SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30115.Seq
         (690 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF132553-1|AAD27852.1|  801|Drosophila melanogaster BcDNA.GM0288...   131   1e-30
AF047037-1|AAC27447.1|  801|Drosophila melanogaster transitional...   131   1e-30
AE013599-984|AAF58863.1|  801|Drosophila melanogaster CG2331-PA,...   131   1e-30
AF202034-1|AAF17568.1|  799|Drosophila melanogaster endoplasmic ...   117   2e-26
AE014298-1761|AAN09307.1|  618|Drosophila melanogaster CG32651-P...    29   4.5  

>AF132553-1|AAD27852.1|  801|Drosophila melanogaster BcDNA.GM02885
           protein.
          Length = 801

 Score =  131 bits (316), Expect = 1e-30
 Identities = 60/94 (63%), Positives = 67/94 (71%)
 Frame = +2

Query: 254 LLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTGNL 433
           +LSDD CPDEKIRM            SDVVS+  CP VKYGKRV ILPID+S EG+TGNL
Sbjct: 68  VLSDDTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDESTEGVTGNL 127

Query: 434 FEVYLKPYFMEAYRPIHRDDTFMVRGACAPSSSK 535
           FE+YLKPYF+EAYRPIH  D F+VR A  P   K
Sbjct: 128 FEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFK 161



 Score =  115 bits (277), Expect = 5e-26
 Identities = 56/68 (82%), Positives = 65/68 (95%)
 Frame = +3

Query: 51  MADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGK 230
           MAD+K  +DL+TAIL+RKDRPNRLIVEEA +DDNSVV+LSQAKM++LQLFRGDTV+LKGK
Sbjct: 1   MADSKG-EDLATAILKRKDRPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGK 59

Query: 231 RRKETVCI 254
           RRKETVCI
Sbjct: 60  RRKETVCI 67



 Score =  108 bits (260), Expect = 6e-24
 Identities = 47/56 (83%), Positives = 52/56 (92%)
 Frame = +1

Query: 514 MRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           MR +EFKVV TDP P+CIVAP+TVI CDG+PIKREEEEE+LNAVGYDDIGGCRKQL
Sbjct: 155 MRPIEFKVVLTDPEPYCIVAPETVIFCDGDPIKREEEEESLNAVGYDDIGGCRKQL 210


>AF047037-1|AAC27447.1|  801|Drosophila melanogaster transitional
           endoplasmic reticulumATPase TER94 protein.
          Length = 801

 Score =  131 bits (316), Expect = 1e-30
 Identities = 60/94 (63%), Positives = 67/94 (71%)
 Frame = +2

Query: 254 LLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTGNL 433
           +LSDD CPDEKIRM            SDVVS+  CP VKYGKRV ILPID+S EG+TGNL
Sbjct: 68  VLSDDTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDESTEGVTGNL 127

Query: 434 FEVYLKPYFMEAYRPIHRDDTFMVRGACAPSSSK 535
           FE+YLKPYF+EAYRPIH  D F+VR A  P   K
Sbjct: 128 FEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFK 161



 Score =  115 bits (277), Expect = 5e-26
 Identities = 56/68 (82%), Positives = 65/68 (95%)
 Frame = +3

Query: 51  MADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGK 230
           MAD+K  +DL+TAIL+RKDRPNRLIVEEA +DDNSVV+LSQAKM++LQLFRGDTV+LKGK
Sbjct: 1   MADSKG-EDLATAILKRKDRPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGK 59

Query: 231 RRKETVCI 254
           RRKETVCI
Sbjct: 60  RRKETVCI 67



 Score =  108 bits (260), Expect = 6e-24
 Identities = 47/56 (83%), Positives = 52/56 (92%)
 Frame = +1

Query: 514 MRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           MR +EFKVV TDP P+CIVAP+TVI CDG+PIKREEEEE+LNAVGYDDIGGCRKQL
Sbjct: 155 MRPIEFKVVLTDPEPYCIVAPETVIFCDGDPIKREEEEESLNAVGYDDIGGCRKQL 210


>AE013599-984|AAF58863.1|  801|Drosophila melanogaster CG2331-PA,
           isoform A protein.
          Length = 801

 Score =  131 bits (316), Expect = 1e-30
 Identities = 60/94 (63%), Positives = 67/94 (71%)
 Frame = +2

Query: 254 LLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTGNL 433
           +LSDD CPDEKIRM            SDVVS+  CP VKYGKRV ILPID+S EG+TGNL
Sbjct: 68  VLSDDTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDESTEGVTGNL 127

Query: 434 FEVYLKPYFMEAYRPIHRDDTFMVRGACAPSSSK 535
           FE+YLKPYF+EAYRPIH  D F+VR A  P   K
Sbjct: 128 FEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFK 161



 Score =  115 bits (277), Expect = 5e-26
 Identities = 56/68 (82%), Positives = 65/68 (95%)
 Frame = +3

Query: 51  MADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGK 230
           MAD+K  +DL+TAIL+RKDRPNRLIVEEA +DDNSVV+LSQAKM++LQLFRGDTV+LKGK
Sbjct: 1   MADSKG-EDLATAILKRKDRPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGK 59

Query: 231 RRKETVCI 254
           RRKETVCI
Sbjct: 60  RRKETVCI 67



 Score =  108 bits (260), Expect = 6e-24
 Identities = 47/56 (83%), Positives = 52/56 (92%)
 Frame = +1

Query: 514 MRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           MR +EFKVV TDP P+CIVAP+TVI CDG+PIKREEEEE+LNAVGYDDIGGCRKQL
Sbjct: 155 MRPIEFKVVLTDPEPYCIVAPETVIFCDGDPIKREEEEESLNAVGYDDIGGCRKQL 210


>AF202034-1|AAF17568.1|  799|Drosophila melanogaster endoplasmic
           reticulum membranefusion protein protein.
          Length = 799

 Score =  117 bits (281), Expect = 2e-26
 Identities = 55/94 (58%), Positives = 61/94 (64%)
 Frame = +2

Query: 254 LLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTGNL 433
           +LSDD CPDEKIRM            SDVVS+  CP VKYGKRV ILPID+S EG+TGNL
Sbjct: 68  VLSDDTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDESTEGVTGNL 127

Query: 434 FEVYLKPYFMEAYRPIHRDDTFMVRGACAPSSSK 535
           FE+YLKPYF      IH  D F+VR A  P   K
Sbjct: 128 FEIYLKPYFPRGLSAIHMGDNFIVRAAMRPIEFK 161



 Score =  115 bits (277), Expect = 5e-26
 Identities = 56/68 (82%), Positives = 65/68 (95%)
 Frame = +3

Query: 51  MADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGK 230
           MAD+K  +DL+TAIL+RKDRPNRLIVEEA +DDNSVV+LSQAKM++LQLFRGDTV+LKGK
Sbjct: 1   MADSKG-EDLATAILKRKDRPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGK 59

Query: 231 RRKETVCI 254
           RRKETVCI
Sbjct: 60  RRKETVCI 67



 Score =  108 bits (260), Expect = 6e-24
 Identities = 47/56 (83%), Positives = 52/56 (92%)
 Frame = +1

Query: 514 MRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           MR +EFKVV TDP P+CIVAP+TVI CDG+PIKREEEEE+LNAVGYDDIGGCRKQL
Sbjct: 155 MRPIEFKVVLTDPEPYCIVAPETVIFCDGDPIKREEEEESLNAVGYDDIGGCRKQL 210


>AE014298-1761|AAN09307.1|  618|Drosophila melanogaster CG32651-PA
           protein.
          Length = 618

 Score = 29.5 bits (63), Expect = 4.5
 Identities = 13/25 (52%), Positives = 17/25 (68%)
 Frame = +3

Query: 369 NMENESTYCQLMIQLRVLLAIYSKY 443
           N+ NES  C  +IQL+ +L  YSKY
Sbjct: 479 NVTNESVKCHAVIQLQNVLLEYSKY 503


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,567,106
Number of Sequences: 53049
Number of extensions: 672643
Number of successful extensions: 1950
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1901
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1950
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3005453946
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -