SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30122.Seq
         (669 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X15109-1|CAA33207.1|  239|Drosophila melanogaster ribosomal  pro...   105   7e-23
AY089648-1|AAL90386.1|  252|Drosophila melanogaster RH04903p pro...   105   7e-23
AE014134-1774|AAF52868.1|  252|Drosophila melanogaster CG4897-PA...   105   7e-23
BT028802-1|ABI34183.1|  227|Drosophila melanogaster LP23547p pro...    50   4e-06
BT029578-1|ABL75637.1|  257|Drosophila melanogaster IP16905p pro...    45   1e-04
BT029555-1|ABL75615.1|  257|Drosophila melanogaster IP16805p pro...    45   1e-04
BT021218-1|AAX33366.1|  257|Drosophila melanogaster RH63749p pro...    45   1e-04
AY071314-1|AAL48936.1|  257|Drosophila melanogaster RE33833p pro...    45   1e-04
AE014134-2146|AAF53155.2|  257|Drosophila melanogaster CG5317-PA...    45   1e-04
AY060836-1|AAL28384.1|  240|Drosophila melanogaster GM01918p pro...    30   3.3  
AE014298-1264|AAF46438.1|  240|Drosophila melanogaster CG7041-PA...    30   3.3  

>X15109-1|CAA33207.1|  239|Drosophila melanogaster ribosomal
           protein protein.
          Length = 239

 Score =  105 bits (251), Expect = 7e-23
 Identities = 56/92 (60%), Positives = 66/92 (71%), Gaps = 4/92 (4%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQLFRLRQINNGVF++LNKAT+NMLRIAEPYI WGYPNLKSVREL+        V
Sbjct: 94  KVRKVLQLFRLRQINNGVFIKLNKATINMLRIAEPYITWGYPNLKSVRELIY---KRGFV 150

Query: 535 DNVYQSLPT----ALLRRGFHKHNIICVEDLI 618
            +  Q +P      + R+    H I CVEDL+
Sbjct: 151 KHNRQRVPITDNFVIERKLRQAHQIQCVEDLV 182



 Score = 46.0 bits (104), Expect = 5e-05
 Identities = 19/24 (79%), Positives = 23/24 (95%)
 Frame = +2

Query: 287 YYVPGEAKLAFVIRIRGINQVSPK 358
           +YVP EAKLAFV+RIRGIN+V+PK
Sbjct: 71  FYVPAEAKLAFVVRIRGINKVAPK 94



 Score = 35.1 bits (77), Expect = 0.087
 Identities = 22/59 (37%), Positives = 29/59 (49%)
 Frame = +3

Query: 78  LPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEI 254
           LPAVPES LK             +  LK+ +    +K+E   RAE+Y  EY   E+ EI
Sbjct: 1   LPAVPESKLKFSKKQISKRVAESKRRLKKAAVIALRKKENLVRAEKYQNEYIKAEQREI 59



 Score = 34.3 bits (75), Expect = 0.15
 Identities = 14/16 (87%), Positives = 14/16 (87%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEIFTVG  FKYASNF
Sbjct: 183 HEIFTVGPNFKYASNF 198


>AY089648-1|AAL90386.1|  252|Drosophila melanogaster RH04903p
           protein.
          Length = 252

 Score =  105 bits (251), Expect = 7e-23
 Identities = 56/92 (60%), Positives = 66/92 (71%), Gaps = 4/92 (4%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQLFRLRQINNGVF++LNKAT+NMLRIAEPYI WGYPNLKSVREL+        V
Sbjct: 107 KVRKVLQLFRLRQINNGVFIKLNKATINMLRIAEPYITWGYPNLKSVRELIY---KRGFV 163

Query: 535 DNVYQSLPT----ALLRRGFHKHNIICVEDLI 618
            +  Q +P      + R+    H I CVEDL+
Sbjct: 164 KHNRQRVPITDNFVIERKLRQAHQIQCVEDLV 195



 Score = 46.0 bits (104), Expect = 5e-05
 Identities = 19/24 (79%), Positives = 23/24 (95%)
 Frame = +2

Query: 287 YYVPGEAKLAFVIRIRGINQVSPK 358
           +YVP EAKLAFV+RIRGIN+V+PK
Sbjct: 84  FYVPAEAKLAFVVRIRGINKVAPK 107



 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 27/69 (39%), Positives = 35/69 (50%)
 Frame = +3

Query: 48  PVKGKEDSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKE 227
           PV  K  +KKLPAVPES LK             +  LK+ +    +K+E   RAE+Y  E
Sbjct: 4   PVVKKPAAKKLPAVPESKLKFSKKQISKRVAESKRRLKKAAVIALRKKENLVRAEKYQNE 63

Query: 228 YRIKERDEI 254
           Y   E+ EI
Sbjct: 64  YIKAEQREI 72



 Score = 34.3 bits (75), Expect = 0.15
 Identities = 14/16 (87%), Positives = 14/16 (87%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEIFTVG  FKYASNF
Sbjct: 196 HEIFTVGPNFKYASNF 211


>AE014134-1774|AAF52868.1|  252|Drosophila melanogaster CG4897-PA
           protein.
          Length = 252

 Score =  105 bits (251), Expect = 7e-23
 Identities = 56/92 (60%), Positives = 66/92 (71%), Gaps = 4/92 (4%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRKVLQLFRLRQINNGVF++LNKAT+NMLRIAEPYI WGYPNLKSVREL+        V
Sbjct: 107 KVRKVLQLFRLRQINNGVFIKLNKATINMLRIAEPYITWGYPNLKSVRELIY---KRGFV 163

Query: 535 DNVYQSLPT----ALLRRGFHKHNIICVEDLI 618
            +  Q +P      + R+    H I CVEDL+
Sbjct: 164 KHNRQRVPITDNFVIERKLRQAHQIQCVEDLV 195



 Score = 46.0 bits (104), Expect = 5e-05
 Identities = 19/24 (79%), Positives = 23/24 (95%)
 Frame = +2

Query: 287 YYVPGEAKLAFVIRIRGINQVSPK 358
           +YVP EAKLAFV+RIRGIN+V+PK
Sbjct: 84  FYVPAEAKLAFVVRIRGINKVAPK 107



 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 27/69 (39%), Positives = 35/69 (50%)
 Frame = +3

Query: 48  PVKGKEDSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKE 227
           PV  K  +KKLPAVPES LK             +  LK+ +    +K+E   RAE+Y  E
Sbjct: 4   PVVKKPAAKKLPAVPESKLKFSKKQISKRVAESKRRLKKAAVIALRKKENLVRAEKYQNE 63

Query: 228 YRIKERDEI 254
           Y   E+ EI
Sbjct: 64  YIKAEQREI 72



 Score = 34.3 bits (75), Expect = 0.15
 Identities = 14/16 (87%), Positives = 14/16 (87%)
 Frame = +2

Query: 620 HEIFTVGEKFKYASNF 667
           HEIFTVG  FKYASNF
Sbjct: 196 HEIFTVGPNFKYASNF 211


>BT028802-1|ABI34183.1|  227|Drosophila melanogaster LP23547p
           protein.
          Length = 227

 Score = 49.6 bits (113), Expect = 4e-06
 Identities = 20/44 (45%), Positives = 30/44 (68%)
 Frame = -1

Query: 483 VGVSPSNVRLGDT*HIHSSLIQTYKHTIVYLAQSKQLQNFTDFG 352
           +G++P +V LGD  H+   L+Q  +HT+V L Q++QLQN  D G
Sbjct: 48  IGIAPGDVGLGDAQHVDGGLVQLDEHTVVDLPQTEQLQNLADLG 91



 Score = 31.5 bits (68), Expect = 1.1
 Identities = 13/25 (52%), Positives = 18/25 (72%)
 Frame = -3

Query: 349 NLVDTTDSDDKCQFGFPGNVVVATI 275
           +LVDT D+DDK QFG  G+V +  +
Sbjct: 93  HLVDTADTDDKGQFGLGGHVELVAL 117


>BT029578-1|ABL75637.1|  257|Drosophila melanogaster IP16905p
           protein.
          Length = 257

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +1

Query: 367 VLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VDNVY 546
           + +  R+   +N VF+   K    +LR+ EP++ +G P+L S+RELV        +D   
Sbjct: 116 IFRTLRMGSRHNAVFMENTKENQLLLRVIEPFVVYGNPSLSSIRELVFKKGFAR-IDGKK 174

Query: 547 QSLPT-ALLRRGFHKHNIICVEDLI 618
            ++ +  ++ +      +IC+ED+I
Sbjct: 175 TAIQSNTMVEQQLGDKGVICLEDII 199


>BT029555-1|ABL75615.1|  257|Drosophila melanogaster IP16805p
           protein.
          Length = 257

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +1

Query: 367 VLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VDNVY 546
           + +  R+   +N VF+   K    +LR+ EP++ +G P+L S+RELV        +D   
Sbjct: 116 IFRTLRMGSRHNAVFMENTKENQLLLRVIEPFVVYGNPSLSSIRELVFKKGFAR-IDGKK 174

Query: 547 QSLPT-ALLRRGFHKHNIICVEDLI 618
            ++ +  ++ +      +IC+ED+I
Sbjct: 175 TAIQSNTMVEQQLGDKGVICLEDII 199


>BT021218-1|AAX33366.1|  257|Drosophila melanogaster RH63749p
           protein.
          Length = 257

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +1

Query: 367 VLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VDNVY 546
           + +  R+   +N VF+   K    +LR+ EP++ +G P+L S+RELV        +D   
Sbjct: 116 IFRTLRMGSRHNAVFMENTKENQLLLRVIEPFVVYGNPSLSSIRELVFKKGFAR-IDGKK 174

Query: 547 QSLPT-ALLRRGFHKHNIICVEDLI 618
            ++ +  ++ +      +IC+ED+I
Sbjct: 175 TAIQSNTMVEQQLGDKGVICLEDII 199


>AY071314-1|AAL48936.1|  257|Drosophila melanogaster RE33833p
           protein.
          Length = 257

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +1

Query: 367 VLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VDNVY 546
           + +  R+   +N VF+   K    +LR+ EP++ +G P+L S+RELV        +D   
Sbjct: 116 IFRTLRMGSRHNAVFMENTKENQLLLRVIEPFVVYGNPSLSSIRELVFKKGFAR-IDGKK 174

Query: 547 QSLPT-ALLRRGFHKHNIICVEDLI 618
            ++ +  ++ +      +IC+ED+I
Sbjct: 175 TAIQSNTMVEQQLGDKGVICLEDII 199


>AE014134-2146|AAF53155.2|  257|Drosophila melanogaster CG5317-PA
           protein.
          Length = 257

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +1

Query: 367 VLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*VDNVY 546
           + +  R+   +N VF+   K    +LR+ EP++ +G P+L S+RELV        +D   
Sbjct: 116 IFRTLRMGSRHNAVFMENTKENQLLLRVIEPFVVYGNPSLSSIRELVFKKGFAR-IDGKK 174

Query: 547 QSLPT-ALLRRGFHKHNIICVEDLI 618
            ++ +  ++ +      +IC+ED+I
Sbjct: 175 TAIQSNTMVEQQLGDKGVICLEDII 199


>AY060836-1|AAL28384.1|  240|Drosophila melanogaster GM01918p
           protein.
          Length = 240

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = +1

Query: 421 NKATVNMLRIAEPYIAW-GYPNLKSVRELVSNVDSPS*VDNVYQSL 555
           +K TVN     E Y+ W GYP  ++  E V N+D P  + N  +SL
Sbjct: 11  DKRTVNGR--TEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESL 54


>AE014298-1264|AAF46438.1|  240|Drosophila melanogaster CG7041-PA
           protein.
          Length = 240

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = +1

Query: 421 NKATVNMLRIAEPYIAW-GYPNLKSVRELVSNVDSPS*VDNVYQSL 555
           +K TVN     E Y+ W GYP  ++  E V N+D P  + N  +SL
Sbjct: 11  DKRTVNGR--TEYYLKWKGYPRSENTWEPVENLDCPDLIANFEESL 54


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,348,399
Number of Sequences: 53049
Number of extensions: 555890
Number of successful extensions: 1228
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1170
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1217
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2889369000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -