SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30117.Seq
         (608 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY061440-1|AAL28988.1|  352|Drosophila melanogaster LD37574p pro...   112   4e-25
AE014296-2093|AAF49961.3|  352|Drosophila melanogaster CG5654-PA...   112   4e-25
U49120-1|AAB94634.1|  359|Drosophila melanogaster Y-box protein ...   105   4e-23
AY118360-1|AAM48389.1|  195|Drosophila melanogaster RE05342p pro...    31   1.2  
AF521096-1|AAM77748.1|  195|Drosophila melanogaster RNA-binding ...    31   1.2  
AE014296-983|AAF50758.2|  195|Drosophila melanogaster CG17334-PA...    31   1.2  
BT029040-1|ABJ16973.1|  460|Drosophila melanogaster IP03738p pro...    29   5.0  

>AY061440-1|AAL28988.1|  352|Drosophila melanogaster LD37574p
           protein.
          Length = 352

 Score =  112 bits (269), Expect = 4e-25
 Identities = 52/66 (78%), Positives = 58/66 (87%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQ+AIARNNP+KAVRSVGDGE VEF VV GEKG EAA VTGP GEPV+GS +AA
Sbjct: 84  REDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFAA 143

Query: 432 DKRRGY 449
           DKRR +
Sbjct: 144 DKRRNF 149



 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 25/29 (86%), Positives = 28/29 (96%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV+GTVKWFNVKSGYGFINRNDT++
Sbjct: 57  VIATKVTGTVKWFNVKSGYGFINRNDTRE 85


>AE014296-2093|AAF49961.3|  352|Drosophila melanogaster CG5654-PA
           protein.
          Length = 352

 Score =  112 bits (269), Expect = 4e-25
 Identities = 52/66 (78%), Positives = 58/66 (87%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQ+AIARNNP+KAVRSVGDGE VEF VV GEKG EAA VTGP GEPV+GS +AA
Sbjct: 84  REDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFAA 143

Query: 432 DKRRGY 449
           DKRR +
Sbjct: 144 DKRRNF 149



 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 25/29 (86%), Positives = 28/29 (96%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV+GTVKWFNVKSGYGFINRNDT++
Sbjct: 57  VIATKVTGTVKWFNVKSGYGFINRNDTRE 85


>U49120-1|AAB94634.1|  359|Drosophila melanogaster Y-box protein
           protein.
          Length = 359

 Score =  105 bits (253), Expect = 4e-23
 Identities = 51/66 (77%), Positives = 57/66 (86%)
 Frame = +3

Query: 252 QEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAA 431
           +EDVFVHQ+AIA NNP+KAVRSVGDGE VEF VV GEKG EAA VTGP GEPV+GS +AA
Sbjct: 85  REDVFVHQSAIA-NNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFAA 143

Query: 432 DKRRGY 449
           DKRR +
Sbjct: 144 DKRRNF 149



 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 25/29 (86%), Positives = 28/29 (96%)
 Frame = +1

Query: 172 VIAEKVSGTVKWFNVKSGYGFINRNDTKK 258
           VIA KV+GTVKWFNVKSGYGFINRNDT++
Sbjct: 58  VIATKVTGTVKWFNVKSGYGFINRNDTRE 86


>AY118360-1|AAM48389.1|  195|Drosophila melanogaster RE05342p
           protein.
          Length = 195

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 11/19 (57%), Positives = 13/19 (68%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFINRND 249
           G  KWFNV  G+GF+  ND
Sbjct: 41  GKCKWFNVAKGWGFLTPND 59


>AF521096-1|AAM77748.1|  195|Drosophila melanogaster RNA-binding
           protein LIN-28 protein.
          Length = 195

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 11/19 (57%), Positives = 13/19 (68%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFINRND 249
           G  KWFNV  G+GF+  ND
Sbjct: 41  GKCKWFNVAKGWGFLTPND 59


>AE014296-983|AAF50758.2|  195|Drosophila melanogaster CG17334-PA
           protein.
          Length = 195

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 11/19 (57%), Positives = 13/19 (68%)
 Frame = +1

Query: 193 GTVKWFNVKSGYGFINRND 249
           G  KWFNV  G+GF+  ND
Sbjct: 41  GKCKWFNVAKGWGFLTPND 59


>BT029040-1|ABJ16973.1|  460|Drosophila melanogaster IP03738p
           protein.
          Length = 460

 Score = 29.1 bits (62), Expect = 5.0
 Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = +3

Query: 282 IARNNPRKAVRSVGDGEAVEFAVVAGE-KGFEAAGVTGPGGEPVKGSPYAAD 434
           +AR  P        DG  V  AV+A +  G   AG T   G PV G+  AAD
Sbjct: 202 VARAVPATDGNGAPDGVPVAGAVLATDGNGAPVAGATDGNGAPVAGAVPAAD 253


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,792,282
Number of Sequences: 53049
Number of extensions: 377643
Number of successful extensions: 1312
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1244
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1306
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2503659279
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -