHR
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHR 66


>AE014297-1571|AAF54853.1|  376|Drosophila melanogaster CG6174-PA
           protein.
          Length = 376

 Score =  113 bits (272), Expect = 3e-25
 Identities = 49/86 (56%), Positives = 67/86 (77%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANR 431
           A+  RG+L+++YP+EHGIVT+W+DME+IW + +  E L    E+HPVLLTEAPLNP+ NR
Sbjct: 62  AEEHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNR 121

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EK  +  FE  N PA++V++QAVLSL
Sbjct: 122 EKAAEFFFEGINAPALFVSMQAVLSL 147



 Score = 91.5 bits (217), Expect = 1e-18
 Identities = 40/80 (50%), Positives = 59/80 (73%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GR TG+VLDSGDGV+H VPIYEG+A+PH+I+R+D +   +T YL  ++   G++F +
Sbjct: 148 YATGRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRREGFNFRS 207

Query: 689 NAXREIRS*TFKEKLCYVGS 748
            A  EI   + KEK+CY+ +
Sbjct: 208 TAEFEIVR-SIKEKVCYLAT 226



 Score = 62.5 bits (145), Expect = 7e-10
 Identities = 28/55 (50%), Positives = 39/55 (70%), Gaps = 3/55 (5%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG---DEHR 261
           +V+DNGSG+ KAGFAG+  P+  FP+ +GRP+H  VM G  + D +VG   +EHR
Sbjct: 12  VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHR 66


>X71789-1|CAA50674.1|  418|Drosophila melanogaster actin related
           protein protein.
          Length = 418

 Score = 94.3 bits (224), Expect = 2e-19
 Identities = 40/77 (51%), Positives = 53/77 (68%)
 Frame = +3

Query: 279 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 458
           ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE
Sbjct: 73  SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFE 132

Query: 459 TFNTPAMYVAIQAVLSL 509
           TFN P +Y+A+QAVL+L
Sbjct: 133 TFNVPGLYIAVQAVLAL 149



 Score = 52.0 bits (119), Expect = 1e-06
 Identities = 29/85 (34%), Positives = 43/85 (50%), Gaps = 1/85 (1%)
 Frame = +2

Query: 512 ASGRT-TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           A  RT TGIV+DSGDGV+  +P+ EGY +   I  +  +   +T  +  +L ER      
Sbjct: 158 AEERTLTGIVVDSGDGVTDVIPVAEGYVIGSCIKHIPIAGRNITSLIQSLLREREVGIPP 217

Query: 689 NAXREIRS*TFKEKLCYVGS*LSKQ 763
               E      KEK CY+   ++K+
Sbjct: 218 EQSLETAK-AIKEKHCYICPDIAKE 241



 Score = 35.1 bits (77), Expect = 0.12
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 8/59 (13%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDE 255
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDE
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDE 65


>AY051859-1|AAK93283.1|  418|Drosophila melanogaster LD35711p
           protein.
          Length = 418

 Score = 94.3 bits (224), Expect = 2e-19
 Identities = 40/77 (51%), Positives = 53/77 (68%)
 Frame = +3

Query: 279 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 458
           ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE
Sbjct: 73  SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFE 132

Query: 459 TFNTPAMYVAIQAVLSL 509
           TFN P +Y+A+QAVL+L
Sbjct: 133 TFNVPGLYIAVQAVLAL 149



 Score = 57.2 bits (132), Expect = 3e-08
 Identities = 30/85 (35%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +2

Query: 512 ASGRT-TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           A  RT TGIV+DSGDGV+H +P+ EGY +   I  +  +   +T ++  +L ER      
Sbjct: 158 AEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNITSFIQSLLREREVGIPP 217

Query: 689 NAXREIRS*TFKEKLCYVGS*LSKQ 763
               E      KEK CY+   ++K+
Sbjct: 218 EQSLETAK-AIKEKHCYICPDIAKE 241



 Score = 35.1 bits (77), Expect = 0.12
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 8/59 (13%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDE 255
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDE
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDE 65


>AE014296-1370|AAF50488.1|  418|Drosophila melanogaster CG7558-PA
           protein.
          Length = 418

 Score = 94.3 bits (224), Expect = 2e-19
 Identities = 40/77 (51%), Positives = 53/77 (68%)
 Frame = +3

Query: 279 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 458
           ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE
Sbjct: 73  SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFE 132

Query: 459 TFNTPAMYVAIQAVLSL 509
           TFN P +Y+A+QAVL+L
Sbjct: 133 TFNVPGLYIAVQAVLAL 149



 Score = 57.2 bits (132), Expect = 3e-08
 Identities = 30/85 (35%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +2

Query: 512 ASGRT-TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           A  RT TGIV+DSGDGV+H +P+ EGY +   I  +  +   +T ++  +L ER      
Sbjct: 158 AEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNITSFIQSLLREREVGIPP 217

Query: 689 NAXREIRS*TFKEKLCYVGS*LSKQ 763
               E      KEK CY+   ++K+
Sbjct: 218 EQSLETAK-AIKEKHCYICPDIAKE 241



 Score = 35.1 bits (77), Expect = 0.12
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 8/59 (13%)
 Frame = +1

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDE 255
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDE
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDE 65


>AY061256-1|AAL28804.1|  394|Drosophila melanogaster LD18955p
           protein.
          Length = 394

 Score = 91.5 bits (217), Expect = 1e-18
 Identities = 40/86 (46%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANR 431
           A   R +L + YP+E+G+V NWDDM  +W +TF   ++ + P    +LLTE P+NP  NR
Sbjct: 61  ASQLRSLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNR 120

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EKM ++MFE +   + Y+AIQAVL+L
Sbjct: 121 EKMIEVMFEKYGFDSAYIAIQAVLTL 146



 Score = 84.2 bits (199), Expect = 2e-16
 Identities = 41/80 (51%), Positives = 55/80 (68%), Gaps = 1/80 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA G  +G+V+DSGDGV+H  P+YE +ALPH   RLD +   +T YL+K+L  RGY+F  
Sbjct: 147 YAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGRDITRYLIKLLLLRGYAFNH 206

Query: 689 NAXRE-IRS*TFKEKLCYVG 745
           +A  E +R    KEKLCY+G
Sbjct: 207 SADFETVR--IMKEKLCYIG 224



 Score = 49.2 bits (112), Expect = 7e-06
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 2/52 (3%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVGDE 255
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VGDE
Sbjct: 9   IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDE 60


>AE014298-2420|AAF48621.1|  394|Drosophila melanogaster CG9901-PA
           protein.
          Length = 394

 Score = 91.5 bits (217), Expect = 1e-18
 Identities = 40/86 (46%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANR 431
           A   R +L + YP+E+G+V NWDDM  +W +TF   ++ + P    +LLTE P+NP  NR
Sbjct: 61  ASQLRSLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNR 120

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EKM ++MFE +   + Y+AIQAVL+L
Sbjct: 121 EKMIEVMFEKYGFDSAYIAIQAVLTL 146



 Score = 84.2 bits (199), Expect = 2e-16
 Identities = 41/80 (51%), Positives = 55/80 (68%), Gaps = 1/80 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA G  +G+V+DSGDGV+H  P+YE +ALPH   RLD +   +T YL+K+L  RGY+F  
Sbjct: 147 YAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGRDITRYLIKLLLLRGYAFNH 206

Query: 689 NAXRE-IRS*TFKEKLCYVG 745
           +A  E +R    KEKLCY+G
Sbjct: 207 SADFETVR--IMKEKLCYIG 224



 Score = 49.2 bits (112), Expect = 7e-06
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 2/52 (3%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVGDE 255
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VGDE
Sbjct: 9   IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDE 60


>X78486-1|CAA55238.1|  395|Drosophila melanogaster actin related
           protein protein.
          Length = 395

 Score = 87.8 bits (208), Expect = 2e-17
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANR 431
           A   R +L + YP+E+G+V NWDDM  +W +TF   ++ + P    +LLTE P+NP  NR
Sbjct: 62  ASQLRSLLEVSYPMENGVVRNWDDMCHVWEYTFGPKKMDIDPTNTKILLTEPPMNPTKNR 121

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EKM ++MFE +   + Y+AIQA  +L
Sbjct: 122 EKMIEVMFEKYGFDSAYIAIQAAWTL 147



 Score = 84.2 bits (199), Expect = 2e-16
 Identities = 41/80 (51%), Positives = 55/80 (68%), Gaps = 1/80 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA G  +G+V+DSGDGV+H  P+YE +ALPH   RLD +   +T YL+K+L  RGY+F  
Sbjct: 148 YAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGRDITRYLIKLLLLRGYAFNH 207

Query: 689 NAXRE-IRS*TFKEKLCYVG 745
           +A  E +R    KEKLCY+G
Sbjct: 208 SADFETVR--IMKEKLCYIG 225



 Score = 49.2 bits (112), Expect = 7e-06
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 2/52 (3%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-MGQKDSYVGDE 255
           +V DNG+G  K G+AG + P  +FPS+VGRP  + V  +G +  KD  VGDE
Sbjct: 10  IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDE 61


>AY070886-1|AAL48508.1|  425|Drosophila melanogaster LD29458p
           protein.
          Length = 425

 Score = 72.5 bits (170), Expect = 7e-13
 Identities = 30/71 (42%), Positives = 48/71 (67%)
 Frame = +3

Query: 294 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 473
           ++ G++ NWD  EK+  + + N ++  PE HPVL +EA  N + NREK+T++MFE +N P
Sbjct: 93  MKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREKLTELMFEKYNVP 152

Query: 474 AMYVAIQAVLS 506
           A ++   AVL+
Sbjct: 153 AFFLVKNAVLA 163



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 16/36 (44%), Positives = 26/36 (72%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR 613
           A++SGR T +V+DSG   +  VP++EGY L  A+++
Sbjct: 164 AFSSGRATALVVDSGATHTSAVPVHEGYVLSQAVVK 199



 Score = 37.5 bits (83), Expect = 0.023
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           +E+ ALV D G    + G+A +D+P+A  PS+VG
Sbjct: 11  DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVG 44


>AE013599-2461|AAF57868.1|  425|Drosophila melanogaster CG6546-PA
           protein.
          Length = 425

 Score = 72.5 bits (170), Expect = 7e-13
 Identities = 30/71 (42%), Positives = 48/71 (67%)
 Frame = +3

Query: 294 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 473
           ++ G++ NWD  EK+  + + N ++  PE HPVL +EA  N + NREK+T++MFE +N P
Sbjct: 93  MKDGMIDNWDLFEKVIDYAYANVIQSEPEYHPVLFSEASWNVRNNREKLTELMFEKYNVP 152

Query: 474 AMYVAIQAVLS 506
           A ++   AVL+
Sbjct: 153 AFFLVKNAVLA 163



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 16/36 (44%), Positives = 26/36 (72%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR 613
           A++SGR T +V+DSG   +  VP++EGY L  A+++
Sbjct: 164 AFSSGRATALVVDSGATHTSAVPVHEGYVLSQAVVK 199



 Score = 37.5 bits (83), Expect = 0.023
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +1

Query: 91  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 192
           +E+ ALV D G    + G+A +D+P+A  PS+VG
Sbjct: 11  DEIGALVFDPGHHSLRVGYAQEDSPKAEIPSVVG 44


>AY069531-1|AAL39676.1|  648|Drosophila melanogaster LD24983p
           protein.
          Length = 648

 Score = 56.8 bits (131), Expect = 4e-08
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 2/77 (2%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIMF 455
           LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP   R++M +++F
Sbjct: 79  LKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANPNFCRQQMNELLF 138

Query: 456 ETFNTPAMYVAIQAVLS 506
           E +  P++   I A+ S
Sbjct: 139 ECYGIPSVSYGIDALYS 155



 Score = 30.7 bits (66), Expect = 2.7
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 201
           LV+DNGS  C+ G++    P   F +++ +PR
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPR 38


>AE014297-2454|AAF55504.1|  648|Drosophila melanogaster CG7940-PA
           protein.
          Length = 648

 Score = 56.8 bits (131), Expect = 4e-08
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 2/77 (2%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIMF 455
           LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP   R++M +++F
Sbjct: 79  LKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANPNFCRQQMNELLF 138

Query: 456 ETFNTPAMYVAIQAVLS 506
           E +  P++   I A+ S
Sbjct: 139 ECYGIPSVSYGIDALYS 155



 Score = 30.7 bits (66), Expect = 2.7
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +1

Query: 106 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 201
           LV+DNGS  C+ G++    P   F +++ +PR
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPR 38


>L25314-1|AAA17685.1|  398|Drosophila melanogaster actin-related
           protein protein.
          Length = 398

 Score = 36.7 bits (81), Expect = 0.041
 Identities = 16/71 (22%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = +3

Query: 297 EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 473
           + G + NW   + +W + F  + +  + E   +++TE  +N ++ +E   +I+FE +   
Sbjct: 64  QRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVD 123

Query: 474 AMYVAIQAVLS 506
            +Y    A L+
Sbjct: 124 GVYKTTAADLA 134



 Score = 31.1 bits (67), Expect = 2.0
 Identities = 18/70 (25%), Positives = 34/70 (48%)
 Frame = +2

Query: 533 IVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREIRS 712
           I++D G   +H VP   G  +   I R+D     LT+ L ++++ R  + + +    +  
Sbjct: 154 IIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTNQLKELISYRHLN-VMDESHVVNQ 212

Query: 713 *TFKEKLCYV 742
              KE +C+V
Sbjct: 213 --IKEDVCFV 220


>AY058726-1|AAL13955.1|  398|Drosophila melanogaster LD47054p
           protein.
          Length = 398

 Score = 36.7 bits (81), Expect = 0.041
 Identities = 16/71 (22%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = +3

Query: 297 EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 473
           + G + NW   + +W + F  + +  + E   +++TE  +N ++ +E   +I+FE +   
Sbjct: 64  QRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVD 123

Query: 474 AMYVAIQAVLS 506
            +Y    A L+
Sbjct: 124 GVYKTTAADLA 134



 Score = 31.1 bits (67), Expect = 2.0
 Identities = 18/70 (25%), Positives = 34/70 (48%)
 Frame = +2

Query: 533 IVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREIRS 712
           I++D G   +H VP   G  +   I R+D     LT+ L ++++ R  + + +    +  
Sbjct: 154 IIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTNQLKELISYRHLN-VMDESHVVNQ 212

Query: 713 *TFKEKLCYV 742
              KE +C+V
Sbjct: 213 --IKEDVCFV 220


>AE014298-2201|AAF48499.1|  398|Drosophila melanogaster CG11678-PA
           protein.
          Length = 398

 Score = 36.7 bits (81), Expect = 0.041
 Identities = 16/71 (22%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = +3

Query: 297 EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 473
           + G + NW   + +W + F  + +  + E   +++TE  +N ++ +E   +I+FE +   
Sbjct: 64  QRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVD 123

Query: 474 AMYVAIQAVLS 506
            +Y    A L+
Sbjct: 124 GVYKTTAADLA 134



 Score = 31.1 bits (67), Expect = 2.0
 Identities = 18/70 (25%), Positives = 34/70 (48%)
 Frame = +2

Query: 533 IVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREIRS 712
           I++D G   +H VP   G  +   I R+D     LT+ L ++++ R  + + +    +  
Sbjct: 154 IIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTNQLKELISYRHLN-VMDESHVVNQ 212

Query: 713 *TFKEKLCYV 742
              KE +C+V
Sbjct: 213 --IKEDVCFV 220


>AF156227-1|AAD43809.1|  258|Drosophila melanogaster salivary gland
           secretion protein protein.
          Length = 258

 Score = 34.7 bits (76), Expect = 0.16
 Identities = 21/56 (37%), Positives = 26/56 (46%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAAT 677
           T  V+P   C T  T +PTP  ST+ T +   +C  T       TTS   SPS  T
Sbjct: 185 TSTVIPTSPC-TQETTTPTPTCSTQGTPTTPCTCALTTTTTKCTTTSSTCSPSTTT 239


>AE014298-1527|AAF47979.1|  592|Drosophila melanogaster CG2145-PA
           protein.
          Length = 592

 Score = 34.3 bits (75), Expect = 0.22
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +3

Query: 468 TPAMYVAIQAVLSLTR-PVVPPVSCWTPATVSPTPCPSTRDTHSPTPS 608
           TP    A Q+ L   + PV PP    + AT +PTP PS   + +PTP+
Sbjct: 247 TPGSPSAWQSPLPTPQHPVHPPTKATSAATPTPTPTPSFSSSVTPTPA 294


>AY075406-1|AAL68233.1|  388|Drosophila melanogaster LD32741p
           protein.
          Length = 388

 Score = 33.1 bits (72), Expect = 0.50
 Identities = 20/57 (35%), Positives = 26/57 (45%)
 Frame = +3

Query: 513 RPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRS 683
           RP+ PP+S W    V   PC +      P P  + T   R +  T+ R   SAAT S
Sbjct: 266 RPLCPPISAWE--WVWDCPCRANSCAELPIPVTIITTTTRCTSVTTARPKRSAATAS 320


>AE014134-1061|AAF52351.2|  471|Drosophila melanogaster CG13990-PA
           protein.
          Length = 471

 Score = 32.7 bits (71), Expect = 0.66
 Identities = 25/86 (29%), Positives = 35/86 (40%), Gaps = 3/86 (3%)
 Frame = +3

Query: 444 QIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPC-PSTRDTHSP--TPSCV 614
           QI+  T  TPA           T     P +  T A  + T C P+T  T +P  T +C 
Sbjct: 123 QIITTTTCTPASVTTTTTCAPTTTTTCAPTTTTTCAPTTTTTCAPTTTTTCAPTTTTTCA 182

Query: 615 WTLAGRDSQTTS*RFSPSAATRSLPT 692
            T     + TT+   +P+  T   PT
Sbjct: 183 PTTTTTCAPTTTTTCAPTTTTTCAPT 208


>AE014296-2272|AAN11836.1|  626|Drosophila melanogaster CG32121-PA
           protein.
          Length = 626

 Score = 32.3 bits (70), Expect = 0.87
 Identities = 12/21 (57%), Positives = 15/21 (71%)
 Frame = +3

Query: 546 PATVSPTPCPSTRDTHSPTPS 608
           P T SPTP P+   +H+PTPS
Sbjct: 150 PTTPSPTPTPTLTPSHTPTPS 170


>AE013599-3087|AAM68186.2|   36|Drosophila melanogaster CG10067-PB,
           isoform B protein.
          Length = 36

 Score = 32.3 bits (70), Expect = 0.87
 Identities = 13/15 (86%), Positives = 15/15 (100%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGS 126
           MCD+EVAALVVDNG+
Sbjct: 1   MCDDEVAALVVDNGA 15


>AY075568-1|AAL68375.1|  806|Drosophila melanogaster SD01878p
           protein.
          Length = 806

 Score = 31.5 bits (68), Expect = 1.5
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +1

Query: 520 SYHRYRAGLRRRCLPHRAHLRGIRTPPRHPASGL*PVATHRLPHEDSHRARLLVH 684
           SYH  +AGL RR LP+ +H   +  P +     L  +  +RLP  D  R  L  H
Sbjct: 718 SYHYPQAGLIRRSLPNMSHSMLVHEPAKIYPYHLLLITNYRLP-SDVDRCNLERH 771


>AF434683-1|AAL30427.1|  806|Drosophila melanogaster DUNC-115l
           protein.
          Length = 806

 Score = 31.5 bits (68), Expect = 1.5
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +1

Query: 520 SYHRYRAGLRRRCLPHRAHLRGIRTPPRHPASGL*PVATHRLPHEDSHRARLLVH 684
           SYH  +AGL RR LP+ +H   +  P +     L  +  +RLP  D  R  L  H
Sbjct: 718 SYHYPQAGLIRRSLPNMSHSMLVHEPAKIYPYHLLLITNYRLP-SDVDRCNLERH 771


>AE014297-1009|AAF54427.4|  806|Drosophila melanogaster CG31352-PA
           protein.
          Length = 806

 Score = 31.5 bits (68), Expect = 1.5
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +1

Query: 520 SYHRYRAGLRRRCLPHRAHLRGIRTPPRHPASGL*PVATHRLPHEDSHRARLLVH 684
           SYH  +AGL RR LP+ +H   +  P +     L  +  +RLP  D  R  L  H
Sbjct: 718 SYHYPQAGLIRRSLPNMSHSMLVHEPAKIYPYHLLLITNYRLP-SDVDRCNLERH 771


>AE014134-808|AAF50957.4| 1286|Drosophila melanogaster CG3047-PA
           protein.
          Length = 1286

 Score = 31.5 bits (68), Expect = 1.5
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 4/61 (6%)
 Frame = +3

Query: 522 VPPVSCWTPATVSPTPCPSTRDTHSPTPSC----VWTLAGRDSQTTS*RFSPSAATRSLP 689
           +P   C   +TV PT  P T++T +PTP+C      T     +QTT+   S +  + S P
Sbjct: 177 IPSSPCIDTSTVIPTS-PCTQETTTPTPTCSTQGTQTTPCTCAQTTTTPRSTTTTSTSRP 235

Query: 690 T 692
           T
Sbjct: 236 T 236


>DQ991915-1|ABJ09588.1| 2176|Drosophila melanogaster eyes shut
            protein.
          Length = 2176

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 28/101 (27%), Positives = 37/101 (36%)
 Frame = +3

Query: 300  HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 479
            H   T    +E    H    E  +  +E  V+ TE+P  P            ET   P +
Sbjct: 842  HDEFTTPQPVEITTGHPLQTEDLIGVQEPAVVTTESPFAPA-----------ETTVVPVV 890

Query: 480  YVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPT 602
              A  A L    P   P     PAT +P P P +  T +PT
Sbjct: 891  VPATIAPLGTAAPPATPAPV-PPATTTPPPSPPSLATETPT 930


>DQ780942-1|ABH07112.1| 2165|Drosophila melanogaster spacemaker
            protein.
          Length = 2165

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 28/101 (27%), Positives = 37/101 (36%)
 Frame = +3

Query: 300  HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 479
            H   T    +E    H    E  +  +E  V+ TE+P  P            ET   P +
Sbjct: 831  HDEFTTPQPVEITTGHPLQTEDLIGVQEPAVVTTESPFAPA-----------ETTVVPVV 879

Query: 480  YVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPT 602
              A  A L    P   P     PAT +P P P +  T +PT
Sbjct: 880  VPATIAPLGTAAPPATPAPV-PPATTTPPPSPPSLATETPT 919


>AY051551-1|AAK92975.1|  634|Drosophila melanogaster GH20023p
           protein.
          Length = 634

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 14/41 (34%), Positives = 23/41 (56%)
 Frame = -1

Query: 727 LLECSRTNFPXGVGNERVAALGENLHEVVCESRPAKVQTQD 605
           LL+C  +  P G G    AAL  NL ++  ++ P+ V++ D
Sbjct: 161 LLKCLGSKLPKGSGESPAAALFSNLGKLFSQAPPSDVESSD 201


>AE014296-2474|AAF49664.3|  634|Drosophila melanogaster CG13458-PA
           protein.
          Length = 634

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 14/41 (34%), Positives = 23/41 (56%)
 Frame = -1

Query: 727 LLECSRTNFPXGVGNERVAALGENLHEVVCESRPAKVQTQD 605
           LL+C  +  P G G    AAL  NL ++  ++ P+ V++ D
Sbjct: 161 LLKCLGSKLPKGSGESPAAALFSNLGKLFSQAPPSDVESSD 201


>AE014134-390|AAZ83988.1| 1984|Drosophila melanogaster CG33955-PB
           protein.
          Length = 1984

 Score = 31.1 bits (67), Expect = 2.0
 Identities = 28/101 (27%), Positives = 37/101 (36%)
 Frame = +3

Query: 300 HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 479
           H   T    +E    H    E  +  +E  V+ TE+P  P            ET   P +
Sbjct: 635 HDEFTTPQPVEITTGHPLQTEDLIGVQEPAVVTTESPFAPA-----------ETTVVPVV 683

Query: 480 YVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPT 602
             A  A L    P   P     PAT +P P P +  T +PT
Sbjct: 684 VPATIAPLGTAAPPATPAPV-PPATTTPPPSPPSLATETPT 723


>EF108315-1|ABL09495.1|  528|Drosophila melanogaster
           serine-peptidase protein.
          Length = 528

 Score = 30.7 bits (66), Expect = 2.7
 Identities = 20/55 (36%), Positives = 24/55 (43%)
 Frame = +3

Query: 531 VSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           VS  +PA V+P P P+    + P PS   T A      TS    P      LPTP
Sbjct: 186 VSNRSPAVVTPAPTPTEIFWNQPVPSVPITFAPPVPTITSSPAPPPPPPPPLPTP 240


>AY058771-1|AAL14000.1|  885|Drosophila melanogaster SD05329p
           protein.
          Length = 885

 Score = 30.7 bits (66), Expect = 2.7
 Identities = 19/61 (31%), Positives = 27/61 (44%)
 Frame = +3

Query: 357 NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVS 536
           N+L V     P  LTE  L P  ++ K  +I     N    YV   AV +L   ++P + 
Sbjct: 649 NDLYVETGIVPPTLTEDELKPSTSKRKFDEIESSVSNYKECYVEF-AVPNLRTDILPTIK 707

Query: 537 C 539
           C
Sbjct: 708 C 708


>AE014296-3638|AAF51794.1|  885|Drosophila melanogaster CG7143-PA
           protein.
          Length = 885

 Score = 30.7 bits (66), Expect = 2.7
 Identities = 19/61 (31%), Positives = 27/61 (44%)
 Frame = +3

Query: 357 NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVS 536
           N+L V     P  LTE  L P  ++ K  +I     N    YV   AV +L   ++P + 
Sbjct: 649 NDLYVETGIVPPTLTEDELKPSTSKRKFDEIESSVSNYKECYVEF-AVPNLRTDILPTIK 707

Query: 537 C 539
           C
Sbjct: 708 C 708


>AB049433-1|BAB15799.1|  885|Drosophila melanogaster dpol-eta
           protein.
          Length = 885

 Score = 30.7 bits (66), Expect = 2.7
 Identities = 19/61 (31%), Positives = 27/61 (44%)
 Frame = +3

Query: 357 NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVS 536
           N+L V     P  LTE  L P  ++ K  +I     N    YV   AV +L   ++P + 
Sbjct: 649 NDLYVETGIVPPTLTEDELKPSTSKRKFDEIESSVSNYKECYVEF-AVPNLRTDILPTIK 707

Query: 537 C 539
           C
Sbjct: 708 C 708


>AB036766-1|BAB20905.1|  885|Drosophila melanogaster DNA polymerase
           eta protein.
          Length = 885

 Score = 30.7 bits (66), Expect = 2.7
 Identities = 19/61 (31%), Positives = 27/61 (44%)
 Frame = +3

Query: 357 NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVS 536
           N+L V     P  LTE  L P  ++ K  +I     N    YV   AV +L   ++P + 
Sbjct: 649 NDLYVETGIVPPTLTEDELKPSTSKRKFDEIESSVSNYKECYVEF-AVPNLRTDILPTIK 707

Query: 537 C 539
           C
Sbjct: 708 C 708


>AE014296-1913|AAN11902.1|  130|Drosophila melanogaster CG32077-PA
           protein.
          Length = 130

 Score = 30.3 bits (65), Expect = 3.5
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 3/76 (3%)
 Frame = +3

Query: 474 AMYVAIQAVLSLTRPVVPPVSCWT--PATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTT 647
           A+   + +  ++T P  PP +  T  PAT   TP  +   T SPT S   T +   S T 
Sbjct: 10  AIVAFVSSAWAVTDPATPPATDPTTPPATDPTTPPATDPATTSPTTSTSPTTSTSPSATG 69

Query: 648 S*RFSPSAA-TRSLPT 692
           S   +P+ A T   PT
Sbjct: 70  SSTTAPTTAPTTVAPT 85


>L42514-1|AAA98918.1| 1039|Drosophila melanogaster male-specific
           lethal-1 protein protein.
          Length = 1039

 Score = 29.9 bits (64), Expect = 4.7
 Identities = 18/57 (31%), Positives = 28/57 (49%)
 Frame = +3

Query: 525 PPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           PP +  +  T++P P PST  T   TP    T +  D + ++ + S S A   + TP
Sbjct: 732 PPSAPVSSTTITPAPTPSTTPTPGSTPQHAVT-SSMDQEISAAK-SKSKAAEQIATP 786


>BT023828-1|AAZ86749.1| 1039|Drosophila melanogaster RE18093p
           protein.
          Length = 1039

 Score = 29.9 bits (64), Expect = 4.7
 Identities = 18/57 (31%), Positives = 28/57 (49%)
 Frame = +3

Query: 525 PPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           PP +  +  T++P P PST  T   TP    T +  D + ++ + S S A   + TP
Sbjct: 732 PPSAPVSSTTITPAPTPSTTPTPGSTPQHAVT-SSMDQEISAAK-SKSKAAEQIATP 786


>AE014296-1693|AAF50239.2| 1937|Drosophila melanogaster CG3280-PA
           protein.
          Length = 1937

 Score = 29.9 bits (64), Expect = 4.7
 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 1/51 (1%)
 Frame = +3

Query: 501 LSLTRPVVPPVSCWTPA-TVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS 650
           L  T P   P +  T   T  PT  PST  T + T S +W+     S TT+
Sbjct: 659 LPTTLPTTLPTALPTTLPTTLPTTLPSTLATTTATTSSIWSTTEETSPTTT 709



 Score = 29.5 bits (63), Expect = 6.2
 Identities = 24/83 (28%), Positives = 32/83 (38%), Gaps = 2/83 (2%)
 Frame = +3

Query: 441 TQIMFETFNTPAMYV-AIQAVLSLTRPVVPPVSCWTPA-TVSPTPCPSTRDTHSPTPSCV 614
           T +M     TPAM    +   L  T P   P +  T   T  PT  P+T  T  P+    
Sbjct: 630 TTLMVLNLTTPAMVPPTLPTTLPTTFPTTLPTTLPTTLPTALPTTLPTTLPTTLPSTLAT 689

Query: 615 WTLAGRDSQTTS*RFSPSAATRS 683
            T       +T+   SP+  T S
Sbjct: 690 TTATTSSIWSTTEETSPTTTTTS 712


>AE014134-2958|AAF53689.1| 1039|Drosophila melanogaster CG10385-PA
           protein.
          Length = 1039

 Score = 29.9 bits (64), Expect = 4.7
 Identities = 18/57 (31%), Positives = 28/57 (49%)
 Frame = +3

Query: 525 PPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           PP +  +  T++P P PST  T   TP    T +  D + ++ + S S A   + TP
Sbjct: 732 PPSAPVSSTTITPAPTPSTTPTPGSTPQHAVT-SSMDQEISAAK-SKSKAAEQIATP 786


>M96575-1|AAB59184.1| 1775|Drosophila melanogaster type IV collagen
            protein.
          Length = 1775

 Score = 29.5 bits (63), Expect = 6.2
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 177  PLDRGKAPPSGRDGRYGTEGL 239
            P +RG   P GRDGR GT GL
Sbjct: 1430 PGERGFTGPKGRDGRDGTPGL 1450


>M28334-1|AAA28422.1|  421|Drosophila melanogaster type VI-related
           collagen protein.
          Length = 421

 Score = 29.5 bits (63), Expect = 6.2
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 177 PLDRGKAPPSGRDGRYGTEGL 239
           P +RG   P GRDGR GT GL
Sbjct: 76  PGERGFTGPKGRDGRDGTPGL 96


>M23704-1|AAA28404.1| 1775|Drosophila melanogaster alpha-1 type IV
            collagen protein.
          Length = 1775

 Score = 29.5 bits (63), Expect = 6.2
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 177  PLDRGKAPPSGRDGRYGTEGL 239
            P +RG   P GRDGR GT GL
Sbjct: 1430 PGERGFTGPKGRDGRDGTPGL 1450


>L05080-1|AAA28420.1|  873|Drosophila melanogaster calphotin
           protein.
          Length = 873

 Score = 29.5 bits (63), Expect = 6.2
 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 2/41 (4%)
 Frame = +3

Query: 483 VAIQAVLSLTRPVVPPVSCWT-PA-TVSPTPCPSTRDTHSP 599
           VA  AV   T PVVPPV+  + PA  V+ TP P+T     P
Sbjct: 348 VASVAVAETTPPVVPPVAAESIPAPVVATTPVPATLAVTDP 388


>L02111-1|AAA28405.1|  865|Drosophila melanogaster calcium-binding
           protein protein.
          Length = 865

 Score = 29.5 bits (63), Expect = 6.2
 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 2/41 (4%)
 Frame = +3

Query: 483 VAIQAVLSLTRPVVPPVSCWT-PA-TVSPTPCPSTRDTHSP 599
           VA  AV   T PVVPPV+  + PA  V+ TP P+T     P
Sbjct: 340 VASVAVAETTPPVVPPVAAESIPAPVVATTPVPATLAVTDP 380


>J02727-1|AAA28423.1| 1775|Drosophila melanogaster type IV
            pro-collagen protein.
          Length = 1775

 Score = 29.5 bits (63), Expect = 6.2
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 177  PLDRGKAPPSGRDGRYGTEGL 239
            P +RG   P GRDGR GT GL
Sbjct: 1430 PGERGFTGPKGRDGRDGTPGL 1450


>AY058315-1|AAL13544.1|  864|Drosophila melanogaster GH08002p
           protein.
          Length = 864

 Score = 29.5 bits (63), Expect = 6.2
 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 2/41 (4%)
 Frame = +3

Query: 483 VAIQAVLSLTRPVVPPVSCWT-PA-TVSPTPCPSTRDTHSP 599
           VA  AV   T PVVPPV+  + PA  V+ TP P+T     P
Sbjct: 341 VASVAVAETTPPVVPPVAAESIPAPVVATTPVPATLAVTDP 381


>AE014298-2947|AAF49026.2| 2529|Drosophila melanogaster CG32529-PA,
           isoform A protein.
          Length = 2529

 Score = 29.5 bits (63), Expect = 6.2
 Identities = 30/107 (28%), Positives = 47/107 (43%)
 Frame = +3

Query: 375 PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPAT 554
           P++   L+      P +N E +   + E  +TP +     A      P   P    TP T
Sbjct: 321 PKKEANLVKSTARLPDSNTESVQMELEEIVSTPTVTPTPSAT-----PTATPTPTATP-T 374

Query: 555 VSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           ++PTP  +TR T +PTP    TL    + T++   +  AA +  P P
Sbjct: 375 LTPTPT-ATR-TRTPTP----TLTPTPTPTSTPSSTAIAAGQPAPPP 415


>AE014297-1457|AAF54754.1|  864|Drosophila melanogaster CG4795-PB,
           isoform B protein.
          Length = 864

 Score = 29.5 bits (63), Expect = 6.2
 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 2/41 (4%)
 Frame = +3

Query: 483 VAIQAVLSLTRPVVPPVSCWT-PA-TVSPTPCPSTRDTHSP 599
           VA  AV   T PVVPPV+  + PA  V+ TP P+T     P
Sbjct: 341 VASVAVAETTPPVVPPVAAESIPAPVVATTPVPATLAVTDP 381


>AE014297-1456|AAF54755.1|  842|Drosophila melanogaster CG4795-PA,
           isoform A protein.
          Length = 842

 Score = 29.5 bits (63), Expect = 6.2
 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 2/41 (4%)
 Frame = +3

Query: 483 VAIQAVLSLTRPVVPPVSCWT-PA-TVSPTPCPSTRDTHSP 599
           VA  AV   T PVVPPV+  + PA  V+ TP P+T     P
Sbjct: 341 VASVAVAETTPPVVPPVAAESIPAPVVATTPVPATLAVTDP 381


>AE014296-1901|AAF50098.3|  137|Drosophila melanogaster CG12522-PA
           protein.
          Length = 137

 Score = 29.5 bits (63), Expect = 6.2
 Identities = 23/85 (27%), Positives = 40/85 (47%)
 Frame = +3

Query: 474 AMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS* 653
           A+ +A+ A L +        S  + ++ SPT   ST  T S + S   T +   S TT+ 
Sbjct: 6   ALSLAVLATLVVLSSQATSTSPTSSSSTSPTSSSSTSPTSSSSTSP--TSSSSSSDTTAT 63

Query: 654 RFSPSAATRSLPTPXGKFVREHSRR 728
             + +AAT +  +   +  ++H RR
Sbjct: 64  TTTTTAATTTTTSTTEESKKKHRRR 88


>AE014134-846|AAN10520.1| 1779|Drosophila melanogaster CG4145-PC,
            isoform C protein.
          Length = 1779

 Score = 29.5 bits (63), Expect = 6.2
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 177  PLDRGKAPPSGRDGRYGTEGL 239
            P +RG   P GRDGR GT GL
Sbjct: 1431 PGERGFTGPKGRDGRDGTPGL 1451


>AE014134-845|AAN10519.1| 1779|Drosophila melanogaster CG4145-PB,
            isoform B protein.
          Length = 1779

 Score = 29.5 bits (63), Expect = 6.2
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 177  PLDRGKAPPSGRDGRYGTEGL 239
            P +RG   P GRDGR GT GL
Sbjct: 1431 PGERGFTGPKGRDGRDGTPGL 1451


>AE014134-844|AAF52204.1| 1779|Drosophila melanogaster CG4145-PA,
            isoform A protein.
          Length = 1779

 Score = 29.5 bits (63), Expect = 6.2
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = +3

Query: 177  PLDRGKAPPSGRDGRYGTEGL 239
            P +RG   P GRDGR GT GL
Sbjct: 1431 PGERGFTGPKGRDGRDGTPGL 1451


>AY071278-1|AAL48900.1|  347|Drosophila melanogaster RE30702p
           protein.
          Length = 347

 Score = 29.1 bits (62), Expect = 8.1
 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 3/81 (3%)
 Frame = +3

Query: 444 QIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPC-PSTRDTHSP--TPSCV 614
           QI+  T  TPA           T     P +  T A  + T C P+T  T +P  T +C 
Sbjct: 123 QIITTTTCTPASVTTTTTCAPTTTTTCAPTTTTTCAPTTTTTCAPTTTTTCAPTTTTTCA 182

Query: 615 WTLAGRDSQTTS*RFSPSAAT 677
            T     + TT+   +P+  T
Sbjct: 183 PTTTTTCAPTTTTTCTPTTTT 203


>AE014298-394|AAS65251.1| 1535|Drosophila melanogaster CG14047-PB,
           isoform B protein.
          Length = 1535

 Score = 29.1 bits (62), Expect = 8.1
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -3

Query: 521 DRTRKREHGLDGDVHGGRVECFE 453
           DRT  R HG +  +HGG VE  E
Sbjct: 57  DRTADRSHGHNHGIHGGHVEQIE 79


>AE014298-393|AAF45777.2| 1395|Drosophila melanogaster CG14047-PA,
           isoform A protein.
          Length = 1395

 Score = 29.1 bits (62), Expect = 8.1
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -3

Query: 521 DRTRKREHGLDGDVHGGRVECFE 453
           DRT  R HG +  +HGG VE  E
Sbjct: 57  DRTADRSHGHNHGIHGGHVEQIE 79


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 41,537,291
Number of Sequences: 53049
Number of extensions: 1033841
Number of successful extensions: 4724
Number of sequences better than 10.0: 89
Number of HSP's better than 10.0 without gapping: 3844
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4656
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4106450400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -