SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30132.Seq
         (689 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF520715-1|AAM55244.1| 4723|Drosophila melanogaster MICAL long i...    34   0.21 
BT030443-1|ABP87885.1|  467|Drosophila melanogaster IP01439p pro...    33   0.37 
AF520714-1|AAM55243.1| 3002|Drosophila melanogaster MICAL medium...    33   0.37 
AE014297-1071|AAO41537.1| 4723|Drosophila melanogaster CG33208-P...    33   0.37 
AE014297-1070|AAO41536.1| 4723|Drosophila melanogaster CG33208-P...    33   0.37 
AE014297-1069|AAO41535.1| 4723|Drosophila melanogaster CG33208-P...    33   0.37 
AE014297-1068|AAO41534.1| 4723|Drosophila melanogaster CG33208-P...    33   0.37 
AE014297-1067|AAO41533.1| 4723|Drosophila melanogaster CG33208-P...    33   0.37 
AE014297-1066|AAO41532.1| 3002|Drosophila melanogaster CG33208-P...    33   0.37 
AE014296-2126|AAF49932.1|  530|Drosophila melanogaster CG4328-PA...    33   0.37 
X65158-1|CAA46276.1|  469|Drosophila melanogaster developmental ...    32   0.64 
M92841-1|AAA28673.1|  469|Drosophila melanogaster LIM-homeodomai...    32   0.64 
BT005201-1|AAO61758.1|  469|Drosophila melanogaster HL02012p pro...    32   0.64 
AY069815-1|AAL39960.1|  468|Drosophila melanogaster SD05618p pro...    32   0.64 
AY051991-1|AAK93415.1| 1010|Drosophila melanogaster LD45758p pro...    32   0.64 
AF520716-1|AAM55245.1| 1010|Drosophila melanogaster MICAL-like p...    32   0.64 
AE014296-2228|AAF49857.2| 1010|Drosophila melanogaster CG11259-P...    32   0.64 
AE013599-102|AAF57314.1|  469|Drosophila melanogaster CG8376-PA,...    32   0.64 
AF520713-1|AAM55242.1| 2734|Drosophila melanogaster MICAL short ...    32   0.84 
AE014297-1065|AAO41531.1| 2734|Drosophila melanogaster CG33208-P...    32   0.84 
AY052077-1|AAK93501.1|  817|Drosophila melanogaster SD03168p pro...    29   7.9  
AY051990-1|AAK93414.1|  776|Drosophila melanogaster LD45682p pro...    29   7.9  
AF215703-1|AAF43004.1| 5322|Drosophila melanogaster KISMET-L lon...    29   7.9  
AF113847-1|AAD37500.1| 2151|Drosophila melanogaster kismet protein.    29   7.9  
AE014296-2710|AAF49482.1|  776|Drosophila melanogaster CG4925-PA...    29   7.9  
AE014134-63|AAF51530.1| 2151|Drosophila melanogaster CG3696-PB, ...    29   7.9  
AE014134-62|AAF51527.3| 5322|Drosophila melanogaster CG3696-PA, ...    29   7.9  
AE013599-3041|AAF57448.2|  818|Drosophila melanogaster CG30147-P...    29   7.9  
AE013599-3040|AAF57449.2|  818|Drosophila melanogaster CG30147-P...    29   7.9  

>AF520715-1|AAM55244.1| 4723|Drosophila melanogaster MICAL long
            isoform protein.
          Length = 4723

 Score = 33.9 bits (74), Expect = 0.21
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = +1

Query: 355  PGASSK-SEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
            P +SSK + A +       C  C Q +    K  ++    H +C KC+ CHT
Sbjct: 1055 PKSSSKVALAFKKQAASEKCRFCKQTVYPMEKTTVEGLVLHRNCLKCHHCHT 1106


>BT030443-1|ABP87885.1|  467|Drosophila melanogaster IP01439p
           protein.
          Length = 467

 Score = 33.1 bits (72), Expect = 0.37
 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 2/56 (3%)
 Frame = +1

Query: 352 NPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFC--HTVH 513
           N G   +   +  + + S C+ C Q I +   + + + +FH  C KC  C  H VH
Sbjct: 103 NSGMGMELGLAMASPQLSQCAHCCQPICDRYIMRVVENSFHEGCLKCTACSLHLVH 158


>AF520714-1|AAM55243.1| 3002|Drosophila melanogaster MICAL medium
            isoform protein.
          Length = 3002

 Score = 33.1 bits (72), Expect = 0.37
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = +1

Query: 355  PGASSK-SEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
            P +SSK + A +       C  C Q +    K  ++    H +C KC+ CHT
Sbjct: 1055 PKSSSKVALAFKKQAASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHT 1106


>AE014297-1071|AAO41537.1| 4723|Drosophila melanogaster CG33208-PH,
            isoform H protein.
          Length = 4723

 Score = 33.1 bits (72), Expect = 0.37
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = +1

Query: 355  PGASSK-SEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
            P +SSK + A +       C  C Q +    K  ++    H +C KC+ CHT
Sbjct: 1055 PKSSSKVALAFKKQAASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHT 1106


>AE014297-1070|AAO41536.1| 4723|Drosophila melanogaster CG33208-PG,
            isoform G protein.
          Length = 4723

 Score = 33.1 bits (72), Expect = 0.37
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = +1

Query: 355  PGASSK-SEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
            P +SSK + A +       C  C Q +    K  ++    H +C KC+ CHT
Sbjct: 1055 PKSSSKVALAFKKQAASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHT 1106


>AE014297-1069|AAO41535.1| 4723|Drosophila melanogaster CG33208-PF,
            isoform F protein.
          Length = 4723

 Score = 33.1 bits (72), Expect = 0.37
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = +1

Query: 355  PGASSK-SEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
            P +SSK + A +       C  C Q +    K  ++    H +C KC+ CHT
Sbjct: 1055 PKSSSKVALAFKKQAASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHT 1106


>AE014297-1068|AAO41534.1| 4723|Drosophila melanogaster CG33208-PD,
            isoform D protein.
          Length = 4723

 Score = 33.1 bits (72), Expect = 0.37
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = +1

Query: 355  PGASSK-SEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
            P +SSK + A +       C  C Q +    K  ++    H +C KC+ CHT
Sbjct: 1055 PKSSSKVALAFKKQAASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHT 1106


>AE014297-1067|AAO41533.1| 4723|Drosophila melanogaster CG33208-PC,
            isoform C protein.
          Length = 4723

 Score = 33.1 bits (72), Expect = 0.37
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = +1

Query: 355  PGASSK-SEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
            P +SSK + A +       C  C Q +    K  ++    H +C KC+ CHT
Sbjct: 1055 PKSSSKVALAFKKQAASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHT 1106


>AE014297-1066|AAO41532.1| 3002|Drosophila melanogaster CG33208-PB,
            isoform B protein.
          Length = 3002

 Score = 33.1 bits (72), Expect = 0.37
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = +1

Query: 355  PGASSK-SEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
            P +SSK + A +       C  C Q +    K  ++    H +C KC+ CHT
Sbjct: 1055 PKSSSKVALAFKKQAASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHT 1106


>AE014296-2126|AAF49932.1|  530|Drosophila melanogaster CG4328-PA
           protein.
          Length = 530

 Score = 33.1 bits (72), Expect = 0.37
 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 2/56 (3%)
 Frame = +1

Query: 352 NPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFC--HTVH 513
           N G   +   +  + + S C+ C Q I +   + + + +FH  C KC  C  H VH
Sbjct: 166 NSGMGMELGLAMASPQLSQCAHCCQPICDRYIMRVVENSFHEGCLKCTACSLHLVH 221


>X65158-1|CAA46276.1|  469|Drosophila melanogaster developmental
           regulatory protein protein.
          Length = 469

 Score = 32.3 bits (70), Expect = 0.64
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQ-AFHSHCAKCYFCHT 507
           CSRCL  I+ N  +   +   FH +C  C  CHT
Sbjct: 210 CSRCLASISSNELVMRARNLVFHVNCFCCTVCHT 243


>M92841-1|AAA28673.1|  469|Drosophila melanogaster LIM-homeodomain
           apterous protein protein.
          Length = 469

 Score = 32.3 bits (70), Expect = 0.64
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQ-AFHSHCAKCYFCHT 507
           CSRCL  I+ N  +   +   FH +C  C  CHT
Sbjct: 210 CSRCLASISSNELVMRARNLVFHVNCFCCTVCHT 243


>BT005201-1|AAO61758.1|  469|Drosophila melanogaster HL02012p
           protein.
          Length = 469

 Score = 32.3 bits (70), Expect = 0.64
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQ-AFHSHCAKCYFCHT 507
           CSRCL  I+ N  +   +   FH +C  C  CHT
Sbjct: 210 CSRCLASISSNELVMRARNLVFHVNCFCCTVCHT 243


>AY069815-1|AAL39960.1|  468|Drosophila melanogaster SD05618p
           protein.
          Length = 468

 Score = 32.3 bits (70), Expect = 0.64
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQ-AFHSHCAKCYFCHT 507
           CSRCL  I+ N  +   +   FH +C  C  CHT
Sbjct: 209 CSRCLASISSNELVMRARNLVFHVNCFCCTVCHT 242


>AY051991-1|AAK93415.1| 1010|Drosophila melanogaster LD45758p
           protein.
          Length = 1010

 Score = 32.3 bits (70), Expect = 0.64
 Identities = 13/46 (28%), Positives = 23/46 (50%)
 Frame = +1

Query: 388 GNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRPTS 525
           G  +R  C +C   +    ++ + K+A+H  C KC  C ++  P S
Sbjct: 143 GMPRRDKCQKCNLPVFLAERVLVGKRAYHRTCLKCARCSSLLTPGS 188


>AF520716-1|AAM55245.1| 1010|Drosophila melanogaster MICAL-like
           protein protein.
          Length = 1010

 Score = 32.3 bits (70), Expect = 0.64
 Identities = 13/46 (28%), Positives = 23/46 (50%)
 Frame = +1

Query: 388 GNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRPTS 525
           G  +R  C +C   +    ++ + K+A+H  C KC  C ++  P S
Sbjct: 143 GMPRRDKCQKCNLPVFLAERVLVGKRAYHRTCLKCARCSSLLTPGS 188


>AE014296-2228|AAF49857.2| 1010|Drosophila melanogaster CG11259-PA
           protein.
          Length = 1010

 Score = 32.3 bits (70), Expect = 0.64
 Identities = 13/46 (28%), Positives = 23/46 (50%)
 Frame = +1

Query: 388 GNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRPTS 525
           G  +R  C +C   +    ++ + K+A+H  C KC  C ++  P S
Sbjct: 143 GMPRRDKCQKCNLPVFLAERVLVGKRAYHRTCLKCARCSSLLTPGS 188


>AE013599-102|AAF57314.1|  469|Drosophila melanogaster CG8376-PA,
           isoform A protein.
          Length = 469

 Score = 32.3 bits (70), Expect = 0.64
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQ-AFHSHCAKCYFCHT 507
           CSRCL  I+ N  +   +   FH +C  C  CHT
Sbjct: 210 CSRCLASISSNELVMRARNLVFHVNCFCCTVCHT 243


>AF520713-1|AAM55242.1| 2734|Drosophila melanogaster MICAL short
           isoform protein.
          Length = 2734

 Score = 31.9 bits (69), Expect = 0.84
 Identities = 11/33 (33%), Positives = 16/33 (48%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
           C  C Q +    K  ++    H +C KC+ CHT
Sbjct: 806 CRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHT 838


>AE014297-1065|AAO41531.1| 2734|Drosophila melanogaster CG33208-PE,
           isoform E protein.
          Length = 2734

 Score = 31.9 bits (69), Expect = 0.84
 Identities = 11/33 (33%), Positives = 16/33 (48%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
           C  C Q +    K  ++    H +C KC+ CHT
Sbjct: 806 CRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHT 838


>AY052077-1|AAK93501.1|  817|Drosophila melanogaster SD03168p
           protein.
          Length = 817

 Score = 28.7 bits (61), Expect = 7.9
 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 2/41 (4%)
 Frame = +1

Query: 391 NTKRSVCSRCLQMINENNKIEI--DKQAFHSHCAKCYFCHT 507
           N   S C RC + + + +++    D   FHS C KC  C T
Sbjct: 5   NFYESTCLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGT 45


>AY051990-1|AAK93414.1|  776|Drosophila melanogaster LD45682p
           protein.
          Length = 776

 Score = 28.7 bits (61), Expect = 7.9
 Identities = 21/67 (31%), Positives = 30/67 (44%)
 Frame = +1

Query: 370 KSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRPTSTSAMVKSS 549
           K   +E  T  S CS C Q IN     E  +Q  HS  +     H+  R  S S+  ++ 
Sbjct: 551 KRGITEPKTPISYCSNCQQAIN-GYPTENPQQRSHSRSSSHGSMHSGSRRASESSESETV 609

Query: 550 ASLASNI 570
           AS A+ +
Sbjct: 610 ASSATTV 616


>AF215703-1|AAF43004.1| 5322|Drosophila melanogaster KISMET-L long
            isoform protein.
          Length = 5322

 Score = 28.7 bits (61), Expect = 7.9
 Identities = 14/49 (28%), Positives = 24/49 (48%)
 Frame = +1

Query: 331  GNGQEGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHS 477
            G G  G   G S +S   +GN+++S  +  LQ   +  + +  +Q  HS
Sbjct: 4318 GGGASGSGSGNSRRSNRQQGNSQQSSSAAQLQKQQQQQQQQQQQQQQHS 4366


>AF113847-1|AAD37500.1| 2151|Drosophila melanogaster kismet protein.
          Length = 2151

 Score = 28.7 bits (61), Expect = 7.9
 Identities = 14/49 (28%), Positives = 24/49 (48%)
 Frame = +1

Query: 331  GNGQEGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHS 477
            G G  G   G S +S   +GN+++S  +  LQ   +  + +  +Q  HS
Sbjct: 1147 GGGASGSGSGNSRRSNRQQGNSQQSSSAAQLQKQQQQQQQQQQQQQQHS 1195


>AE014296-2710|AAF49482.1|  776|Drosophila melanogaster CG4925-PA
           protein.
          Length = 776

 Score = 28.7 bits (61), Expect = 7.9
 Identities = 21/67 (31%), Positives = 30/67 (44%)
 Frame = +1

Query: 370 KSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHTVHRPTSTSAMVKSS 549
           K   +E  T  S CS C Q IN     E  +Q  HS  +     H+  R  S S+  ++ 
Sbjct: 551 KRGITEPKTPISYCSNCQQAIN-GYPTENPQQRSHSRSSSHGSMHSGSRRASESSESETV 609

Query: 550 ASLASNI 570
           AS A+ +
Sbjct: 610 ASSATTV 616


>AE014134-63|AAF51530.1| 2151|Drosophila melanogaster CG3696-PB,
            isoform B protein.
          Length = 2151

 Score = 28.7 bits (61), Expect = 7.9
 Identities = 14/49 (28%), Positives = 24/49 (48%)
 Frame = +1

Query: 331  GNGQEGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHS 477
            G G  G   G S +S   +GN+++S  +  LQ   +  + +  +Q  HS
Sbjct: 1147 GGGASGSGSGNSRRSNRQQGNSQQSSSAAQLQKQQQQQQQQQQQQQQHS 1195


>AE014134-62|AAF51527.3| 5322|Drosophila melanogaster CG3696-PA,
            isoform A protein.
          Length = 5322

 Score = 28.7 bits (61), Expect = 7.9
 Identities = 14/49 (28%), Positives = 24/49 (48%)
 Frame = +1

Query: 331  GNGQEGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHS 477
            G G  G   G S +S   +GN+++S  +  LQ   +  + +  +Q  HS
Sbjct: 4318 GGGASGSGSGNSRRSNRQQGNSQQSSSAAQLQKQQQQQQQQQQQQQQHS 4366


>AE013599-3041|AAF57448.2|  818|Drosophila melanogaster CG30147-PB,
           isoform B protein.
          Length = 818

 Score = 28.7 bits (61), Expect = 7.9
 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 2/41 (4%)
 Frame = +1

Query: 391 NTKRSVCSRCLQMINENNKIEI--DKQAFHSHCAKCYFCHT 507
           N   S C RC + + + +++    D   FHS C KC  C T
Sbjct: 5   NFYESTCLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGT 45


>AE013599-3040|AAF57449.2|  818|Drosophila melanogaster CG30147-PA,
           isoform A protein.
          Length = 818

 Score = 28.7 bits (61), Expect = 7.9
 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 2/41 (4%)
 Frame = +1

Query: 391 NTKRSVCSRCLQMINENNKIEI--DKQAFHSHCAKCYFCHT 507
           N   S C RC + + + +++    D   FHS C KC  C T
Sbjct: 5   NFYESTCLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGT 45


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,604,883
Number of Sequences: 53049
Number of extensions: 718553
Number of successful extensions: 2666
Number of sequences better than 10.0: 29
Number of HSP's better than 10.0 without gapping: 2476
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2656
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3005453946
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -