SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30125.Seq
         (682 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY061163-1|AAL28711.1|  248|Drosophila melanogaster LD12946p pro...   133   2e-31
AE014298-2270|AAF48534.1|  248|Drosophila melanogaster CG9066-PA...   133   2e-31
BT022626-1|AAY55042.1|  192|Drosophila melanogaster IP06960p pro...    74   2e-13
AE014134-2348|AAF53300.1|  192|Drosophila melanogaster CG16957-P...    74   2e-13
AY069225-1|AAL39370.1|  287|Drosophila melanogaster GH27237p pro...    53   3e-07
AE014298-1296|AAF46459.1|  287|Drosophila melanogaster CG12056-P...    53   3e-07
BT011566-1|AAS15702.1|  221|Drosophila melanogaster AT07779p pro...    40   0.004
AE014134-2217|AAN10818.1|  216|Drosophila melanogaster CG31858-P...    39   0.006
BT022339-1|AAY54755.1|  195|Drosophila melanogaster IP08319p pro...    38   0.010
AE014134-305|AAF51335.3|  201|Drosophila melanogaster CG15623-PA...    38   0.010
BT001332-1|AAN71087.1|  886|Drosophila melanogaster AT18855p pro...    32   0.83 
AE014297-980|AAF54409.1|  874|Drosophila melanogaster CG8273-PA ...    32   0.83 
AY118833-1|AAM50693.1|  489|Drosophila melanogaster GM01981p pro...    31   1.1  
X15087-1|CAA33195.1|  883|Drosophila melanogaster protein ( Dros...    31   1.9  
M37083-1|AAA28494.1|  883|Drosophila melanogaster E74B protein p...    31   1.9  
BT003745-1|AAO41406.1|  883|Drosophila melanogaster SD03570p pro...    31   1.9  
AE014296-2936|AAX52740.1|  883|Drosophila melanogaster CG32180-P...    31   1.9  
AE014296-2935|AAF49324.1|  883|Drosophila melanogaster CG32180-P...    31   1.9  
AE014134-309|AAF51330.1|  305|Drosophila melanogaster CG7295-PA ...    31   1.9  
AY113235-1|AAM29240.1|  305|Drosophila melanogaster AT11443p pro...    29   4.5  
DQ231608-1|ABA71714.1|  415|Drosophila melanogaster male accesso...    29   5.9  
AE014134-758|ABI31286.1|  415|Drosophila melanogaster CG34102-PA...    29   5.9  

>AY061163-1|AAL28711.1|  248|Drosophila melanogaster LD12946p
           protein.
          Length = 248

 Score =  133 bits (321), Expect = 2e-31
 Identities = 61/89 (68%), Positives = 74/89 (83%), Gaps = 1/89 (1%)
 Frame = +3

Query: 243 IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           I +  T  ELRQYDGTQ  GRVL+AVNG ++DV++G RFYGPGGPYA F GRDA+R LAT
Sbjct: 79  IRRDFTVKELRQYDGTQPDGRVLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLAT 138

Query: 423 FSVTAPEKD-YDDLSDLNSMEMESVREWE 506
           FSV + +KD YDDLSDL+++EM+SVREWE
Sbjct: 139 FSVVSIDKDEYDDLSDLSAVEMDSVREWE 167



 Score = 49.6 bits (113), Expect = 4e-06
 Identities = 23/43 (53%), Positives = 31/43 (72%)
 Frame = +2

Query: 509 QFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSALPNDDKENQ 637
           QF+E Y+LVG+LLR GEEP NY D+E EE     + ND++E +
Sbjct: 169 QFKEKYELVGKLLRKGEEPTNYDDDEDEE----NVNNDEQERK 207


>AE014298-2270|AAF48534.1|  248|Drosophila melanogaster CG9066-PA
           protein.
          Length = 248

 Score =  133 bits (321), Expect = 2e-31
 Identities = 61/89 (68%), Positives = 74/89 (83%), Gaps = 1/89 (1%)
 Frame = +3

Query: 243 IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           I +  T  ELRQYDGTQ  GRVL+AVNG ++DV++G RFYGPGGPYA F GRDA+R LAT
Sbjct: 79  IRRDFTVKELRQYDGTQPDGRVLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLAT 138

Query: 423 FSVTAPEKD-YDDLSDLNSMEMESVREWE 506
           FSV + +KD YDDLSDL+++EM+SVREWE
Sbjct: 139 FSVVSIDKDEYDDLSDLSAVEMDSVREWE 167



 Score = 49.6 bits (113), Expect = 4e-06
 Identities = 23/43 (53%), Positives = 31/43 (72%)
 Frame = +2

Query: 509 QFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSALPNDDKENQ 637
           QF+E Y+LVG+LLR GEEP NY D+E EE     + ND++E +
Sbjct: 169 QFKEKYELVGKLLRKGEEPTNYDDDEDEE----NVNNDEQERK 207


>BT022626-1|AAY55042.1|  192|Drosophila melanogaster IP06960p
           protein.
          Length = 192

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 37/89 (41%), Positives = 55/89 (61%), Gaps = 1/89 (1%)
 Frame = +3

Query: 243 IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           + K  T  ELR+YDGT+  GR+L+A+   I+DV+R   +YG  G    + GRD +R L  
Sbjct: 69  LRKDFTVRELREYDGTRADGRILVAILFNIYDVSRSVHYYGRNGVNPNYAGRDISRILIN 128

Query: 423 FSVTAPE-KDYDDLSDLNSMEMESVREWE 506
                 + +D+DDLSDL+  +M ++REWE
Sbjct: 129 SPEDLKDSEDFDDLSDLSRNQMNTLREWE 157


>AE014134-2348|AAF53300.1|  192|Drosophila melanogaster CG16957-PA
           protein.
          Length = 192

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 37/89 (41%), Positives = 55/89 (61%), Gaps = 1/89 (1%)
 Frame = +3

Query: 243 IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           + K  T  ELR+YDGT+  GR+L+A+   I+DV+R   +YG  G    + GRD +R L  
Sbjct: 69  LRKDFTVRELREYDGTRADGRILVAILFNIYDVSRSVHYYGRNGVNPNYAGRDISRILIN 128

Query: 423 FSVTAPE-KDYDDLSDLNSMEMESVREWE 506
                 + +D+DDLSDL+  +M ++REWE
Sbjct: 129 SPEDLKDSEDFDDLSDLSRNQMNTLREWE 157


>AY069225-1|AAL39370.1|  287|Drosophila melanogaster GH27237p
           protein.
          Length = 287

 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 31/99 (31%), Positives = 51/99 (51%), Gaps = 2/99 (2%)
 Frame = +3

Query: 243 IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           I    T  EL +++G +EG  + +A+ G +FDV+RG + YG G  Y  F GRDA+    +
Sbjct: 60  IGTLFTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSFIS 119

Query: 423 --FSVTAPEKDYDDLSDLNSMEMESVREWEDNLERIMIW 533
             F    PE   DD+  L   ++  +  W D  ++  ++
Sbjct: 120 GDFETYDPE-TADDVLTLKPDDLIGLAGWRDFYQKDYVY 157


>AE014298-1296|AAF46459.1|  287|Drosophila melanogaster CG12056-PA
           protein.
          Length = 287

 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 31/99 (31%), Positives = 51/99 (51%), Gaps = 2/99 (2%)
 Frame = +3

Query: 243 IAKRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLAT 422
           I    T  EL +++G +EG  + +A+ G +FDV+RG + YG G  Y  F GRDA+    +
Sbjct: 60  IGTLFTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSFIS 119

Query: 423 --FSVTAPEKDYDDLSDLNSMEMESVREWEDNLERIMIW 533
             F    PE   DD+  L   ++  +  W D  ++  ++
Sbjct: 120 GDFETYDPE-TADDVLTLKPDDLIGLAGWRDFYQKDYVY 157


>BT011566-1|AAS15702.1|  221|Drosophila melanogaster AT07779p
           protein.
          Length = 221

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 26/89 (29%), Positives = 44/89 (49%)
 Frame = +3

Query: 252 RMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSV 431
           +++  +L  +DGT+  GR+L+A+ G I+DV+     +G  G  +   GRD T  L +   
Sbjct: 58  KLSLDQLLGFDGTRSDGRILVALRGKIYDVSSDFEEFGLTGTLSHVAGRDFTNYLKS--- 114

Query: 432 TAPEKDYDDLSDLNSMEMESVREWEDNLE 518
                    + D ++ E+  V  WE  LE
Sbjct: 115 ---------IMDTHNSEINYVDRWESILE 134


>AE014134-2217|AAN10818.1|  216|Drosophila melanogaster CG31858-PA
           protein.
          Length = 216

 Score = 39.1 bits (87), Expect = 0.006
 Identities = 26/84 (30%), Positives = 41/84 (48%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVTAPEK 446
           +L  +DGT+  GR+L+A+ G I+DV+     +G  G  +   GRD T  L +        
Sbjct: 63  QLLGFDGTRSDGRILVALRGKIYDVSSDFEEFGLTGTLSHVAGRDFTNYLKS-------- 114

Query: 447 DYDDLSDLNSMEMESVREWEDNLE 518
               + D ++ E+  V  WE  LE
Sbjct: 115 ----IMDTHNSEINYVDRWESILE 134


>BT022339-1|AAY54755.1|  195|Drosophila melanogaster IP08319p
           protein.
          Length = 195

 Score = 38.3 bits (85), Expect = 0.010
 Identities = 17/54 (31%), Positives = 30/54 (55%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGL 416
           +T  EL  +DG+     +  A+NG I+D++ G   +   GPY++  G +A + L
Sbjct: 80  LTLEELTAFDGSSPSLPIYTALNGLIYDLSPGREKFSSHGPYSLLAGCNANKVL 133


>AE014134-305|AAF51335.3|  201|Drosophila melanogaster CG15623-PA
           protein.
          Length = 201

 Score = 38.3 bits (85), Expect = 0.010
 Identities = 17/54 (31%), Positives = 30/54 (55%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGL 416
           +T  EL  +DG+     +  A+NG I+D++ G   +   GPY++  G +A + L
Sbjct: 86  LTLEELTAFDGSSPSLPIYTALNGLIYDLSPGREKFSSHGPYSLLAGCNANKVL 139


>BT001332-1|AAN71087.1|  886|Drosophila melanogaster AT18855p
           protein.
          Length = 886

 Score = 31.9 bits (69), Expect = 0.83
 Identities = 16/42 (38%), Positives = 21/42 (50%)
 Frame = -1

Query: 427 ENVASPLVASLPPKTAYGPPGP*NRFPLVTSNIHPFTAINTL 302
           +N+A P+ A   P      PGP    PLVT + HP   +N L
Sbjct: 779 KNMAGPIGAGPCPAVQGAGPGPLASTPLVTQDKHPVCVLNEL 820


>AE014297-980|AAF54409.1|  874|Drosophila melanogaster CG8273-PA
           protein.
          Length = 874

 Score = 31.9 bits (69), Expect = 0.83
 Identities = 16/42 (38%), Positives = 21/42 (50%)
 Frame = -1

Query: 427 ENVASPLVASLPPKTAYGPPGP*NRFPLVTSNIHPFTAINTL 302
           +N+A P+ A   P      PGP    PLVT + HP   +N L
Sbjct: 767 KNMAGPIGAGPCPAVQGAGPGPLASTPLVTQDKHPVCVLNEL 808


>AY118833-1|AAM50693.1|  489|Drosophila melanogaster GM01981p
           protein.
          Length = 489

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 16/42 (38%), Positives = 21/42 (50%)
 Frame = -1

Query: 427 ENVASPLVASLPPKTAYGPPGP*NRFPLVTSNIHPFTAINTL 302
           +N+A P+ A   P      PGP    PLVT + HP   +N L
Sbjct: 382 KNMAGPIGAGPCPAVQGAGPGPVAPTPLVTQDKHPVCVLNEL 423


>X15087-1|CAA33195.1|  883|Drosophila melanogaster protein (
           Drosophila melanogaster74E gene. ).
          Length = 883

 Score = 30.7 bits (66), Expect = 1.9
 Identities = 17/41 (41%), Positives = 21/41 (51%)
 Frame = -1

Query: 493 TDSISIELRSLKSS*SFSGAVTENVASPLVASLPPKTAYGP 371
           + S S+ L S  SS S S A    VASP+  + PP  A  P
Sbjct: 36  SSSSSLSLSSSSSSSSLSSATPTPVASPVTPTSPPPAAAAP 76


>M37083-1|AAA28494.1|  883|Drosophila melanogaster E74B protein
           protein.
          Length = 883

 Score = 30.7 bits (66), Expect = 1.9
 Identities = 17/41 (41%), Positives = 21/41 (51%)
 Frame = -1

Query: 493 TDSISIELRSLKSS*SFSGAVTENVASPLVASLPPKTAYGP 371
           + S S+ L S  SS S S A    VASP+  + PP  A  P
Sbjct: 36  SSSSSLSLSSSSSSSSLSSATPTPVASPVTPTSPPPAAAAP 76


>BT003745-1|AAO41406.1|  883|Drosophila melanogaster SD03570p
           protein.
          Length = 883

 Score = 30.7 bits (66), Expect = 1.9
 Identities = 17/41 (41%), Positives = 21/41 (51%)
 Frame = -1

Query: 493 TDSISIELRSLKSS*SFSGAVTENVASPLVASLPPKTAYGP 371
           + S S+ L S  SS S S A    VASP+  + PP  A  P
Sbjct: 36  SSSSSLSLSSSSSSSSLSSATPTPVASPVTPTSPPPAAAAP 76


>AE014296-2936|AAX52740.1|  883|Drosophila melanogaster CG32180-PD,
           isoform D protein.
          Length = 883

 Score = 30.7 bits (66), Expect = 1.9
 Identities = 17/41 (41%), Positives = 21/41 (51%)
 Frame = -1

Query: 493 TDSISIELRSLKSS*SFSGAVTENVASPLVASLPPKTAYGP 371
           + S S+ L S  SS S S A    VASP+  + PP  A  P
Sbjct: 36  SSSSSLSLSSSSSSSSLSSATPTPVASPVTPTSPPPAAAAP 76


>AE014296-2935|AAF49324.1|  883|Drosophila melanogaster CG32180-PB,
           isoform B protein.
          Length = 883

 Score = 30.7 bits (66), Expect = 1.9
 Identities = 17/41 (41%), Positives = 21/41 (51%)
 Frame = -1

Query: 493 TDSISIELRSLKSS*SFSGAVTENVASPLVASLPPKTAYGP 371
           + S S+ L S  SS S S A    VASP+  + PP  A  P
Sbjct: 36  SSSSSLSLSSSSSSSSLSSATPTPVASPVTPTSPPPAAAAP 76


>AE014134-309|AAF51330.1|  305|Drosophila melanogaster CG7295-PA
           protein.
          Length = 305

 Score = 30.7 bits (66), Expect = 1.9
 Identities = 14/50 (28%), Positives = 25/50 (50%)
 Frame = +3

Query: 252 RMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRD 401
           R+   +L +Y+        L+A++  IFDV+     +GPGG +    G +
Sbjct: 66  RLNRKQLAKYNSAHPDKIYLVALHEVIFDVSSAEHIFGPGGEHDKLTGTE 115


>AY113235-1|AAM29240.1|  305|Drosophila melanogaster AT11443p
           protein.
          Length = 305

 Score = 29.5 bits (63), Expect = 4.5
 Identities = 13/45 (28%), Positives = 23/45 (51%)
 Frame = +3

Query: 267 ELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRD 401
           +L +Y+        L+A++  IFDV+     +GPGG +    G +
Sbjct: 71  QLAKYNSAHPDKIYLVALHEVIFDVSSAEHIFGPGGEHEKLTGTE 115


>DQ231608-1|ABA71714.1|  415|Drosophila melanogaster male accessory
           gland protein protein.
          Length = 415

 Score = 29.1 bits (62), Expect = 5.9
 Identities = 15/40 (37%), Positives = 20/40 (50%)
 Frame = -1

Query: 415 SPLVASLPPKTAYGPPGP*NRFPLVTSNIHPFTAINTLPP 296
           SP  +S PP    GPPGP N   L ++N   +     +PP
Sbjct: 257 SPPGSSFPPSPQSGPPGPPNWNQLESANRPVYPPEMPIPP 296


>AE014134-758|ABI31286.1|  415|Drosophila melanogaster CG34102-PA
           protein.
          Length = 415

 Score = 29.1 bits (62), Expect = 5.9
 Identities = 15/40 (37%), Positives = 20/40 (50%)
 Frame = -1

Query: 415 SPLVASLPPKTAYGPPGP*NRFPLVTSNIHPFTAINTLPP 296
           SP  +S PP    GPPGP N   L ++N   +     +PP
Sbjct: 257 SPPGSSFPPSPQSGPPGPPNWNQLESANRPVYPPEMPIPP 296


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,664,963
Number of Sequences: 53049
Number of extensions: 695726
Number of successful extensions: 2578
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 2352
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2574
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2971922400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -