SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30131.Seq
         (482 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M90422-1|AAA28741.1|  270|Drosophila melanogaster p40 protein.        138   5e-33
M77133-1|AAA28667.1|  253|Drosophila melanogaster laminin recept...   138   5e-33
BT029094-1|ABJ17027.1|  270|Drosophila melanogaster IP12946p pro...   138   5e-33
AY118899-1|AAM50759.1|  270|Drosophila melanogaster LD09376p pro...   138   5e-33
AL031027-8|CAA19839.1|  270|Drosophila melanogaster EG:80H7.6,FB...   138   5e-33
AE014298-225|AAN09049.1|  270|Drosophila melanogaster CG14792-PB...   138   5e-33
AE014298-224|AAF45638.2|  270|Drosophila melanogaster CG14792-PA...   138   5e-33
AE014298-223|AAN09050.2|  313|Drosophila melanogaster CG14792-PD...   138   5e-33
BT012492-1|AAS93763.1|  301|Drosophila melanogaster LD03460p pro...    31   1.1  
BT003264-1|AAO25021.1|  334|Drosophila melanogaster LD22345p pro...    31   1.1  
AY051619-1|AAK93043.1|  334|Drosophila melanogaster GH26634p pro...    31   1.1  
AE014296-14|AAS64919.1|  334|Drosophila melanogaster CG6845-PB, ...    31   1.1  
AE014296-13|AAF47333.2|  480|Drosophila melanogaster CG6845-PA, ...    31   1.1  

>M90422-1|AAA28741.1|  270|Drosophila melanogaster p40 protein.
          Length = 270

 Score =  138 bits (333), Expect = 5e-33
 Identities = 66/84 (78%), Positives = 72/84 (85%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL LAARA+VAI+NP+D+FVISSR  GQRAVLKFA +T  TPIAGRFTPGAFTNQIQ AF
Sbjct: 57  KLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQPI EASYV
Sbjct: 117 REPRLLVVTDPNTDHQPIMEASYV 140



 Score =  103 bits (246), Expect = 2e-22
 Identities = 46/73 (63%), Positives = 51/73 (69%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IPVIA  NTDSPL ++DIAIPCN KS+HSIGLMWW              R   W VVVDL
Sbjct: 142 IPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVDL 201

Query: 437 FFYRDPEESEKDE 475
           FFYRDPEE+EK+E
Sbjct: 202 FFYRDPEEAEKEE 214


>M77133-1|AAA28667.1|  253|Drosophila melanogaster laminin receptor
           protein.
          Length = 253

 Score =  138 bits (333), Expect = 5e-33
 Identities = 66/84 (78%), Positives = 72/84 (85%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL LAARA+VAI+NP+D+FVISSR  GQRAVLKFA +T  TPIAGRFTPGAFTNQIQ AF
Sbjct: 40  KLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAF 99

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQPI EASYV
Sbjct: 100 REPRLLVVTDPNTDHQPIMEASYV 123



 Score =  103 bits (246), Expect = 2e-22
 Identities = 46/73 (63%), Positives = 51/73 (69%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IPVIA  NTDSPL ++DIAIPCN KS+HSIGLMWW              R   W VVVDL
Sbjct: 125 IPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVDL 184

Query: 437 FFYRDPEESEKDE 475
           FFYRDPEE+EK+E
Sbjct: 185 FFYRDPEEAEKEE 197


>BT029094-1|ABJ17027.1|  270|Drosophila melanogaster IP12946p
           protein.
          Length = 270

 Score =  138 bits (333), Expect = 5e-33
 Identities = 66/84 (78%), Positives = 72/84 (85%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL LAARA+VAI+NP+D+FVISSR  GQRAVLKFA +T  TPIAGRFTPGAFTNQIQ AF
Sbjct: 57  KLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQPI EASYV
Sbjct: 117 REPRLLVVTDPNTDHQPIMEASYV 140



 Score =  103 bits (246), Expect = 2e-22
 Identities = 46/73 (63%), Positives = 51/73 (69%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IPVIA  NTDSPL ++DIAIPCN KS+HSIGLMWW              R   W VVVDL
Sbjct: 142 IPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVDL 201

Query: 437 FFYRDPEESEKDE 475
           FFYRDPEE+EK+E
Sbjct: 202 FFYRDPEEAEKEE 214


>AY118899-1|AAM50759.1|  270|Drosophila melanogaster LD09376p
           protein.
          Length = 270

 Score =  138 bits (333), Expect = 5e-33
 Identities = 66/84 (78%), Positives = 72/84 (85%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL LAARA+VAI+NP+D+FVISSR  GQRAVLKFA +T  TPIAGRFTPGAFTNQIQ AF
Sbjct: 57  KLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQPI EASYV
Sbjct: 117 REPRLLVVTDPNTDHQPIMEASYV 140



 Score =  103 bits (246), Expect = 2e-22
 Identities = 46/73 (63%), Positives = 51/73 (69%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IPVIA  NTDSPL ++DIAIPCN KS+HSIGLMWW              R   W VVVDL
Sbjct: 142 IPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVDL 201

Query: 437 FFYRDPEESEKDE 475
           FFYRDPEE+EK+E
Sbjct: 202 FFYRDPEEAEKEE 214


>AL031027-8|CAA19839.1|  270|Drosophila melanogaster
           EG:80H7.6,FBgn0003517;sta protein.
          Length = 270

 Score =  138 bits (333), Expect = 5e-33
 Identities = 66/84 (78%), Positives = 72/84 (85%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL LAARA+VAI+NP+D+FVISSR  GQRAVLKFA +T  TPIAGRFTPGAFTNQIQ AF
Sbjct: 57  KLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQPI EASYV
Sbjct: 117 REPRLLVVTDPNTDHQPIMEASYV 140



 Score =  103 bits (246), Expect = 2e-22
 Identities = 46/73 (63%), Positives = 51/73 (69%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IPVIA  NTDSPL ++DIAIPCN KS+HSIGLMWW              R   W VVVDL
Sbjct: 142 IPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVDL 201

Query: 437 FFYRDPEESEKDE 475
           FFYRDPEE+EK+E
Sbjct: 202 FFYRDPEEAEKEE 214


>AE014298-225|AAN09049.1|  270|Drosophila melanogaster CG14792-PB,
           isoform B protein.
          Length = 270

 Score =  138 bits (333), Expect = 5e-33
 Identities = 66/84 (78%), Positives = 72/84 (85%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL LAARA+VAI+NP+D+FVISSR  GQRAVLKFA +T  TPIAGRFTPGAFTNQIQ AF
Sbjct: 57  KLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQPI EASYV
Sbjct: 117 REPRLLVVTDPNTDHQPIMEASYV 140



 Score =  103 bits (246), Expect = 2e-22
 Identities = 46/73 (63%), Positives = 51/73 (69%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IPVIA  NTDSPL ++DIAIPCN KS+HSIGLMWW              R   W VVVDL
Sbjct: 142 IPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVDL 201

Query: 437 FFYRDPEESEKDE 475
           FFYRDPEE+EK+E
Sbjct: 202 FFYRDPEEAEKEE 214


>AE014298-224|AAF45638.2|  270|Drosophila melanogaster CG14792-PA,
           isoform A protein.
          Length = 270

 Score =  138 bits (333), Expect = 5e-33
 Identities = 66/84 (78%), Positives = 72/84 (85%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL LAARA+VAI+NP+D+FVISSR  GQRAVLKFA +T  TPIAGRFTPGAFTNQIQ AF
Sbjct: 57  KLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQPI EASYV
Sbjct: 117 REPRLLVVTDPNTDHQPIMEASYV 140



 Score =  103 bits (246), Expect = 2e-22
 Identities = 46/73 (63%), Positives = 51/73 (69%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IPVIA  NTDSPL ++DIAIPCN KS+HSIGLMWW              R   W VVVDL
Sbjct: 142 IPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVDL 201

Query: 437 FFYRDPEESEKDE 475
           FFYRDPEE+EK+E
Sbjct: 202 FFYRDPEEAEKEE 214


>AE014298-223|AAN09050.2|  313|Drosophila melanogaster CG14792-PD,
           isoform D protein.
          Length = 313

 Score =  138 bits (333), Expect = 5e-33
 Identities = 66/84 (78%), Positives = 72/84 (85%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL LAARA+VAI+NP+D+FVISSR  GQRAVLKFA +T  TPIAGRFTPGAFTNQIQ AF
Sbjct: 100 KLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAF 159

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLL+V DP   HQPI EASYV
Sbjct: 160 REPRLLVVTDPNTDHQPIMEASYV 183



 Score =  103 bits (246), Expect = 2e-22
 Identities = 46/73 (63%), Positives = 51/73 (69%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IPVIA  NTDSPL ++DIAIPCN KS+HSIGLMWW              R   W VVVDL
Sbjct: 185 IPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVDL 244

Query: 437 FFYRDPEESEKDE 475
           FFYRDPEE+EK+E
Sbjct: 245 FFYRDPEEAEKEE 257


>BT012492-1|AAS93763.1|  301|Drosophila melanogaster LD03460p
           protein.
          Length = 301

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 16/49 (32%), Positives = 20/49 (40%)
 Frame = +2

Query: 8   CSGCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHRCYAYCGTFHTRC 154
           CS CS C+S      C R L    R+ C T  C+   C       H +C
Sbjct: 210 CSCCSSCQSTERCTICGRSLTLSNRNPCDTPGCKGVYCGKCFEKSHNKC 258


>BT003264-1|AAO25021.1|  334|Drosophila melanogaster LD22345p
           protein.
          Length = 334

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 16/49 (32%), Positives = 20/49 (40%)
 Frame = +2

Query: 8   CSGCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHRCYAYCGTFHTRC 154
           CS CS C+S      C R L    R+ C T  C+   C       H +C
Sbjct: 243 CSCCSSCQSTERCTICGRSLTLSNRNPCDTPGCKGVYCGKCFEKSHNKC 291


>AY051619-1|AAK93043.1|  334|Drosophila melanogaster GH26634p
           protein.
          Length = 334

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 16/49 (32%), Positives = 20/49 (40%)
 Frame = +2

Query: 8   CSGCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHRCYAYCGTFHTRC 154
           CS CS C+S      C R L    R+ C T  C+   C       H +C
Sbjct: 243 CSCCSSCQSTERCTICGRSLTLSNRNPCDTPGCKGVYCGKCFEKSHNKC 291


>AE014296-14|AAS64919.1|  334|Drosophila melanogaster CG6845-PB,
           isoform B protein.
          Length = 334

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 16/49 (32%), Positives = 20/49 (40%)
 Frame = +2

Query: 8   CSGCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHRCYAYCGTFHTRC 154
           CS CS C+S      C R L    R+ C T  C+   C       H +C
Sbjct: 243 CSCCSSCQSTERCTICGRSLTLSNRNPCDTPGCKGVYCGKCFEKSHNKC 291


>AE014296-13|AAF47333.2|  480|Drosophila melanogaster CG6845-PA,
           isoform A protein.
          Length = 480

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 16/49 (32%), Positives = 20/49 (40%)
 Frame = +2

Query: 8   CSGCSCCRSHREPR*CVRHLITXLRSACCTEVCRXHRCYAYCGTFHTRC 154
           CS CS C+S      C R L    R+ C T  C+   C       H +C
Sbjct: 389 CSCCSSCQSTERCTICGRSLTLSNRNPCDTPGCKGVYCGKCFEKSHNKC 437


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,687,021
Number of Sequences: 53049
Number of extensions: 431697
Number of successful extensions: 903
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 885
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 903
length of database: 24,988,368
effective HSP length: 79
effective length of database: 20,797,497
effective search space used: 1684597257
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -