SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30123.Seq
         (694 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT003242-1|AAO24999.1|  447|Drosophila melanogaster LD43681p pro...   151   1e-36
AE013599-2892|AAF57556.1|  456|Drosophila melanogaster CG9277-PA...   151   1e-36
AE013599-2891|AAF57555.1|  447|Drosophila melanogaster CG9277-PB...   151   1e-36
M20419-1|AAA28989.1|  447|Drosophila melanogaster protein ( D.me...   149   4e-36
AY118725-1|AAM50585.1|  446|Drosophila melanogaster GH02051p pro...   146   3e-35
AE014297-930|AAF54373.1|  446|Drosophila melanogaster CG9359-PA ...   146   3e-35
M20420-1|AAA28991.1|  446|Drosophila melanogaster protein ( D.me...   144   8e-35
AY118611-1|AAM49980.1|  457|Drosophila melanogaster LP10436p pro...   140   1e-33
AE014297-4213|AAF56770.2|  522|Drosophila melanogaster CG4869-PA...   140   1e-33
X16826-1|CAA34726.1|  435|Drosophila melanogaster 60C beta tubul...   137   1e-32
M22335-1|AAA28993.1|  454|Drosophila melanogaster protein ( D.me...   137   1e-32
BT015991-1|AAV36876.1|  454|Drosophila melanogaster RE53159p pro...   137   1e-32
AE013599-3851|AAF47193.2|  454|Drosophila melanogaster CG3401-PA...   137   1e-32
AE013599-2894|AAN16132.2|  375|Drosophila melanogaster CG9277-PD...    97   2e-20
AE013599-2893|AAN16133.1|  375|Drosophila melanogaster CG9277-PC...    97   2e-20
M14645-1|AAA28987.1|  450|Drosophila melanogaster protein ( D.me...    88   1e-17
M14643-1|AAA28985.1|  450|Drosophila melanogaster protein ( D.me...    88   1e-17
BT016118-1|AAV37003.1|  450|Drosophila melanogaster LD07757p pro...    88   1e-17
BT012506-1|AAS93777.1|  450|Drosophila melanogaster AT25469p pro...    88   1e-17
BT003630-1|AAO39634.1|  450|Drosophila melanogaster AT26363p pro...    88   1e-17
AY084208-1|AAL89946.1|  450|Drosophila melanogaster SD07763p pro...    88   1e-17
AE014297-627|AAN13341.1|  450|Drosophila melanogaster CG2512-PB,...    88   1e-17
AE014297-626|AAF54007.1|  450|Drosophila melanogaster CG2512-PA,...    88   1e-17
AE014297-554|AAF54067.1|  450|Drosophila melanogaster CG1913-PA ...    88   1e-17
M14644-1|AAA28986.1|  449|Drosophila melanogaster protein ( D.me...    87   3e-17
AY113631-1|AAM29636.1|  449|Drosophila melanogaster RH71862p pro...    87   3e-17
AE014297-1015|AAF54433.1|  449|Drosophila melanogaster CG9476-PA...    87   3e-17
AY089468-1|AAL90206.1|  462|Drosophila melanogaster AT27896p pro...    77   2e-14
AE014296-1121|AAF50659.1|  462|Drosophila melanogaster CG32396-P...    77   2e-14
BT011034-1|AAR30194.1|  240|Drosophila melanogaster RE44641p pro...    69   5e-12
M61765-1|AAA28597.1|  475|Drosophila melanogaster gamma-tubulin ...    66   4e-11
M14646-1|AAA28988.1|  462|Drosophila melanogaster protein ( D.me...    66   4e-11
AY069633-1|AAL39778.1|  475|Drosophila melanogaster LD40196p pro...    66   4e-11
AF073994-1|AAC27620.1|  333|Drosophila melanogaster gamma-tubuli...    66   4e-11
AE014296-1707|AAF50226.2|  462|Drosophila melanogaster CG8308-PA...    66   4e-11
AE014134-523|AAF51174.1|  475|Drosophila melanogaster CG3157-PA ...    66   4e-11
M76765-1|AAB52553.1|  457|Drosophila melanogaster gamma-tubulin ...    64   2e-10
AY070558-1|AAL48029.1|  457|Drosophila melanogaster LD32755p pro...    64   2e-10
AJ010552-1|CAA09233.1|  457|Drosophila melanogaster gamma-tubuli...    64   2e-10
AF091265-1|AAC64117.1|  457|Drosophila melanogaster gamma-tubuli...    64   2e-10
AF081253-1|AAC35844.1|  351|Drosophila melanogaster gamma-tubuli...    64   2e-10
AF081252-1|AAC35843.1|  457|Drosophila melanogaster gamma-tubuli...    64   2e-10
AE014134-3061|AAF53774.1|  457|Drosophila melanogaster CG17566-P...    64   2e-10
AY089253-1|AAL89991.1|  455|Drosophila melanogaster AT04270p pro...    57   3e-08
AE014297-2432|AAF55488.1|  455|Drosophila melanogaster CG7794-PA...    57   3e-08
S60740-1|AAD13917.1|   25|Drosophila melanogaster beta 3 tubulin...    44   2e-04
X16825-1|CAA34725.1|   19|Drosophila melanogaster protein ( Dros...    36   0.052
BT009977-1|AAQ22446.1| 1287|Drosophila melanogaster RE56428p pro...    32   0.64 
AJ249606-1|CAB56505.1| 1287|Drosophila melanogaster NPC1 protein...    32   0.64 
AE014134-1780|AAF52874.2| 1287|Drosophila melanogaster CG5722-PA...    32   0.64 
AY094788-1|AAM11141.1| 1521|Drosophila melanogaster LD15253p pro...    29   4.5  
AF221715-1|AAF34661.1| 5554|Drosophila melanogaster split ends l...    29   4.5  
AF188205-1|AAF13218.1| 5533|Drosophila melanogaster Spen RNP mot...    29   4.5  
AF184612-1|AAF26299.1| 5476|Drosophila melanogaster split ends p...    29   4.5  
AE014134-58|AAN10511.1| 5476|Drosophila melanogaster CG18497-PC,...    29   4.5  
AE014134-57|AAF51534.2| 5533|Drosophila melanogaster CG18497-PB,...    29   4.5  
AE014134-56|AAF51535.2| 5560|Drosophila melanogaster CG18497-PA,...    29   4.5  
AE014296-2034|AAF50006.2| 2523|Drosophila melanogaster CG32092-P...    29   6.0  

>BT003242-1|AAO24999.1|  447|Drosophila melanogaster LD43681p
           protein.
          Length = 447

 Score =  151 bits (365), Expect = 1e-36
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEAS GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   +     P+    VVEPYN TL
Sbjct: 163 IMNTYSVVPSPKVSDTVVEPYNATL 187



 Score = 81.4 bits (192), Expect = 1e-15
 Identities = 32/42 (76%), Positives = 37/42 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWE+ISDEHGID +G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEIISDEHGIDATGAYHGDSDL 42



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ T+SV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSD 177


>AE013599-2892|AAF57556.1|  456|Drosophila melanogaster CG9277-PA,
           isoform A protein.
          Length = 456

 Score =  151 bits (365), Expect = 1e-36
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEAS GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 52  QLERINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 111

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 112 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 171

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   +     P+    VVEPYN TL
Sbjct: 172 IMNTYSVVPSPKVSDTVVEPYNATL 196



 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 19/23 (82%), Positives = 21/23 (91%)
 Frame = +1

Query: 187 FWEVISDEHGIDPSGCYHGDSDL 255
           FWE+ISDEHGID +G YHGDSDL
Sbjct: 29  FWEIISDEHGIDATGAYHGDSDL 51



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ T+SV PSP+VSD
Sbjct: 137 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSD 186


>AE013599-2891|AAF57555.1|  447|Drosophila melanogaster CG9277-PB,
           isoform B protein.
          Length = 447

 Score =  151 bits (365), Expect = 1e-36
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEAS GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   +     P+    VVEPYN TL
Sbjct: 163 IMNTYSVVPSPKVSDTVVEPYNATL 187



 Score = 81.4 bits (192), Expect = 1e-15
 Identities = 32/42 (76%), Positives = 37/42 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWE+ISDEHGID +G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEIISDEHGIDATGAYHGDSDL 42



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ T+SV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSD 177


>M20419-1|AAA28989.1|  447|Drosophila melanogaster protein (
           D.melanogaster beta-1 tubulin mRNA, complete cds. ).
          Length = 447

 Score =  149 bits (361), Expect = 4e-36
 Identities = 75/145 (51%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEAS GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
               +     P+    VVEPYN TL
Sbjct: 163 SMNTYSVVPSPKVSDTVVEPYNATL 187



 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 32/42 (76%), Positives = 37/42 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIG KFWE+ISDEHGID +G YHGDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEIISDEHGIDATGTYHGDSDL 42



 Score = 46.4 bits (105), Expect = 4e-05
 Identities = 22/50 (44%), Positives = 29/50 (58%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDR + T+SV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRSMNTYSVVPSPKVSD 177


>AY118725-1|AAM50585.1|  446|Drosophila melanogaster GH02051p
           protein.
          Length = 446

 Score =  146 bits (353), Expect = 3e-35
 Identities = 72/145 (49%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+  KYVPR +L+DL+P TMD+VRSG FG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGAKYVPRAILVDLEPGTMDSVRSGAFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E+EG    +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKESEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 77.8 bits (183), Expect = 1e-14
 Identities = 32/42 (76%), Positives = 37/42 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIGGKFWEVISDEH ID +G Y+GDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGGKFWEVISDEHCIDATGTYYGDSDL 42



 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 27/56 (48%), Positives = 33/56 (58%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S G DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 122 KESEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>AE014297-930|AAF54373.1|  446|Drosophila melanogaster CG9359-PA
           protein.
          Length = 446

 Score =  146 bits (353), Expect = 3e-35
 Identities = 72/145 (49%), Positives = 93/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+  KYVPR +L+DL+P TMD+VRSG FG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGAKYVPRAILVDLEPGTMDSVRSGAFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E+EG    +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKESEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 77.8 bits (183), Expect = 1e-14
 Identities = 32/42 (76%), Positives = 37/42 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIGGKFWEVISDEH ID +G Y+GDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGGKFWEVISDEHCIDATGTYYGDSDL 42



 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 27/56 (48%), Positives = 33/56 (58%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S G DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 122 KESEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>M20420-1|AAA28991.1|  446|Drosophila melanogaster protein (
           D.melanogaster beta-2 tubulin mRNA, complete cds. ).
          Length = 446

 Score =  144 bits (350), Expect = 8e-35
 Identities = 72/145 (49%), Positives = 92/145 (63%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+  KYVPR +L+DL+P TMD+VRSG FG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGAKYVPRAILVDLEPGTMDSVRSGAFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+E+EG    +    T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKESEGCDCLQGFQSTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 77.8 bits (183), Expect = 1e-14
 Identities = 32/42 (76%), Positives = 37/42 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+++Q G CGNQIGGKFWEVISDEH ID +G Y+GDSDL
Sbjct: 1   MREIVHIQAGQCGNQIGGKFWEVISDEHCIDATGTYYGDSDL 42



 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 27/56 (48%), Positives = 33/56 (58%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S G DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 122 KESEGCDCLQGFQSTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>AY118611-1|AAM49980.1|  457|Drosophila melanogaster LP10436p
           protein.
          Length = 457

 Score =  140 bits (340), Expect = 1e-33
 Identities = 72/145 (49%), Positives = 91/145 (62%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           Q ERI+VYYNEAS+GKYVPR VLIDL+P TMD+VR  P G LFRPDNFVYGQ+ A NNWA
Sbjct: 43  QHERIDVYYNEASSGKYVPRAVLIDLEPGTMDSVRQSPVGQLFRPDNFVYGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S L+V+R+E+EG    +   +  +              +   +  P  
Sbjct: 103 KGHYTEGAELIDSVLEVLRKESEGCDCLQGFQLAHSLGGGTGSGLGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNSFSVVPSPKVSDTVVEPYNATL 187



 Score = 79.8 bits (188), Expect = 3e-15
 Identities = 32/42 (76%), Positives = 37/42 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWE+ISDEHGIDP+G YHG+S L
Sbjct: 1   MREIVHLQAGQCGNQIGSKFWEIISDEHGIDPNGYYHGESAL 42



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 26/56 (46%), Positives = 33/56 (58%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S G DCLQ F+                 +++IREEYPDRI+ +FSV PSP+VSD
Sbjct: 122 KESEGCDCLQGFQLAHSLGGGTGSGLGTLLISKIREEYPDRIMNSFSVVPSPKVSD 177


>AE014297-4213|AAF56770.2|  522|Drosophila melanogaster CG4869-PA
           protein.
          Length = 522

 Score =  140 bits (340), Expect = 1e-33
 Identities = 72/145 (49%), Positives = 91/145 (62%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           Q ERI+VYYNEAS+GKYVPR VLIDL+P TMD+VR  P G LFRPDNFVYGQ+ A NNWA
Sbjct: 43  QHERIDVYYNEASSGKYVPRAVLIDLEPGTMDSVRQSPVGQLFRPDNFVYGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S L+V+R+E+EG    +   +  +              +   +  P  
Sbjct: 103 KGHYTEGAELIDSVLEVLRKESEGCDCLQGFQLAHSLGGGTGSGLGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNSFSVVPSPKVSDTVVEPYNATL 187



 Score = 79.8 bits (188), Expect = 3e-15
 Identities = 32/42 (76%), Positives = 37/42 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWE+ISDEHGIDP+G YHG+S L
Sbjct: 1   MREIVHLQAGQCGNQIGSKFWEIISDEHGIDPNGYYHGESAL 42



 Score = 51.6 bits (118), Expect = 1e-06
 Identities = 26/56 (46%), Positives = 33/56 (58%)
 Frame = +2

Query: 491 KGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           K S G DCLQ F+                 +++IREEYPDRI+ +FSV PSP+VSD
Sbjct: 122 KESEGCDCLQGFQLAHSLGGGTGSGLGTLLISKIREEYPDRIMNSFSVVPSPKVSD 177


>X16826-1|CAA34726.1|  435|Drosophila melanogaster 60C beta tubulin
           protein.
          Length = 435

 Score =  137 bits (332), Expect = 1e-32
 Identities = 71/151 (47%), Positives = 94/151 (62%), Gaps = 6/151 (3%)
 Frame = +3

Query: 255 QLERINVYYNEASA------GKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNC 416
           QLER++VYYNEASA      GKYVPR +L+DL+P TM++VRSGP+G LFRPDNFVYGQ+ 
Sbjct: 24  QLERVSVYYNEASAVTRSSGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSG 83

Query: 417 AANNWAKGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYA 596
           A NNWAKGHYTEG E++++ LDV+R+E E     +   +T +              +   
Sbjct: 84  AGNNWAKGHYTEGAELVDNVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIR 143

Query: 597 KSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
           +  P  +   +     P+    VVEPYN TL
Sbjct: 144 EEYPDRIMNTYSVVPSPKVSDTVVEPYNATL 174



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ T+SV PSP+VSD
Sbjct: 115 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSD 164



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 17/23 (73%), Positives = 20/23 (86%)
 Frame = +1

Query: 187 FWEVISDEHGIDPSGCYHGDSDL 255
           FWE+IS+EHGID +G Y GDSDL
Sbjct: 1   FWEIISEEHGIDSNGIYVGDSDL 23


>M22335-1|AAA28993.1|  454|Drosophila melanogaster protein (
           D.melanogaster beta-3 tubulin gene, exons 2, 3 and 4. ).
          Length = 454

 Score =  137 bits (332), Expect = 1e-32
 Identities = 71/151 (47%), Positives = 94/151 (62%), Gaps = 6/151 (3%)
 Frame = +3

Query: 255 QLERINVYYNEASA------GKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNC 416
           QLER++VYYNEASA      GKYVPR +L+DL+P TM++VRSGP+G LFRPDNFVYGQ+ 
Sbjct: 43  QLERVSVYYNEASAVTRSSGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSG 102

Query: 417 AANNWAKGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYA 596
           A NNWAKGHYTEG E++++ LDV+R+E E     +   +T +              +   
Sbjct: 103 AGNNWAKGHYTEGAELVDNVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIR 162

Query: 597 KSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
           +  P  +   +     P+    VVEPYN TL
Sbjct: 163 EEYPDRIMNTYSVVPSPKVSDTVVEPYNATL 193



 Score = 75.8 bits (178), Expect = 5e-14
 Identities = 31/42 (73%), Positives = 36/42 (85%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWE+IS+EHGID +G Y GDSDL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEIISEEHGIDSNGIYVGDSDL 42



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ T+SV PSP+VSD
Sbjct: 134 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSD 183


>BT015991-1|AAV36876.1|  454|Drosophila melanogaster RE53159p
           protein.
          Length = 454

 Score =  137 bits (332), Expect = 1e-32
 Identities = 71/151 (47%), Positives = 94/151 (62%), Gaps = 6/151 (3%)
 Frame = +3

Query: 255 QLERINVYYNEASA------GKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNC 416
           QLER++VYYNEASA      GKYVPR +L+DL+P TM++VRSGP+G LFRPDNFVYGQ+ 
Sbjct: 43  QLERVSVYYNEASAVTRSSGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSG 102

Query: 417 AANNWAKGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYA 596
           A NNWAKGHYTEG E++++ LDV+R+E E     +   +T +              +   
Sbjct: 103 AGNNWAKGHYTEGAELVDNVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIR 162

Query: 597 KSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
           +  P  +   +     P+    VVEPYN TL
Sbjct: 163 EEYPDRIMNTYSVVPSPKVSDTVVEPYNATL 193



 Score = 77.8 bits (183), Expect = 1e-14
 Identities = 32/42 (76%), Positives = 36/42 (85%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+NLQ G CGNQIG KFWE+IS+EHGID +G Y GDSDL
Sbjct: 1   MREIVNLQAGQCGNQIGAKFWEIISEEHGIDSNGIYVGDSDL 42



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ T+SV PSP+VSD
Sbjct: 134 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSD 183


>AE013599-3851|AAF47193.2|  454|Drosophila melanogaster CG3401-PA
           protein.
          Length = 454

 Score =  137 bits (332), Expect = 1e-32
 Identities = 71/151 (47%), Positives = 94/151 (62%), Gaps = 6/151 (3%)
 Frame = +3

Query: 255 QLERINVYYNEASA------GKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNC 416
           QLER++VYYNEASA      GKYVPR +L+DL+P TM++VRSGP+G LFRPDNFVYGQ+ 
Sbjct: 43  QLERVSVYYNEASAVTRSSGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSG 102

Query: 417 AANNWAKGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYA 596
           A NNWAKGHYTEG E++++ LDV+R+E E     +   +T +              +   
Sbjct: 103 AGNNWAKGHYTEGAELVDNVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIR 162

Query: 597 KSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
           +  P  +   +     P+    VVEPYN TL
Sbjct: 163 EEYPDRIMNTYSVVPSPKVSDTVVEPYNATL 193



 Score = 77.8 bits (183), Expect = 1e-14
 Identities = 32/42 (76%), Positives = 36/42 (85%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI+NLQ G CGNQIG KFWE+IS+EHGID +G Y GDSDL
Sbjct: 1   MREIVNLQAGQCGNQIGAKFWEIISEEHGIDSNGIYVGDSDL 42



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ T+SV PSP+VSD
Sbjct: 134 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSD 183


>AE013599-2894|AAN16132.2|  375|Drosophila melanogaster CG9277-PD,
           isoform D protein.
          Length = 375

 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 50/115 (43%), Positives = 67/115 (58%)
 Frame = +3

Query: 345 MDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAEGWIACKF 524
           MD+VRSGPFG +FRPDNFV+GQ+ A NNWAKGHYTEG E+++S LDV+R+EAE     + 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG 60

Query: 525 SDVTLARWRYRFRIRYATS*TGYAKSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
             +T +              +   +  P  +   +     P+    VVEPYN TL
Sbjct: 61  FQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATL 115



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ T+SV PSP+VSD
Sbjct: 56  DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSD 105


>AE013599-2893|AAN16133.1|  375|Drosophila melanogaster CG9277-PC,
           isoform C protein.
          Length = 375

 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 50/115 (43%), Positives = 67/115 (58%)
 Frame = +3

Query: 345 MDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAEGWIACKF 524
           MD+VRSGPFG +FRPDNFV+GQ+ A NNWAKGHYTEG E+++S LDV+R+EAE     + 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG 60

Query: 525 SDVTLARWRYRFRIRYATS*TGYAKSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
             +T +              +   +  P  +   +     P+    VVEPYN TL
Sbjct: 61  FQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATL 115



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ T+SV PSP+VSD
Sbjct: 56  DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSD 105


>M14645-1|AAA28987.1|  450|Drosophila melanogaster protein (
           D.melanogaster alpha-tubulin gene (alpha-3), complete
           cds. ).
          Length = 450

 Score = 87.8 bits (208), Expect = 1e-17
 Identities = 54/150 (36%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FAVYPAPQVSTAVVEPYNSIL 189



 Score = 41.9 bits (94), Expect = 8e-04
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNT 51


>M14643-1|AAA28985.1|  450|Drosophila melanogaster protein (
           D.melanogaster alpha-tubulin gene (alpha-1), complete
           cds. ).
          Length = 450

 Score = 87.8 bits (208), Expect = 1e-17
 Identities = 54/150 (36%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FAIYPAPQVSTAVVEPYNSIL 189



 Score = 41.9 bits (94), Expect = 8e-04
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNT 51


>BT016118-1|AAV37003.1|  450|Drosophila melanogaster LD07757p
           protein.
          Length = 450

 Score = 87.8 bits (208), Expect = 1e-17
 Identities = 54/150 (36%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FAVYPAPQVSTAVVEPYNSIL 189



 Score = 41.9 bits (94), Expect = 8e-04
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNT 51


>BT012506-1|AAS93777.1|  450|Drosophila melanogaster AT25469p
           protein.
          Length = 450

 Score = 87.8 bits (208), Expect = 1e-17
 Identities = 54/150 (36%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FAIYPAPQVSTAVVEPYNSIL 189



 Score = 41.9 bits (94), Expect = 8e-04
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNT 51


>BT003630-1|AAO39634.1|  450|Drosophila melanogaster AT26363p
           protein.
          Length = 450

 Score = 87.8 bits (208), Expect = 1e-17
 Identities = 54/150 (36%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FAVYPAPQVSTAVVEPYNSIL 189



 Score = 41.9 bits (94), Expect = 8e-04
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNT 51


>AY084208-1|AAL89946.1|  450|Drosophila melanogaster SD07763p
           protein.
          Length = 450

 Score = 87.8 bits (208), Expect = 1e-17
 Identities = 54/150 (36%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FAVYPAPQVSTAVVEPYNSIL 189



 Score = 41.9 bits (94), Expect = 8e-04
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNT 51


>AE014297-627|AAN13341.1|  450|Drosophila melanogaster CG2512-PB,
           isoform B protein.
          Length = 450

 Score = 87.8 bits (208), Expect = 1e-17
 Identities = 54/150 (36%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FAVYPAPQVSTAVVEPYNSIL 189



 Score = 41.9 bits (94), Expect = 8e-04
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNT 51


>AE014297-626|AAF54007.1|  450|Drosophila melanogaster CG2512-PA,
           isoform A protein.
          Length = 450

 Score = 87.8 bits (208), Expect = 1e-17
 Identities = 54/150 (36%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FAVYPAPQVSTAVVEPYNSIL 189



 Score = 41.9 bits (94), Expect = 8e-04
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNT 51


>AE014297-554|AAF54067.1|  450|Drosophila melanogaster CG1913-PA
           protein.
          Length = 450

 Score = 87.8 bits (208), Expect = 1e-17
 Identities = 54/150 (36%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FAIYPAPQVSTAVVEPYNSIL 189



 Score = 41.9 bits (94), Expect = 8e-04
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNT 51


>M14644-1|AAA28986.1|  449|Drosophila melanogaster protein (
           D.melanogaster alpha-tubulin gene (alpha-2), complete
           cds. ).
          Length = 449

 Score = 86.6 bits (205), Expect = 3e-17
 Identities = 52/150 (34%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  + +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFSTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIVDVVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 19/51 (37%), Positives = 26/51 (50%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ +G  G QIG   WE+   EHGI P G    D  +     + +T
Sbjct: 1   MRECISVHIGQAGVQIGNACWELYCLEHGIQPDGHMPSDKTVGGGDDSFST 51


>AY113631-1|AAM29636.1|  449|Drosophila melanogaster RH71862p
           protein.
          Length = 449

 Score = 86.6 bits (205), Expect = 3e-17
 Identities = 52/150 (34%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  + +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFSTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIVDVVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 19/51 (37%), Positives = 26/51 (50%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ +G  G QIG   WE+   EHGI P G    D  +     + +T
Sbjct: 1   MRECISVHIGQAGVQIGNACWELYCLEHGIQPDGHMPSDKTVGGGDDSFST 51


>AE014297-1015|AAF54433.1|  449|Drosophila melanogaster CG9476-PA
           protein.
          Length = 449

 Score = 86.6 bits (205), Expect = 3e-17
 Identities = 52/150 (34%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  + +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFSTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIVDVVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FSIYPAPQVSTAVVEPYNSIL 189



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 19/51 (37%), Positives = 26/51 (50%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ +G  G QIG   WE+   EHGI P G    D  +     + +T
Sbjct: 1   MRECISVHIGQAGVQIGNACWELYCLEHGIQPDGHMPSDKTVGGGDDSFST 51


>AY089468-1|AAL90206.1|  462|Drosophila melanogaster AT27896p
           protein.
          Length = 462

 Score = 77.4 bits (182), Expect = 2e-14
 Identities = 35/83 (42%), Positives = 56/83 (67%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINV++N  ++ ++  RT+LID + +T+  + +     L+RP+NFV G   A NN+A
Sbjct: 44  QLERINVFFNATASKRFYARTILIDTEASTIQRLNAS--SQLYRPENFVAGSESAGNNFA 101

Query: 435 KGHYTEGVEILESALDVIRREAE 503
           +G++T+G  IL+  L+  RRE E
Sbjct: 102 RGYHTDGAAILDQVLENTRREVE 124



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 1/43 (2%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGID-PSGCYHGDSDL 255
           MREI+ LQ+G  GN IG  FW VIS EHG+D  SG + G S L
Sbjct: 1   MREIVTLQIGGAGNAIGDSFWHVISHEHGVDYASGRFGGTSPL 43


>AE014296-1121|AAF50659.1|  462|Drosophila melanogaster CG32396-PA
           protein.
          Length = 462

 Score = 77.4 bits (182), Expect = 2e-14
 Identities = 35/83 (42%), Positives = 56/83 (67%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINV++N  ++ ++  RT+LID + +T+  + +     L+RP+NFV G   A NN+A
Sbjct: 44  QLERINVFFNATASKRFYARTILIDTEASTIQRLNAS--SQLYRPENFVAGSESAGNNFA 101

Query: 435 KGHYTEGVEILESALDVIRREAE 503
           +G++T+G  IL+  L+  RRE E
Sbjct: 102 RGYHTDGAAILDQVLENTRREVE 124



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 1/43 (2%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGID-PSGCYHGDSDL 255
           MREI+ LQ+G  GN IG  FW VIS EHG+D  SG + G S L
Sbjct: 1   MREIVTLQIGGAGNAIGDSFWHVISHEHGVDYASGRFGGTSPL 43


>BT011034-1|AAR30194.1|  240|Drosophila melanogaster RE44641p
           protein.
          Length = 240

 Score = 69.3 bits (162), Expect = 5e-12
 Identities = 28/76 (36%), Positives = 49/76 (64%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEG 455
           ++ E   GK VPR++ +DL+P  +D VR+G  G L+ P+  + G+  AANN+A+G Y+ G
Sbjct: 63  FFTETGNGKQVPRSIFVDLEPTVIDDVRNGCMGELYHPEQLISGKEDAANNYARGRYSIG 122

Query: 456 VEILESALDVIRREAE 503
            E+++     +++ AE
Sbjct: 123 KEVIDRVTSRLQKIAE 138



 Score = 49.2 bits (112), Expect = 5e-06
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCT 279
           MRE++++Q+G CG QIG   WE+   EHGI+  G      +L + GS+ +
Sbjct: 1   MREVVSIQIGQCGIQIGNACWELYLLEHGINLDGSLKTKEELTASGSSAS 50


>M61765-1|AAA28597.1|  475|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 475

 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 30/85 (35%), Positives = 52/85 (61%), Gaps = 2/85 (2%)
 Frame = +3

Query: 258 LERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNW 431
           L+R +V++ +A    Y+PR VL+DL+P  ++ +    +  L+ P+N    ++   A NNW
Sbjct: 45  LDRKDVFFYQADDDHYIPRAVLLDLEPRVINTIMGSVYSKLYNPENVYLSKHGGGAGNNW 104

Query: 432 AKGHYTEGVEILESALDVIRREAEG 506
           A G Y++G ++ E   D+I REA+G
Sbjct: 105 ASG-YSQGEKLQEEVFDIIDREADG 128



 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 21/32 (65%), Positives = 25/32 (78%)
 Frame = +1

Query: 136 EIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           EII LQ+G CGNQIG +FW+ +  EHGI PSG
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPSG 35



 Score = 31.1 bits (67), Expect = 1.5
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPS-PRVSDL 661
           G D L+ F  CH+            + + R+ + YP ++I TFSVFP+   +SD+
Sbjct: 128 GSDSLEGFILCHS-IAGGTGSGMGSFIMERLADRYPKKLIQTFSVFPNQDEISDV 181


>M14646-1|AAA28988.1|  462|Drosophila melanogaster protein (
           D.melanogaster alpha-tubulin gene (alpha-4), complete
           cds. ).
          Length = 462

 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 27/76 (35%), Positives = 48/76 (63%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEG 455
           ++ E   GK VPR++ +DL+P  +D VR+G    L+ P+  + G+  AANN+A+G Y+ G
Sbjct: 63  FFTETGNGKQVPRSIFVDLEPTVIDDVRNGCMRELYHPEQLISGKEDAANNYARGRYSIG 122

Query: 456 VEILESALDVIRREAE 503
            E+++     +++ AE
Sbjct: 123 KEVIDRVTSRLQKIAE 138



 Score = 49.2 bits (112), Expect = 5e-06
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCT 279
           MRE++++Q+G CG QIG   WE+   EHGI+  G      +L + GS+ +
Sbjct: 1   MREVVSIQIGQCGIQIGNACWELYLLEHGINLDGSLKTKEELTASGSSAS 50


>AY069633-1|AAL39778.1|  475|Drosophila melanogaster LD40196p
           protein.
          Length = 475

 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 30/85 (35%), Positives = 52/85 (61%), Gaps = 2/85 (2%)
 Frame = +3

Query: 258 LERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNW 431
           L+R +V++ +A    Y+PR VL+DL+P  ++ +    +  L+ P+N    ++   A NNW
Sbjct: 45  LDRKDVFFYQADDDHYIPRAVLLDLEPRVINTIMGSVYSKLYNPENVYLSKHGGGAGNNW 104

Query: 432 AKGHYTEGVEILESALDVIRREAEG 506
           A G Y++G ++ E   D+I REA+G
Sbjct: 105 ASG-YSQGEKLQEEVFDIIDREADG 128



 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 21/32 (65%), Positives = 25/32 (78%)
 Frame = +1

Query: 136 EIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           EII LQ+G CGNQIG +FW+ +  EHGI PSG
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPSG 35



 Score = 31.1 bits (67), Expect = 1.5
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPS-PRVSDL 661
           G D L+ F  CH+            + + R+ + YP ++I TFSVFP+   +SD+
Sbjct: 128 GSDSLEGFILCHS-IAGGTGSGMGSFIMERLADRYPKKLIQTFSVFPNQDEISDV 181


>AF073994-1|AAC27620.1|  333|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 333

 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 30/85 (35%), Positives = 52/85 (61%), Gaps = 2/85 (2%)
 Frame = +3

Query: 258 LERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNW 431
           L+R +V++ +A    Y+PR VL+DL+P  ++ +    +  L+ P+N    ++   A NNW
Sbjct: 45  LDRKDVFFYQADDDHYIPRAVLLDLEPRVINTIMGSVYSKLYNPENVYLSKHGGGAGNNW 104

Query: 432 AKGHYTEGVEILESALDVIRREAEG 506
           A G Y++G ++ E   D+I REA+G
Sbjct: 105 ASG-YSQGEKLQEEVFDIIDREADG 128



 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 21/32 (65%), Positives = 25/32 (78%)
 Frame = +1

Query: 136 EIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           EII LQ+G CGNQIG +FW+ +  EHGI PSG
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPSG 35



 Score = 31.1 bits (67), Expect = 1.5
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPS-PRVSDL 661
           G D L+ F  CH+            + + R+ + YP ++I TFSVFP+   +SD+
Sbjct: 128 GSDSLEGFILCHS-IAGGTGSGMGSFIMERLADRYPKKLIQTFSVFPNQDEISDV 181


>AE014296-1707|AAF50226.2|  462|Drosophila melanogaster CG8308-PA
           protein.
          Length = 462

 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 27/76 (35%), Positives = 48/76 (63%)
 Frame = +3

Query: 276 YYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEG 455
           ++ E   GK VPR++ +DL+P  +D VR+G    L+ P+  + G+  AANN+A+G Y+ G
Sbjct: 63  FFTETGNGKQVPRSIFVDLEPTVIDDVRNGCMRELYHPEQLISGKEDAANNYARGRYSIG 122

Query: 456 VEILESALDVIRREAE 503
            E+++     +++ AE
Sbjct: 123 KEVIDRVTSRLQKIAE 138



 Score = 49.2 bits (112), Expect = 5e-06
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCT 279
           MRE++++Q+G CG QIG   WE+   EHGI+  G      +L + GS+ +
Sbjct: 1   MREVVSIQIGQCGIQIGNACWELYLLEHGINLDGSLKTKEELTASGSSAS 50


>AE014134-523|AAF51174.1|  475|Drosophila melanogaster CG3157-PA
           protein.
          Length = 475

 Score = 66.1 bits (154), Expect = 4e-11
 Identities = 30/85 (35%), Positives = 52/85 (61%), Gaps = 2/85 (2%)
 Frame = +3

Query: 258 LERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNW 431
           L+R +V++ +A    Y+PR VL+DL+P  ++ +    +  L+ P+N    ++   A NNW
Sbjct: 45  LDRKDVFFYQADDDHYIPRAVLLDLEPRVINTIMGSVYSKLYNPENVYLSKHGGGAGNNW 104

Query: 432 AKGHYTEGVEILESALDVIRREAEG 506
           A G Y++G ++ E   D+I REA+G
Sbjct: 105 ASG-YSQGEKLQEEVFDIIDREADG 128



 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 21/32 (65%), Positives = 25/32 (78%)
 Frame = +1

Query: 136 EIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           EII LQ+G CGNQIG +FW+ +  EHGI PSG
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPSG 35



 Score = 31.1 bits (67), Expect = 1.5
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPS-PRVSDL 661
           G D L+ F  CH+            + + R+ + YP ++I TFSVFP+   +SD+
Sbjct: 128 GSDSLEGFILCHS-IAGGTGSGMGSFIMERLADRYPKKLIQTFSVFPNQDEISDV 181


>M76765-1|AAB52553.1|  457|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 457

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 28/84 (33%), Positives = 52/84 (61%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR VLIDL+P  ++ + + P+  L+  +N    ++   A NNWA
Sbjct: 46  DRKDVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G +++G ++ E   D++ REA+G
Sbjct: 106 SG-FSQGEKVQEEVFDILDREADG 128



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 20/32 (62%), Positives = 24/32 (75%)
 Frame = +1

Query: 136 EIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           EII LQ+G CGNQIG +FW+ +  EHGI P G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPS-PRVSDL 661
           G D L+ F  CH+            Y + R+ E +P ++I T+SVFP+   +SD+
Sbjct: 128 GSDSLEGFVLCHS-IAGGTGSGMGSYVLERLSERFPKKLIQTYSVFPNQDEISDV 181


>AY070558-1|AAL48029.1|  457|Drosophila melanogaster LD32755p
           protein.
          Length = 457

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 28/84 (33%), Positives = 52/84 (61%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR VLIDL+P  ++ + + P+  L+  +N    ++   A NNWA
Sbjct: 46  DRKDVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G +++G ++ E   D++ REA+G
Sbjct: 106 SG-FSQGEKVQEEVFDILDREADG 128



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 20/32 (62%), Positives = 24/32 (75%)
 Frame = +1

Query: 136 EIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           EII LQ+G CGNQIG +FW+ +  EHGI P G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPS-PRVSDL 661
           G D L+ F  CH+            Y + R+ E +P ++I T+SVFP+   +SD+
Sbjct: 128 GSDSLEGFVLCHS-IAGGTGSGMGSYVLERLSERFPKKLIQTYSVFPNQDEISDV 181


>AJ010552-1|CAA09233.1|  457|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 457

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 28/84 (33%), Positives = 52/84 (61%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR VLIDL+P  ++ + + P+  L+  +N    ++   A NNWA
Sbjct: 46  DRKDVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G +++G ++ E   D++ REA+G
Sbjct: 106 SG-FSQGEKVQEEVFDILDREADG 128



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 20/32 (62%), Positives = 24/32 (75%)
 Frame = +1

Query: 136 EIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           EII LQ+G CGNQIG +FW+ +  EHGI P G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPS-PRVSDL 661
           G D L+ F  CH+            Y + R+ E +P ++I T+SVFP+   +SD+
Sbjct: 128 GSDSLEGFVLCHS-IAGGTGSGMGSYVLERLSERFPKKLIQTYSVFPNQDEISDV 181


>AF091265-1|AAC64117.1|  457|Drosophila melanogaster gamma-tubulin
           37CD protein.
          Length = 457

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 28/84 (33%), Positives = 52/84 (61%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR VLIDL+P  ++ + + P+  L+  +N    ++   A NNWA
Sbjct: 46  DRKDVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G +++G ++ E   D++ REA+G
Sbjct: 106 SG-FSQGEKVQEEVFDILDREADG 128



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 20/32 (62%), Positives = 24/32 (75%)
 Frame = +1

Query: 136 EIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           EII LQ+G CGNQIG +FW+ +  EHGI P G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPS-PRVSDL 661
           G D L+ F  CH+            Y + R+ E +P ++I T+SVFP+   +SD+
Sbjct: 128 GSDSLEGFVLCHS-IAGGTGSGMGSYVLERLSERFPKKLIQTYSVFPNQDEISDV 181


>AF081253-1|AAC35844.1|  351|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 351

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 28/84 (33%), Positives = 52/84 (61%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR VLIDL+P  ++ + + P+  L+  +N    ++   A NNWA
Sbjct: 46  DRKDVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G +++G ++ E   D++ REA+G
Sbjct: 106 SG-FSQGEKVQEEVFDILDREADG 128



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 20/32 (62%), Positives = 24/32 (75%)
 Frame = +1

Query: 136 EIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           EII LQ+G CGNQIG +FW+ +  EHGI P G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPS-PRVSDL 661
           G D L+ F  CH+            Y + R+ E +P ++I T+SVFP+   +SD+
Sbjct: 128 GSDSLEGFVLCHS-IAGGTGSGMGSYVLERLSERFPKKLIQTYSVFPNQDEISDV 181


>AF081252-1|AAC35843.1|  457|Drosophila melanogaster gamma-tubulin
           protein.
          Length = 457

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 28/84 (33%), Positives = 52/84 (61%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR VLIDL+P  ++ + + P+  L+  +N    ++   A NNWA
Sbjct: 46  DRKDVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G +++G ++ E   D++ REA+G
Sbjct: 106 SG-FSQGEKVQEEVFDILDREADG 128



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 20/32 (62%), Positives = 24/32 (75%)
 Frame = +1

Query: 136 EIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           EII LQ+G CGNQIG +FW+ +  EHGI P G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPS-PRVSDL 661
           G D L+ F  CH+            Y + R+ E +P ++I T+SVFP+   +SD+
Sbjct: 128 GSDSLEGFVLCHS-IAGGTGSGMGSYVLERLSERFPKKLIQTYSVFPNQDEISDV 181


>AE014134-3061|AAF53774.1|  457|Drosophila melanogaster CG17566-PA
           protein.
          Length = 457

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 28/84 (33%), Positives = 52/84 (61%), Gaps = 2/84 (2%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQN--CAANNWA 434
           +R +V++ +A    Y+PR VLIDL+P  ++ + + P+  L+  +N    ++   A NNWA
Sbjct: 46  DRKDVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGGAGNNWA 105

Query: 435 KGHYTEGVEILESALDVIRREAEG 506
            G +++G ++ E   D++ REA+G
Sbjct: 106 SG-FSQGEKVQEEVFDILDREADG 128



 Score = 48.8 bits (111), Expect = 7e-06
 Identities = 20/32 (62%), Positives = 24/32 (75%)
 Frame = +1

Query: 136 EIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           EII LQ+G CGNQIG +FW+ +  EHGI P G
Sbjct: 4   EIITLQLGQCGNQIGFEFWKRLCLEHGISPDG 35



 Score = 30.7 bits (66), Expect = 2.0
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = +2

Query: 503 GLDCLQVF-RCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPS-PRVSDL 661
           G D L+ F  CH+            Y + R+ E +P ++I T+SVFP+   +SD+
Sbjct: 128 GSDSLEGFVLCHS-IAGGTGSGMGSYVLERLSERFPKKLIQTYSVFPNQDEISDV 181


>AY089253-1|AAL89991.1|  455|Drosophila melanogaster AT04270p
           protein.
          Length = 455

 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 23/65 (35%), Positives = 43/65 (66%)
 Frame = +3

Query: 309 PRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVI 488
           PR V+ID +P  +D +R+G +  LF PD  + G++ + +N+A+G+     E+L+ +++ I
Sbjct: 63  PRLVMIDTEPTVIDEIRTGSYRNLFHPDTLITGKDDSGSNFARGYNLMASELLDRSMNAI 122

Query: 489 RREAE 503
           RR A+
Sbjct: 123 RRVAD 127



 Score = 32.3 bits (70), Expect = 0.64
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = +1

Query: 136 EIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           EII + +G  G QI    WE+   EHGI  +G
Sbjct: 6   EIIQIHIGQAGVQIANACWELFCLEHGILANG 37


>AE014297-2432|AAF55488.1|  455|Drosophila melanogaster CG7794-PA
           protein.
          Length = 455

 Score = 56.8 bits (131), Expect = 3e-08
 Identities = 23/65 (35%), Positives = 43/65 (66%)
 Frame = +3

Query: 309 PRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVI 488
           PR V+ID +P  +D +R+G +  LF PD  + G++ + +N+A+G+     E+L+ +++ I
Sbjct: 63  PRLVMIDTEPTVIDEIRTGSYRNLFHPDTLITGKDDSGSNFARGYNLMASELLDRSMNAI 122

Query: 489 RREAE 503
           RR A+
Sbjct: 123 RRVAD 127



 Score = 32.3 bits (70), Expect = 0.64
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = +1

Query: 136 EIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           EII + +G  G QI    WE+   EHGI  +G
Sbjct: 6   EIIQIHIGQAGVQIANACWELFCLEHGILANG 37


>S60740-1|AAD13917.1|   25|Drosophila melanogaster beta 3 tubulin
           protein.
          Length = 25

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 17/23 (73%), Positives = 20/23 (86%)
 Frame = +1

Query: 187 FWEVISDEHGIDPSGCYHGDSDL 255
           FWE+IS+EHGID +G Y GDSDL
Sbjct: 1   FWEIISEEHGIDSNGIYVGDSDL 23


>X16825-1|CAA34725.1|   19|Drosophila melanogaster protein (
           Drosophila melanogasterDNA for 60C beta tubulin gene
           making beta 3 tubulin isoform.).
          Length = 19

 Score = 35.9 bits (79), Expect = 0.052
 Identities = 14/19 (73%), Positives = 16/19 (84%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGK 186
           MREI++LQ G CGNQIG K
Sbjct: 1   MREIVHLQAGQCGNQIGAK 19


>BT009977-1|AAQ22446.1| 1287|Drosophila melanogaster RE56428p
           protein.
          Length = 1287

 Score = 32.3 bits (70), Expect = 0.64
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +3

Query: 390 DNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAEGWIACKFSDVTL 539
           ++F + QNC  N  AK   T+G+E+L+     +   +E    C  + V L
Sbjct: 42  NDFSHSQNCPYNGTAKEMATDGLELLKKRCGFLLENSENKFCCDKNQVEL 91


>AJ249606-1|CAB56505.1| 1287|Drosophila melanogaster NPC1 protein
           protein.
          Length = 1287

 Score = 32.3 bits (70), Expect = 0.64
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +3

Query: 390 DNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAEGWIACKFSDVTL 539
           ++F + QNC  N  AK   T+G+E+L+     +   +E    C  + V L
Sbjct: 42  NDFSHSQNCPYNGTAKEMATDGLELLKKRCGFLLENSENKFCCDKNQVEL 91


>AE014134-1780|AAF52874.2| 1287|Drosophila melanogaster CG5722-PA
           protein.
          Length = 1287

 Score = 32.3 bits (70), Expect = 0.64
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +3

Query: 390 DNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREAEGWIACKFSDVTL 539
           ++F + QNC  N  AK   T+G+E+L+     +   +E    C  + V L
Sbjct: 42  NDFSHSQNCPYNGTAKEMATDGLELLKKRCGFLLENSENKFCCDKNQVEL 91


>AY094788-1|AAM11141.1| 1521|Drosophila melanogaster LD15253p
           protein.
          Length = 1521

 Score = 29.5 bits (63), Expect = 4.5
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = -2

Query: 507 SPQLPFE*HLKQTPESLLLQCSVPS 433
           SP + F  HL   P+SL+L C  PS
Sbjct: 659 SPSIKFPGHLPSAPQSLMLSCRRPS 683


>AF221715-1|AAF34661.1| 5554|Drosophila melanogaster split ends long
            isoform protein.
          Length = 5554

 Score = 29.5 bits (63), Expect = 4.5
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = -2

Query: 507  SPQLPFE*HLKQTPESLLLQCSVPS 433
            SP + F  HL   P+SL+L C  PS
Sbjct: 1137 SPSIKFPGHLPSAPQSLMLSCRRPS 1161


>AF188205-1|AAF13218.1| 5533|Drosophila melanogaster Spen RNP motif
            protein long isoformprotein.
          Length = 5533

 Score = 29.5 bits (63), Expect = 4.5
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = -2

Query: 507  SPQLPFE*HLKQTPESLLLQCSVPS 433
            SP + F  HL   P+SL+L C  PS
Sbjct: 1143 SPSIKFPGHLPSAPQSLMLSCRRPS 1167


>AF184612-1|AAF26299.1| 5476|Drosophila melanogaster split ends
            protein.
          Length = 5476

 Score = 29.5 bits (63), Expect = 4.5
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = -2

Query: 507  SPQLPFE*HLKQTPESLLLQCSVPS 433
            SP + F  HL   P+SL+L C  PS
Sbjct: 1086 SPSIKFPGHLPSAPQSLMLSCRRPS 1110


>AE014134-58|AAN10511.1| 5476|Drosophila melanogaster CG18497-PC,
            isoform C protein.
          Length = 5476

 Score = 29.5 bits (63), Expect = 4.5
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = -2

Query: 507  SPQLPFE*HLKQTPESLLLQCSVPS 433
            SP + F  HL   P+SL+L C  PS
Sbjct: 1086 SPSIKFPGHLPSAPQSLMLSCRRPS 1110


>AE014134-57|AAF51534.2| 5533|Drosophila melanogaster CG18497-PB,
            isoform B protein.
          Length = 5533

 Score = 29.5 bits (63), Expect = 4.5
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = -2

Query: 507  SPQLPFE*HLKQTPESLLLQCSVPS 433
            SP + F  HL   P+SL+L C  PS
Sbjct: 1143 SPSIKFPGHLPSAPQSLMLSCRRPS 1167


>AE014134-56|AAF51535.2| 5560|Drosophila melanogaster CG18497-PA,
            isoform A protein.
          Length = 5560

 Score = 29.5 bits (63), Expect = 4.5
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = -2

Query: 507  SPQLPFE*HLKQTPESLLLQCSVPS 433
            SP + F  HL   P+SL+L C  PS
Sbjct: 1143 SPSIKFPGHLPSAPQSLMLSCRRPS 1167


>AE014296-2034|AAF50006.2| 2523|Drosophila melanogaster CG32092-PB
            protein.
          Length = 2523

 Score = 29.1 bits (62), Expect = 6.0
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = -1

Query: 688  SVVLYGSTTQIRHSGTWKD*KG-QYNSVGILFAYPVHEVAYLIRNRYRHLAS 536
            SV+L G+  Q   S +W   +G Q+N     +A+  H+V   +R R R  AS
Sbjct: 1828 SVLLAGAEIQTLASPSWAAFRGRQFNCSYTFYAHDNHQVVVSVRTRGRPWAS 1879


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,683,710
Number of Sequences: 53049
Number of extensions: 634480
Number of successful extensions: 1943
Number of sequences better than 10.0: 58
Number of HSP's better than 10.0 without gapping: 1751
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1933
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3026039247
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -