SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30134.Seq
         (882 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014297-2795|AAF55769.2|  408|Drosophila melanogaster CG17916-P...    34   0.30 
DQ397338-1|ABD59005.1|  705|Drosophila melanogaster Lozenge spli...    31   2.1  
BT001341-1|AAN71096.1|  353|Drosophila melanogaster AT22714p pro...    31   2.1  
AF217651-2|AAF35308.1|  826|Drosophila melanogaster lozenge prot...    31   2.1  
AE014298-1325|AAF46486.2|  826|Drosophila melanogaster CG1689-PA...    31   2.1  
AE013599-3242|AAM70925.1|  353|Drosophila melanogaster CG30284-P...    31   2.1  
BT022700-1|AAY55116.1|  422|Drosophila melanogaster IP12315p pro...    30   3.7  
AE014298-707|AAF46008.1|  422|Drosophila melanogaster CG15465-PA...    30   3.7  
BT011461-1|AAR99119.1|  638|Drosophila melanogaster RE27685p pro...    29   6.4  
BT011351-1|AAR96143.1|  638|Drosophila melanogaster RE74788p pro...    29   6.4  

>AE014297-2795|AAF55769.2|  408|Drosophila melanogaster CG17916-PA
           protein.
          Length = 408

 Score = 33.9 bits (74), Expect = 0.30
 Identities = 15/48 (31%), Positives = 28/48 (58%)
 Frame = +2

Query: 560 NVLNGKNLFVFYVILGINNFNQYIFAHVASFVIIWMTILICLHSSXIS 703
           NV+  + L  FY++LG  NFN Y+   +A F++  M+    L ++ ++
Sbjct: 42  NVIR-RYLLRFYLVLGFLNFNAYVVGEIAYFIVHIMSTTTLLEATAVA 88


>DQ397338-1|ABD59005.1|  705|Drosophila melanogaster Lozenge splice
           variant protein.
          Length = 705

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 6/59 (10%)
 Frame = -3

Query: 397 TASSSHRVANVXPVPA-ASKAHTGPAGGATHRPAHSG-----GGTPSRTLARTSHPGLS 239
           TAS+    A V  V + AS   + P GGA++  AHSG     GG  S T +  ++ G S
Sbjct: 197 TASTGATAAEVLAVSSSASVGSSSPTGGASNGTAHSGHSGHTGGHSSSTASNNNNNGAS 255


>BT001341-1|AAN71096.1|  353|Drosophila melanogaster AT22714p
           protein.
          Length = 353

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 4/61 (6%)
 Frame = -2

Query: 299 TQRRR-HPLADPRSDQSPGALISGALTSLTLPNLVGMNGRLA---QSAFIHTVTKTIQAK 132
           T+RRR H    PRS +     ++  ++   +P   G  G+     +S  I T +KT+Q K
Sbjct: 104 TERRRTHRKLSPRSTRCNSVAVTALVSRENIPQTSGKRGKKTPSHRSTLISTPSKTLQLK 163

Query: 131 T 129
           T
Sbjct: 164 T 164


>AF217651-2|AAF35308.1|  826|Drosophila melanogaster lozenge
           protein.
          Length = 826

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 6/59 (10%)
 Frame = -3

Query: 397 TASSSHRVANVXPVPA-ASKAHTGPAGGATHRPAHSG-----GGTPSRTLARTSHPGLS 239
           TAS+    A V  V + AS   + P GGA++  AHSG     GG  S T +  ++ G S
Sbjct: 197 TASTGATAAEVLAVSSSASVGSSSPTGGASNGTAHSGHSGHTGGHSSSTASNNNNNGAS 255


>AE014298-1325|AAF46486.2|  826|Drosophila melanogaster CG1689-PA
           protein.
          Length = 826

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 6/59 (10%)
 Frame = -3

Query: 397 TASSSHRVANVXPVPA-ASKAHTGPAGGATHRPAHSG-----GGTPSRTLARTSHPGLS 239
           TAS+    A V  V + AS   + P GGA++  AHSG     GG  S T +  ++ G S
Sbjct: 197 TASTGATAAEVLAVSSSASVGSSSPTGGASNGTAHSGHSGHTGGHSSSTASNNNNNGAS 255


>AE013599-3242|AAM70925.1|  353|Drosophila melanogaster CG30284-PA,
           isoform A protein.
          Length = 353

 Score = 31.1 bits (67), Expect = 2.1
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 4/61 (6%)
 Frame = -2

Query: 299 TQRRR-HPLADPRSDQSPGALISGALTSLTLPNLVGMNGRLA---QSAFIHTVTKTIQAK 132
           T+RRR H    PRS +     ++  ++   +P   G  G+     +S  I T +KT+Q K
Sbjct: 104 TERRRTHRKLSPRSTRCNSVAVTALVSRENIPQTSGKRGKKTPSHRSTLISTPSKTLQLK 163

Query: 131 T 129
           T
Sbjct: 164 T 164


>BT022700-1|AAY55116.1|  422|Drosophila melanogaster IP12315p
           protein.
          Length = 422

 Score = 30.3 bits (65), Expect = 3.7
 Identities = 25/88 (28%), Positives = 37/88 (42%), Gaps = 4/88 (4%)
 Frame = -3

Query: 445 KLPNL*RRNTLLSRHETASSSHRVANVXPVPAASKAH----TGPAGGATHRPAHSGGGTP 278
           +L N     +LLS+  + +S +R+    P   A   H     G A   T +P  SGG  P
Sbjct: 165 QLKNKVSSRSLLSKFSSTNSDNRI---HPEAGAGSGHHHSVLGAASVITSQPLPSGGEIP 221

Query: 277 SRTLARTSHPGLSYPVR*LL*RSPISLE 194
           S    +   P +  P   L   SP+ +E
Sbjct: 222 SSLFDQPGQPAVVVPPLQLQPSSPLFVE 249


>AE014298-707|AAF46008.1|  422|Drosophila melanogaster CG15465-PA
           protein.
          Length = 422

 Score = 30.3 bits (65), Expect = 3.7
 Identities = 25/88 (28%), Positives = 37/88 (42%), Gaps = 4/88 (4%)
 Frame = -3

Query: 445 KLPNL*RRNTLLSRHETASSSHRVANVXPVPAASKAH----TGPAGGATHRPAHSGGGTP 278
           +L N     +LLS+  + +S +R+    P   A   H     G A   T +P  SGG  P
Sbjct: 165 QLKNKVSSRSLLSKFSSTNSDNRI---HPEAGAGSGHHHSVLGAASVITSQPLPSGGEIP 221

Query: 277 SRTLARTSHPGLSYPVR*LL*RSPISLE 194
           S    +   P +  P   L   SP+ +E
Sbjct: 222 SSLFDQPGQPAVVVPPLQLQPSSPLFVE 249


>BT011461-1|AAR99119.1|  638|Drosophila melanogaster RE27685p
           protein.
          Length = 638

 Score = 29.5 bits (63), Expect = 6.4
 Identities = 20/54 (37%), Positives = 26/54 (48%)
 Frame = -3

Query: 406 RHETASSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGGGTPSRTLARTSHPG 245
           RH +  S  R +      AA++     AGGAT   AHS GGT   + A T+  G
Sbjct: 2   RHNSPVSRERASEAA---AATQTAAATAGGAT---AHSAGGTAGGSAAATTTAG 49


>BT011351-1|AAR96143.1|  638|Drosophila melanogaster RE74788p
           protein.
          Length = 638

 Score = 29.5 bits (63), Expect = 6.4
 Identities = 20/54 (37%), Positives = 26/54 (48%)
 Frame = -3

Query: 406 RHETASSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGGGTPSRTLARTSHPG 245
           RH +  S  R +      AA++     AGGAT   AHS GGT   + A T+  G
Sbjct: 2   RHNSPVSRERASEAA---AATQTAAATAGGAT---AHSAGGTAGGSAAATTTAG 49


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 39,941,357
Number of Sequences: 53049
Number of extensions: 875592
Number of successful extensions: 3047
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 2687
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3047
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 4291240668
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -