SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30114.Seq
         (672 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U18973-1|AAA86480.1|  496|Drosophila melanogaster protein disulf...   134   1e-31
BT003181-1|AAO24936.1|  389|Drosophila melanogaster RH09122p pro...   134   1e-31
BT001544-1|AAN71299.1|  496|Drosophila melanogaster RE10429p pro...   134   1e-31
AE014296-2484|AAF49659.1|  496|Drosophila melanogaster CG6988-PA...   134   1e-31
DQ062786-1|AAY56659.1|  489|Drosophila melanogaster Erp60 protein.     67   2e-11
AE013599-1355|AAF58609.2|  489|Drosophila melanogaster CG8983-PA...    67   2e-11
AY061349-1|AAL28897.1|  433|Drosophila melanogaster LD28038p pro...    62   5e-10
AE014134-2713|AAF53532.1|  433|Drosophila melanogaster CG5809-PA...    62   5e-10
BT012439-1|AAS93710.1|  190|Drosophila melanogaster RH14470p pro...    60   2e-09
BT011488-1|AAR99146.1|  190|Drosophila melanogaster LD08219p pro...    60   2e-09
AE014296-2485|AAN11793.1|  190|Drosophila melanogaster CG6988-PD...    60   2e-09
AY052131-1|AAK93555.1|  510|Drosophila melanogaster SD08104p pro...    59   6e-09
AE014134-2339|AAF53293.1|  510|Drosophila melanogaster CG9302-PA...    59   6e-09
AY060296-1|AAL25335.1|  364|Drosophila melanogaster GH13982p pro...    56   6e-08
AE013599-1356|AAM68697.1|  364|Drosophila melanogaster CG8983-PB...    56   6e-08
AY058697-1|AAL13926.1|  412|Drosophila melanogaster LD41494p pro...    54   1e-07
AE014298-2355|AAN09391.1|  375|Drosophila melanogaster CG9911-PC...    54   1e-07
AE014298-2354|AAF48579.2|  412|Drosophila melanogaster CG9911-PD...    54   1e-07
AE014298-2353|AAN09390.1|  412|Drosophila melanogaster CG9911-PB...    54   1e-07
AE014298-2352|AAF48580.2|  412|Drosophila melanogaster CG9911-PA...    54   1e-07
AY051696-1|AAK93120.1|  430|Drosophila melanogaster LD24073p pro...    53   3e-07
AE014296-2661|AAF49525.3|  430|Drosophila melanogaster CG5027-PA...    53   3e-07
AY051709-1|AAK93133.1|  416|Drosophila melanogaster LD24756p pro...    49   5e-06
AE014298-1673|AAF48082.2|  416|Drosophila melanogaster CG1837-PA...    49   5e-06
AE014297-599|AAF54029.1|  410|Drosophila melanogaster CG10029-PA...    46   6e-05
AF216975-1|AAF34749.1|  857|Drosophila melanogaster l(2)01289 H9...    44   2e-04
AF216973-2|AAF34747.1|  857|Drosophila melanogaster l(2)01289 H9...    44   2e-04
AF216973-1|AAF34746.1| 1703|Drosophila melanogaster l(2)01289 lo...    44   2e-04
AE013599-216|AAM70821.2|  857|Drosophila melanogaster CG9432-PA,...    44   2e-04
AE013599-215|ABI31026.1| 1855|Drosophila melanogaster CG9432-PD,...    44   2e-04
AE013599-214|AAN16126.1| 1703|Drosophila melanogaster CG9432-PB,...    44   2e-04
AF216977-1|AAF34751.1|  432|Drosophila melanogaster l(2)01289 lo...    43   4e-04
AF216976-1|AAF34750.1|  758|Drosophila melanogaster l(2)01289 lo...    43   4e-04
AE013599-213|ABI31025.1|  884|Drosophila melanogaster CG9432-PE,...    43   4e-04
BT004854-1|AAO45210.1|  637|Drosophila melanogaster RE62692p pro...    42   6e-04
AE013599-1673|AAF58400.1|  637|Drosophila melanogaster CG4670-PA...    42   6e-04
BT023024-1|AAY55440.1|  139|Drosophila melanogaster IP04051p pro...    42   0.001
BT022989-1|AAY55405.1|  139|Drosophila melanogaster IP04151p pro...    42   0.001
AE014296-2414|AAF49714.1|  139|Drosophila melanogaster CG13473-P...    42   0.001
BT001615-1|AAN71370.1|  729|Drosophila melanogaster RE34119p pro...    40   0.003
AY089550-1|AAL90288.1|  287|Drosophila melanogaster LD26837p pro...    39   0.005
AF143404-1|AAF66635.1|  287|Drosophila melanogaster thioredoxin-...    39   0.005
AE014296-996|AAF50750.1|  287|Drosophila melanogaster CG5495-PA ...    39   0.005
AF216974-1|AAF34748.1|  566|Drosophila melanogaster l(2)01289 lo...    39   0.007
AF220362-1|AAF37263.1|  106|Drosophila melanogaster thioredoxin ...    37   0.022
AE014298-718|AAF46018.2|  157|Drosophila melanogaster CG3315-PA ...    37   0.022
AE014134-1667|AAN10701.1|  106|Drosophila melanogaster CG31884-P...    37   0.022
AE014134-1666|AAN10700.1|  106|Drosophila melanogaster CG31884-P...    37   0.022
AY118750-1|AAM50610.1|  323|Drosophila melanogaster GH07506p pro...    37   0.029
AJ507731-1|CAD45644.1|  157|Drosophila melanogaster thioredoxinT...    37   0.029
AE013599-3698|AAF47072.1|  323|Drosophila melanogaster CG5554-PA...    37   0.029
AY060458-1|AAL25497.1|  114|Drosophila melanogaster SD03042p pro...    36   0.050
AY071406-1|AAL49028.1|  142|Drosophila melanogaster RE49388p pro...    35   0.088
AE014296-444|AAF47638.1|  142|Drosophila melanogaster CG8993-PA ...    35   0.088
AY070811-1|AAL48433.1|  145|Drosophila melanogaster AT22380p pro...    35   0.12 
AE013599-2952|AAF57518.2|  145|Drosophila melanogaster CG8517-PA...    35   0.12 
BT012482-1|AAS93753.1|  245|Drosophila melanogaster RE10237p pro...    33   0.35 
AY095006-1|AAM11334.1|  302|Drosophila melanogaster GH08893p pro...    33   0.35 
AE014297-3697|AAN14034.1|  245|Drosophila melanogaster CG11790-P...    33   0.35 
AE014297-3696|AAF56385.2|  302|Drosophila melanogaster CG11790-P...    33   0.35 
AE014296-2483|AAN11792.1|  175|Drosophila melanogaster CG6988-PB...    32   0.82 
L27072-1|AAA28937.1|  107|Drosophila melanogaster thioredoxin-li...    31   1.4  
AY119573-1|AAM50227.1|  160|Drosophila melanogaster LD03613p pro...    31   1.4  
AL023893-3|CAA19652.1|  160|Drosophila melanogaster EG:132E8.3 p...    31   1.4  
AE014298-719|AAF46019.1|  107|Drosophila melanogaster CG4193-PA ...    31   1.4  
AE014298-194|AAF45615.1|  160|Drosophila melanogaster CG3719-PA ...    31   1.4  
U73196-1|AAC47325.1|  353|Drosophila melanogaster Jun-N-terminal...    29   4.4  
U50966-1|AAB51188.1|  315|Drosophila melanogaster DJNK protein.        29   4.4  
U50965-1|AAB51187.1|  372|Drosophila melanogaster DJNK protein.        29   4.4  
U49249-1|AAB48381.1|  372|Drosophila melanogaster JNK protein ki...    29   4.4  
U49180-1|AAB97094.1|  372|Drosophila melanogaster JNK protein ki...    29   4.4  
AY122221-1|AAM52733.1|  372|Drosophila melanogaster RE08746p pro...    29   4.4  
AY070865-1|AAL48487.1|  372|Drosophila melanogaster HL02677p pro...    29   4.4  
AE014134-1794|AAF52883.1|  372|Drosophila melanogaster CG5680-PB...    29   4.4  

>U18973-1|AAA86480.1|  496|Drosophila melanogaster protein disulfide
           isomerase protein.
          Length = 496

 Score =  134 bits (323), Expect = 1e-31
 Identities = 65/133 (48%), Positives = 86/133 (64%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEV 432
           +LAKVDAT E +LAE Y VRGYPTLKFFR+GSP++YSGGRQA DII+W+ KKTGPPA ++
Sbjct: 81  KLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGPPAKDL 140

Query: 433 TSAEQAKELIDANTVIVFGFFSDQS*PEPKLSFQXXXXXXXXXXXXSAMRK*FKELEAED 612
           TS   A++ +  N + + GFF D    E K   +            S+      + EA+D
Sbjct: 141 TSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKD 200

Query: 613 EDVVLFKNFEEKR 651
             VVLFK F++K+
Sbjct: 201 NGVVLFKPFDDKK 213



 Score = 94.3 bits (224), Expect = 1e-19
 Identities = 43/78 (55%), Positives = 56/78 (71%)
 Frame = +2

Query: 35  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 214
           +F A + +  +   EV  EE VLV +  NF+ +I   E++LVEFYAPWCGHCK+LAPEYA
Sbjct: 8   LFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYA 67

Query: 215 KAATKLAEEESPIN*RKL 268
           KAA +LAE+ESPI   K+
Sbjct: 68  KAAQQLAEKESPIKLAKV 85



 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 35/83 (42%), Positives = 48/83 (57%), Gaps = 4/83 (4%)
 Frame = +2

Query: 8   ADNIEMRVLIFTAIALLGLALGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAP 175
           A+ IE  +  F    L    L  E+P + +   V VL  +NFE+V +  ++ +LVEFYAP
Sbjct: 336 AETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAP 395

Query: 176 WCGHCKSLAPEYAKAATKLAEEE 244
           WCGHCK LAP Y + A K  + E
Sbjct: 396 WCGHCKQLAPIYDQLAEKYKDNE 418



 Score = 33.5 bits (73), Expect = 0.27
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 2/50 (4%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFR--NGSPIDYSGGRQADDIISWL 399
           +AK+D+T  +   ES  +  +PT+K+FR  +   ID++  R  DD + +L
Sbjct: 422 IAKMDSTANE--LESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFL 469


>BT003181-1|AAO24936.1|  389|Drosophila melanogaster RH09122p
           protein.
          Length = 389

 Score =  134 bits (323), Expect = 1e-31
 Identities = 65/133 (48%), Positives = 86/133 (64%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEV 432
           +LAKVDAT E +LAE Y VRGYPTLKFFR+GSP++YSGGRQA DII+W+ KKTGPPA ++
Sbjct: 81  KLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGPPAKDL 140

Query: 433 TSAEQAKELIDANTVIVFGFFSDQS*PEPKLSFQXXXXXXXXXXXXSAMRK*FKELEAED 612
           TS   A++ +  N + + GFF D    E K   +            S+      + EA+D
Sbjct: 141 TSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKD 200

Query: 613 EDVVLFKNFEEKR 651
             VVLFK F++K+
Sbjct: 201 NGVVLFKPFDDKK 213



 Score = 94.3 bits (224), Expect = 1e-19
 Identities = 43/78 (55%), Positives = 56/78 (71%)
 Frame = +2

Query: 35  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 214
           +F A + +  +   EV  EE VLV +  NF+ +I   E++LVEFYAPWCGHCK+LAPEYA
Sbjct: 8   LFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYA 67

Query: 215 KAATKLAEEESPIN*RKL 268
           KAA +LAE+ESPI   K+
Sbjct: 68  KAAQQLAEKESPIKLAKV 85


>BT001544-1|AAN71299.1|  496|Drosophila melanogaster RE10429p
           protein.
          Length = 496

 Score =  134 bits (323), Expect = 1e-31
 Identities = 65/133 (48%), Positives = 86/133 (64%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEV 432
           +LAKVDAT E +LAE Y VRGYPTLKFFR+GSP++YSGGRQA DII+W+ KKTGPPA ++
Sbjct: 81  KLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGPPAKDL 140

Query: 433 TSAEQAKELIDANTVIVFGFFSDQS*PEPKLSFQXXXXXXXXXXXXSAMRK*FKELEAED 612
           TS   A++ +  N + + GFF D    E K   +            S+      + EA+D
Sbjct: 141 TSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKD 200

Query: 613 EDVVLFKNFEEKR 651
             VVLFK F++K+
Sbjct: 201 NGVVLFKPFDDKK 213



 Score = 94.3 bits (224), Expect = 1e-19
 Identities = 43/78 (55%), Positives = 56/78 (71%)
 Frame = +2

Query: 35  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 214
           +F A + +  +   EV  EE VLV +  NF+ +I   E++LVEFYAPWCGHCK+LAPEYA
Sbjct: 8   LFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYA 67

Query: 215 KAATKLAEEESPIN*RKL 268
           KAA +LAE+ESPI   K+
Sbjct: 68  KAAQQLAEKESPIKLAKV 85



 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 35/83 (42%), Positives = 48/83 (57%), Gaps = 4/83 (4%)
 Frame = +2

Query: 8   ADNIEMRVLIFTAIALLGLALGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAP 175
           A+ IE  +  F    L    L  E+P + +   V VL  +NFE+V +  ++ +LVEFYAP
Sbjct: 336 AETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAP 395

Query: 176 WCGHCKSLAPEYAKAATKLAEEE 244
           WCGHCK LAP Y + A K  + E
Sbjct: 396 WCGHCKQLAPIYDQLAEKYKDNE 418



 Score = 33.5 bits (73), Expect = 0.27
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 2/50 (4%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFR--NGSPIDYSGGRQADDIISWL 399
           +AK+D+T  +   ES  +  +PT+K+FR  +   ID++  R  DD + +L
Sbjct: 422 IAKMDSTANE--LESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFL 469


>AE014296-2484|AAF49659.1|  496|Drosophila melanogaster CG6988-PA,
           isoform A protein.
          Length = 496

 Score =  134 bits (323), Expect = 1e-31
 Identities = 65/133 (48%), Positives = 86/133 (64%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEV 432
           +LAKVDAT E +LAE Y VRGYPTLKFFR+GSP++YSGGRQA DII+W+ KKTGPPA ++
Sbjct: 81  KLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGPPAKDL 140

Query: 433 TSAEQAKELIDANTVIVFGFFSDQS*PEPKLSFQXXXXXXXXXXXXSAMRK*FKELEAED 612
           TS   A++ +  N + + GFF D    E K   +            S+      + EA+D
Sbjct: 141 TSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKD 200

Query: 613 EDVVLFKNFEEKR 651
             VVLFK F++K+
Sbjct: 201 NGVVLFKPFDDKK 213



 Score = 94.3 bits (224), Expect = 1e-19
 Identities = 43/78 (55%), Positives = 56/78 (71%)
 Frame = +2

Query: 35  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 214
           +F A + +  +   EV  EE VLV +  NF+ +I   E++LVEFYAPWCGHCK+LAPEYA
Sbjct: 8   LFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYA 67

Query: 215 KAATKLAEEESPIN*RKL 268
           KAA +LAE+ESPI   K+
Sbjct: 68  KAAQQLAEKESPIKLAKV 85



 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 35/83 (42%), Positives = 48/83 (57%), Gaps = 4/83 (4%)
 Frame = +2

Query: 8   ADNIEMRVLIFTAIALLGLALGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAP 175
           A+ IE  +  F    L    L  E+P + +   V VL  +NFE+V +  ++ +LVEFYAP
Sbjct: 336 AETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAP 395

Query: 176 WCGHCKSLAPEYAKAATKLAEEE 244
           WCGHCK LAP Y + A K  + E
Sbjct: 396 WCGHCKQLAPIYDQLAEKYKDNE 418



 Score = 33.5 bits (73), Expect = 0.27
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 2/50 (4%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFR--NGSPIDYSGGRQADDIISWL 399
           +AK+D+T  +   ES  +  +PT+K+FR  +   ID++  R  DD + +L
Sbjct: 422 IAKMDSTANE--LESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFL 469


>DQ062786-1|AAY56659.1|  489|Drosophila melanogaster Erp60 protein.
          Length = 489

 Score = 67.3 bits (157), Expect = 2e-11
 Identities = 37/129 (28%), Positives = 62/129 (48%), Gaps = 2/129 (1%)
 Frame = +1

Query: 253 QLAKVDATQE-QDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPPAV 426
           +LAKVD T+  ++    Y V GYPTLK FR      DY+G R+A  I  +++ + GP + 
Sbjct: 76  KLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREASGIAKYMRAQVGPASK 135

Query: 427 EVTSAEQAKELIDANTVIVFGFFSDQS*PEPKLSFQXXXXXXXXXXXXSAMRK*FKELEA 606
            V +  + K+ +D     +FG+FSD      K+  +             +  K   + + 
Sbjct: 136 TVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYRFGHSSEKEVLDKQG 195

Query: 607 EDEDVVLFK 633
           E + +VL +
Sbjct: 196 ETDKIVLIR 204



 Score = 66.5 bits (155), Expect = 3e-11
 Identities = 30/60 (50%), Positives = 39/60 (65%)
 Frame = +2

Query: 89  EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIN*RKL 268
           E++VL L   +F T +   E  LV FYAPWCGHCK L PEYAKAA  + +++ PI   K+
Sbjct: 21  EQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKDDDPPIKLAKV 80



 Score = 55.6 bits (128), Expect = 6e-08
 Identities = 30/71 (42%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +2

Query: 98  VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIN*RKLTQ 274
           V V    NF+  VI   +  L+EFYAPWCGHCK L+P Y + A KL +E+  I   K+  
Sbjct: 366 VKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDVAI--VKMDA 423

Query: 275 LKNRISPRATV 307
             N + P   V
Sbjct: 424 TANDVPPEFNV 434



 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 3/54 (5%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKK 408
           + K+DAT   D+   + VRG+PTL +        P+ Y+GGR+ DD + ++ K+
Sbjct: 418 IVKMDATAN-DVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKE 470


>AE013599-1355|AAF58609.2|  489|Drosophila melanogaster CG8983-PA,
           isoform A protein.
          Length = 489

 Score = 67.3 bits (157), Expect = 2e-11
 Identities = 37/129 (28%), Positives = 62/129 (48%), Gaps = 2/129 (1%)
 Frame = +1

Query: 253 QLAKVDATQE-QDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPPAV 426
           +LAKVD T+  ++    Y V GYPTLK FR      DY+G R+A  I  +++ + GP + 
Sbjct: 76  KLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREASGIAKYMRAQVGPASK 135

Query: 427 EVTSAEQAKELIDANTVIVFGFFSDQS*PEPKLSFQXXXXXXXXXXXXSAMRK*FKELEA 606
            V +  + K+ +D     +FG+FSD      K+  +             +  K   + + 
Sbjct: 136 TVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYRFGHSSEKEVLDKQG 195

Query: 607 EDEDVVLFK 633
           E + +VL +
Sbjct: 196 ETDKIVLIR 204



 Score = 66.5 bits (155), Expect = 3e-11
 Identities = 30/60 (50%), Positives = 39/60 (65%)
 Frame = +2

Query: 89  EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIN*RKL 268
           E++VL L   +F T +   E  LV FYAPWCGHCK L PEYAKAA  + +++ PI   K+
Sbjct: 21  EQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKDDDPPIKLAKV 80



 Score = 55.6 bits (128), Expect = 6e-08
 Identities = 30/71 (42%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +2

Query: 98  VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIN*RKLTQ 274
           V V    NF+  VI   +  L+EFYAPWCGHCK L+P Y + A KL +E+  I   K+  
Sbjct: 366 VKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDVAI--VKMDA 423

Query: 275 LKNRISPRATV 307
             N + P   V
Sbjct: 424 TANDVPPEFNV 434



 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 3/54 (5%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKK 408
           + K+DAT   D+   + VRG+PTL +        P+ Y+GGR+ DD + ++ K+
Sbjct: 418 IVKMDATAN-DVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKE 470


>AY061349-1|AAL28897.1|  433|Drosophila melanogaster LD28038p
           protein.
          Length = 433

 Score = 62.5 bits (145), Expect = 5e-10
 Identities = 26/48 (54%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query: 92  ENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 232
           ++V+ L++ NF+ ++  ++ I LVEF+APWCGHCK+LAPE+AKAA +L
Sbjct: 156 DDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKEL 203



 Score = 55.6 bits (128), Expect = 6e-08
 Identities = 24/48 (50%), Positives = 33/48 (68%), Gaps = 1/48 (2%)
 Frame = +2

Query: 92  ENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 232
           + V+ L+ +NF+  +   + I +VEFYAPWCGHC+SL PEY K A  L
Sbjct: 25  DGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKAL 72



 Score = 55.6 bits (128), Expect = 6e-08
 Identities = 28/57 (49%), Positives = 33/57 (57%), Gaps = 5/57 (8%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGS-----PIDYSGGRQADDIISWLKKK 408
           +L  +DAT  Q  A  Y VRGYPT+KFF  GS       +Y GGR A DI+SW   K
Sbjct: 208 KLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASDK 264



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDI 387
           ++  V+A  +  L+  +GVRG+PT+K F     SP DY+G R A  I
Sbjct: 77  KVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAI 123


>AE014134-2713|AAF53532.1|  433|Drosophila melanogaster CG5809-PA
           protein.
          Length = 433

 Score = 62.5 bits (145), Expect = 5e-10
 Identities = 26/48 (54%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query: 92  ENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 232
           ++V+ L++ NF+ ++  ++ I LVEF+APWCGHCK+LAPE+AKAA +L
Sbjct: 156 DDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKEL 203



 Score = 55.6 bits (128), Expect = 6e-08
 Identities = 24/48 (50%), Positives = 33/48 (68%), Gaps = 1/48 (2%)
 Frame = +2

Query: 92  ENVLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 232
           + V+ L+ +NF+  +   + I +VEFYAPWCGHC+SL PEY K A  L
Sbjct: 25  DGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKAL 72



 Score = 55.6 bits (128), Expect = 6e-08
 Identities = 28/57 (49%), Positives = 33/57 (57%), Gaps = 5/57 (8%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGS-----PIDYSGGRQADDIISWLKKK 408
           +L  +DAT  Q  A  Y VRGYPT+KFF  GS       +Y GGR A DI+SW   K
Sbjct: 208 KLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASDK 264



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDI 387
           ++  V+A  +  L+  +GVRG+PT+K F     SP DY+G R A  I
Sbjct: 77  KVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAI 123


>BT012439-1|AAS93710.1|  190|Drosophila melanogaster RH14470p
           protein.
          Length = 190

 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 35/83 (42%), Positives = 48/83 (57%), Gaps = 4/83 (4%)
 Frame = +2

Query: 8   ADNIEMRVLIFTAIALLGLALGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAP 175
           A+ IE  +  F    L    L  E+P + +   V VL  +NFE+V +  ++ +LVEFYAP
Sbjct: 30  AETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAP 89

Query: 176 WCGHCKSLAPEYAKAATKLAEEE 244
           WCGHCK LAP Y + A K  + E
Sbjct: 90  WCGHCKQLAPIYDQLAEKYKDNE 112



 Score = 33.5 bits (73), Expect = 0.27
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 2/50 (4%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFR--NGSPIDYSGGRQADDIISWL 399
           +AK+D+T  +   ES  +  +PT+K+FR  +   ID++  R  DD + +L
Sbjct: 116 IAKMDSTANE--LESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFL 163


>BT011488-1|AAR99146.1|  190|Drosophila melanogaster LD08219p
           protein.
          Length = 190

 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 35/83 (42%), Positives = 48/83 (57%), Gaps = 4/83 (4%)
 Frame = +2

Query: 8   ADNIEMRVLIFTAIALLGLALGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAP 175
           A+ IE  +  F    L    L  E+P + +   V VL  +NFE+V +  ++ +LVEFYAP
Sbjct: 30  AETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAP 89

Query: 176 WCGHCKSLAPEYAKAATKLAEEE 244
           WCGHCK LAP Y + A K  + E
Sbjct: 90  WCGHCKQLAPIYDQLAEKYKDNE 112



 Score = 33.5 bits (73), Expect = 0.27
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 2/50 (4%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFR--NGSPIDYSGGRQADDIISWL 399
           +AK+D+T  +   ES  +  +PT+K+FR  +   ID++  R  DD + +L
Sbjct: 116 IAKMDSTANE--LESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFL 163


>AE014296-2485|AAN11793.1|  190|Drosophila melanogaster CG6988-PD,
           isoform D protein.
          Length = 190

 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 35/83 (42%), Positives = 48/83 (57%), Gaps = 4/83 (4%)
 Frame = +2

Query: 8   ADNIEMRVLIFTAIALLGLALGDEVPTEEN---VLVLSKANFETV-ITTTEYILVEFYAP 175
           A+ IE  +  F    L    L  E+P + +   V VL  +NFE+V +  ++ +LVEFYAP
Sbjct: 30  AETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAP 89

Query: 176 WCGHCKSLAPEYAKAATKLAEEE 244
           WCGHCK LAP Y + A K  + E
Sbjct: 90  WCGHCKQLAPIYDQLAEKYKDNE 112



 Score = 33.5 bits (73), Expect = 0.27
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 2/50 (4%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFR--NGSPIDYSGGRQADDIISWL 399
           +AK+D+T  +   ES  +  +PT+K+FR  +   ID++  R  DD + +L
Sbjct: 116 IAKMDSTANE--LESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFL 163


>AY052131-1|AAK93555.1|  510|Drosophila melanogaster SD08104p
           protein.
          Length = 510

 Score = 58.8 bits (136), Expect = 6e-09
 Identities = 23/55 (41%), Positives = 34/55 (61%)
 Frame = +2

Query: 86  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESP 250
           T   ++ L+   FE  +   +  LV FYAPWCGHCK + PEY KAA ++ +++ P
Sbjct: 269 TNSEIVHLTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIP 323



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 24/56 (42%), Positives = 33/56 (58%)
 Frame = +2

Query: 74  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 241
           +E    + VL L   NF + +   ++ LV FYAPWCGHCK   PE+  AAT L ++
Sbjct: 390 EEEEDSKEVLFLDDDNFSSTLKRKKHALVMFYAPWCGHCKHTKPEFTAAATALQDD 445



 Score = 51.6 bits (118), Expect = 9e-07
 Identities = 25/61 (40%), Positives = 37/61 (60%)
 Frame = +1

Query: 238 RRISYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 417
           ++I   LA +DAT+E  +AE Y V+GYPT+KFF NG        R+A  I+ +++    P
Sbjct: 320 KKIPGLLAALDATKEPSIAEKYKVKGYPTVKFFSNGVFKFEVNVREASKIVEFMRDPKEP 379

Query: 418 P 420
           P
Sbjct: 380 P 380



 Score = 46.0 bits (104), Expect = 5e-05
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +2

Query: 74  DEVPTEENVLVLSKANFETVITTTEY--ILVEFYAPWCGHCKSLAPEYAKAATKL 232
           +E P  ++VL  S A   T     +   +LV FY PWCG CK + P+Y KA+T+L
Sbjct: 137 EEDPAGKDVLHFSDAASFTKHLRKDIRPMLVMFYVPWCGFCKKMKPDYGKASTEL 191



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = +1

Query: 265 VDATQEQDLAESYGVRGYPTLKFFRN-GSPIDYSGGRQADDIISWL 399
           +D T+   L   Y VRGYPT+ +F    + +DY+GGR + D I+++
Sbjct: 453 IDCTKLAALCAKYNVRGYPTILYFSYLKTKLDYNGGRTSKDFIAYM 498



 Score = 31.1 bits (67), Expect = 1.4
 Identities = 19/81 (23%), Positives = 39/81 (48%), Gaps = 3/81 (3%)
 Frame = +1

Query: 250 YQLAKVDATQEQD--LAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKTGPP 420
           Y LA ++  ++++  + + + + G+PTL +F NG     Y G    + ++S++      P
Sbjct: 197 YILAAMNVERQENAPIRKMFNITGFPTLIYFENGKLRFTYEGENNKEALVSFMLNPNAKP 256

Query: 421 AVEVTSAEQAKELIDANTVIV 483
             +    E +    D N+ IV
Sbjct: 257 TPKPKEPEWS---ADTNSEIV 274


>AE014134-2339|AAF53293.1|  510|Drosophila melanogaster CG9302-PA
           protein.
          Length = 510

 Score = 58.8 bits (136), Expect = 6e-09
 Identities = 23/55 (41%), Positives = 34/55 (61%)
 Frame = +2

Query: 86  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESP 250
           T   ++ L+   FE  +   +  LV FYAPWCGHCK + PEY KAA ++ +++ P
Sbjct: 269 TNSEIVHLTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIP 323



 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 24/56 (42%), Positives = 33/56 (58%)
 Frame = +2

Query: 74  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 241
           +E    + VL L   NF + +   ++ LV FYAPWCGHCK   PE+  AAT L ++
Sbjct: 390 EEEEDSKEVLFLDDDNFSSTLKRKKHALVMFYAPWCGHCKHTKPEFTAAATALQDD 445



 Score = 51.6 bits (118), Expect = 9e-07
 Identities = 25/61 (40%), Positives = 37/61 (60%)
 Frame = +1

Query: 238 RRISYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGP 417
           ++I   LA +DAT+E  +AE Y V+GYPT+KFF NG        R+A  I+ +++    P
Sbjct: 320 KKIPGLLAALDATKEPSIAEKYKVKGYPTVKFFSNGVFKFEVNVREASKIVEFMRDPKEP 379

Query: 418 P 420
           P
Sbjct: 380 P 380



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 2/55 (3%)
 Frame = +2

Query: 74  DEVPTEENVLVLSKANFETVITTTEY--ILVEFYAPWCGHCKSLAPEYAKAATKL 232
           +E P  ++VL  S A   T     +   +LV FY PWCG CK + PEY KA+T+L
Sbjct: 137 EEDPAGKDVLHFSDAASFTKHLRKDIRPMLVMFYVPWCGFCKKMKPEYGKASTEL 191



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = +1

Query: 265 VDATQEQDLAESYGVRGYPTLKFFRN-GSPIDYSGGRQADDIISWL 399
           +D T+   L   Y VRGYPT+ +F    + +DY+GGR + D I+++
Sbjct: 453 IDCTKLAALCAKYNVRGYPTILYFSYLKTKLDYNGGRTSKDFIAYM 498



 Score = 31.1 bits (67), Expect = 1.4
 Identities = 19/81 (23%), Positives = 39/81 (48%), Gaps = 3/81 (3%)
 Frame = +1

Query: 250 YQLAKVDATQEQD--LAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKTGPP 420
           Y LA ++  ++++  + + + + G+PTL +F NG     Y G    + ++S++      P
Sbjct: 197 YILAAMNVERQENAPIRKMFNITGFPTLIYFENGKLRFTYEGENNKEALVSFMLNPNAKP 256

Query: 421 AVEVTSAEQAKELIDANTVIV 483
             +    E +    D N+ IV
Sbjct: 257 TPKPKEPEWS---ADTNSEIV 274


>AY060296-1|AAL25335.1|  364|Drosophila melanogaster GH13982p
           protein.
          Length = 364

 Score = 55.6 bits (128), Expect = 6e-08
 Identities = 30/71 (42%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +2

Query: 98  VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIN*RKLTQ 274
           V V    NF+  VI   +  L+EFYAPWCGHCK L+P Y + A KL +E+  I   K+  
Sbjct: 241 VKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDVAI--VKMDA 298

Query: 275 LKNRISPRATV 307
             N + P   V
Sbjct: 299 TANDVPPEFNV 309



 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 3/54 (5%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKK 408
           + K+DAT   D+   + VRG+PTL +        P+ Y+GGR+ DD + ++ K+
Sbjct: 293 IVKMDATAN-DVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKE 345



 Score = 29.9 bits (64), Expect = 3.3
 Identities = 15/79 (18%), Positives = 33/79 (41%)
 Frame = +1

Query: 397 LKKKTGPPAVEVTSAEQAKELIDANTVIVFGFFSDQS*PEPKLSFQXXXXXXXXXXXXSA 576
           ++ + GP +  V +  + K+ +D     +FG+FSD      K+  +             +
Sbjct: 1   MRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYRFGHS 60

Query: 577 MRK*FKELEAEDEDVVLFK 633
             K   + + E + +VL +
Sbjct: 61  SEKEVLDKQGETDKIVLIR 79


>AE013599-1356|AAM68697.1|  364|Drosophila melanogaster CG8983-PB,
           isoform B protein.
          Length = 364

 Score = 55.6 bits (128), Expect = 6e-08
 Identities = 30/71 (42%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +2

Query: 98  VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEESPIN*RKLTQ 274
           V V    NF+  VI   +  L+EFYAPWCGHCK L+P Y + A KL +E+  I   K+  
Sbjct: 241 VKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDVAI--VKMDA 298

Query: 275 LKNRISPRATV 307
             N + P   V
Sbjct: 299 TANDVPPEFNV 309



 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 3/54 (5%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFF---RNGSPIDYSGGRQADDIISWLKKK 408
           + K+DAT   D+   + VRG+PTL +        P+ Y+GGR+ DD + ++ K+
Sbjct: 293 IVKMDATAN-DVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKE 345



 Score = 29.9 bits (64), Expect = 3.3
 Identities = 15/79 (18%), Positives = 33/79 (41%)
 Frame = +1

Query: 397 LKKKTGPPAVEVTSAEQAKELIDANTVIVFGFFSDQS*PEPKLSFQXXXXXXXXXXXXSA 576
           ++ + GP +  V +  + K+ +D     +FG+FSD      K+  +             +
Sbjct: 1   MRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYRFGHS 60

Query: 577 MRK*FKELEAEDEDVVLFK 633
             K   + + E + +VL +
Sbjct: 61  SEKEVLDKQGETDKIVLIR 79


>AY058697-1|AAL13926.1|  412|Drosophila melanogaster LD41494p
           protein.
          Length = 412

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 2/89 (2%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPAVE 429
           L KVD  +E  +A  + +  YPTLK  RNG  S  +Y G R A+  + ++KK+   P  E
Sbjct: 91  LGKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPIQE 150

Query: 430 VTSAEQAKELIDANTVIVFGFFSDQS*PE 516
             S +  + L D+   ++ G+F  +  PE
Sbjct: 151 FKSLKDLENL-DSKKRLILGYFDRRDQPE 178



 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +2

Query: 47  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 226
           +A+L L    +       + ++  N +  + + E + + FYA WC     LAP +A+AA 
Sbjct: 18  VAILQLLQYTQPADAAGAVPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAAD 77

Query: 227 KLAEE 241
           K+ EE
Sbjct: 78  KIKEE 82


>AE014298-2355|AAN09391.1|  375|Drosophila melanogaster CG9911-PC,
           isoform C protein.
          Length = 375

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 2/89 (2%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPAVE 429
           L KVD  +E  +A  + +  YPTLK  RNG  S  +Y G R A+  + ++KK+   P  E
Sbjct: 54  LGKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPIQE 113

Query: 430 VTSAEQAKELIDANTVIVFGFFSDQS*PE 516
             S +  + L D+   ++ G+F  +  PE
Sbjct: 114 FKSLKDLENL-DSKKRLILGYFDRRDQPE 141



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 16/45 (35%), Positives = 26/45 (57%)
 Frame = +2

Query: 107 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 241
           ++  N +  + + E + + FYA WC     LAP +A+AA K+ EE
Sbjct: 1   MTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAADKIKEE 45


>AE014298-2354|AAF48579.2|  412|Drosophila melanogaster CG9911-PD,
           isoform D protein.
          Length = 412

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 2/89 (2%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPAVE 429
           L KVD  +E  +A  + +  YPTLK  RNG  S  +Y G R A+  + ++KK+   P  E
Sbjct: 91  LGKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPIQE 150

Query: 430 VTSAEQAKELIDANTVIVFGFFSDQS*PE 516
             S +  + L D+   ++ G+F  +  PE
Sbjct: 151 FKSLKDLENL-DSKKRLILGYFDRRDQPE 178



 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +2

Query: 47  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 226
           +A+L L    +       + ++  N +  + + E + + FYA WC     LAP +A+AA 
Sbjct: 18  VAILQLLQYTQPADAAGAVPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAAD 77

Query: 227 KLAEE 241
           K+ EE
Sbjct: 78  KIKEE 82


>AE014298-2353|AAN09390.1|  412|Drosophila melanogaster CG9911-PB,
           isoform B protein.
          Length = 412

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 2/89 (2%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPAVE 429
           L KVD  +E  +A  + +  YPTLK  RNG  S  +Y G R A+  + ++KK+   P  E
Sbjct: 91  LGKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPIQE 150

Query: 430 VTSAEQAKELIDANTVIVFGFFSDQS*PE 516
             S +  + L D+   ++ G+F  +  PE
Sbjct: 151 FKSLKDLENL-DSKKRLILGYFDRRDQPE 178



 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +2

Query: 47  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 226
           +A+L L    +       + ++  N +  + + E + + FYA WC     LAP +A+AA 
Sbjct: 18  VAILQLLQYTQPADAAGAVPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAAD 77

Query: 227 KLAEE 241
           K+ EE
Sbjct: 78  KIKEE 82


>AE014298-2352|AAF48580.2|  412|Drosophila melanogaster CG9911-PA,
           isoform A protein.
          Length = 412

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 2/89 (2%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPAVE 429
           L KVD  +E  +A  + +  YPTLK  RNG  S  +Y G R A+  + ++KK+   P  E
Sbjct: 91  LGKVDCDKETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPIQE 150

Query: 430 VTSAEQAKELIDANTVIVFGFFSDQS*PE 516
             S +  + L D+   ++ G+F  +  PE
Sbjct: 151 FKSLKDLENL-DSKKRLILGYFDRRDQPE 178



 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +2

Query: 47  IALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAAT 226
           +A+L L    +       + ++  N +  + + E + + FYA WC     LAP +A+AA 
Sbjct: 18  VAILQLLQYTQPADAAGAVPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAAD 77

Query: 227 KLAEE 241
           K+ EE
Sbjct: 78  KIKEE 82


>AY051696-1|AAK93120.1|  430|Drosophila melanogaster LD24073p
           protein.
          Length = 430

 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 24/84 (28%), Positives = 44/84 (52%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEV 432
           ++ ++D T+    A+ + VRGYPT+ F +      Y+G R  D+++ +  + +GPP   V
Sbjct: 76  RVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNMEFTYNGDRGRDELVDYALRMSGPPVQLV 135

Query: 433 TSAEQAKELIDANTVIVFGFFSDQ 504
           T  E   +++  +  I F F   Q
Sbjct: 136 TRTESV-DMLKGSHTIFFIFVGQQ 158



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 28/66 (42%), Positives = 33/66 (50%)
 Frame = +2

Query: 35  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 214
           IF  I+ L L LG        VL LS   F  V    ++ LV FYAPWCG+CK   P +A
Sbjct: 8   IFGLISALLLTLGS-TGLSSKVLELSD-RFIDVRHEGQW-LVMFYAPWCGYCKKTEPIFA 64

Query: 215 KAATKL 232
             A  L
Sbjct: 65  LVAQAL 70


>AE014296-2661|AAF49525.3|  430|Drosophila melanogaster CG5027-PA
           protein.
          Length = 430

 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 24/84 (28%), Positives = 44/84 (52%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEV 432
           ++ ++D T+    A+ + VRGYPT+ F +      Y+G R  D+++ +  + +GPP   V
Sbjct: 76  RVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNMEFTYNGDRGRDELVDYALRMSGPPVQLV 135

Query: 433 TSAEQAKELIDANTVIVFGFFSDQ 504
           T  E   +++  +  I F F   Q
Sbjct: 136 TRTESV-DMLKGSHTIFFIFVGQQ 158



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 28/66 (42%), Positives = 33/66 (50%)
 Frame = +2

Query: 35  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 214
           IF  I+ L L LG        VL LS   F  V    ++ LV FYAPWCG+CK   P +A
Sbjct: 8   IFGLISALLLTLGS-TGLSSKVLELSD-RFIDVRHEGQW-LVMFYAPWCGYCKKTEPIFA 64

Query: 215 KAATKL 232
             A  L
Sbjct: 65  LVAQAL 70


>AY051709-1|AAK93133.1|  416|Drosophila melanogaster LD24756p
           protein.
          Length = 416

 Score = 49.2 bits (112), Expect = 5e-06
 Identities = 23/70 (32%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVEV 432
           ++K+D TQ + + + + V+GYPTL +  +G  I+ YSG R    + ++++K  G P +E 
Sbjct: 219 ISKIDCTQFRSICQDFEVKGYPTLLWIEDGKKIEKYSGARDLSTLKTYVEKMVGVP-LEK 277

Query: 433 TSAEQAKELI 462
           T+ E   E +
Sbjct: 278 TAGEAGDEKV 287



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 2/72 (2%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPAVE 429
           +AKVD T+ Q L  ++ V GYPTL+ F+ G    + + G R    I  ++ K+   PA E
Sbjct: 91  IAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELSAPA-E 149

Query: 430 VTSAEQAKELID 465
               E  +E ++
Sbjct: 150 ADLGEVKREQVE 161



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 158 VEFYAPWCGHCKSLAPEYAKAATKLAEEESPIN*RKL 268
           ++FYAPWCGHC+ L P + + AT+  + +S +   K+
Sbjct: 324 IKFYAPWCGHCQKLQPTWEQLATETHQAQSSVKIAKV 360



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 18/48 (37%), Positives = 30/48 (62%)
 Frame = +2

Query: 98  VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 241
           V+ L++  F   ++T  +  V+F+APWC HC+ LAP +   A +L +E
Sbjct: 168 VVDLTEDTFAKHVSTGNHF-VKFFAPWCSHCQRLAPTWEDLAKELIKE 214



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +2

Query: 107 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 223
           L    F+T I     + V+F+APWCGHCK + P + + A
Sbjct: 42  LDPETFDTAIAGGN-VFVKFFAPWCGHCKRIQPLWEQLA 79



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 3/59 (5%)
 Frame = +1

Query: 247 SYQLAKVDAT--QEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKTG 414
           S ++AKVD T  + + +     V GYPTL  ++NG    +Y G R   ++ ++LKK  G
Sbjct: 354 SVKIAKVDCTAPENKQVCIDQQVEGYPTLFLYKNGQRQNEYEGSRSLPELQAYLKKFLG 412


>AE014298-1673|AAF48082.2|  416|Drosophila melanogaster CG1837-PA
           protein.
          Length = 416

 Score = 49.2 bits (112), Expect = 5e-06
 Identities = 23/70 (32%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVEV 432
           ++K+D TQ + + + + V+GYPTL +  +G  I+ YSG R    + ++++K  G P +E 
Sbjct: 219 ISKIDCTQFRSICQDFEVKGYPTLLWIEDGKKIEKYSGARDLSTLKTYVEKMVGVP-LEK 277

Query: 433 TSAEQAKELI 462
           T+ E   E +
Sbjct: 278 TAGEAGDEKV 287



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 2/72 (2%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPAVE 429
           +AKVD T+ Q L  ++ V GYPTL+ F+ G    + + G R    I  ++ K+   PA E
Sbjct: 91  IAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELSAPA-E 149

Query: 430 VTSAEQAKELID 465
               E  +E ++
Sbjct: 150 ADLGEVKREQVE 161



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 15/37 (40%), Positives = 25/37 (67%)
 Frame = +2

Query: 158 VEFYAPWCGHCKSLAPEYAKAATKLAEEESPIN*RKL 268
           ++FYAPWCGHC+ L P + + AT+  + +S +   K+
Sbjct: 324 IKFYAPWCGHCQKLQPTWEQLATETHQAQSSVKIAKV 360



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 18/48 (37%), Positives = 30/48 (62%)
 Frame = +2

Query: 98  VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 241
           V+ L++  F   ++T  +  V+F+APWC HC+ LAP +   A +L +E
Sbjct: 168 VVDLTEDTFAKHVSTGNHF-VKFFAPWCSHCQRLAPTWEDLAKELIKE 214



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +2

Query: 107 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 223
           L    F+T I     + V+F+APWCGHCK + P + + A
Sbjct: 42  LDPETFDTAIAGGN-VFVKFFAPWCGHCKRIQPLWEQLA 79



 Score = 38.3 bits (85), Expect = 0.009
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 3/59 (5%)
 Frame = +1

Query: 247 SYQLAKVDAT--QEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKTG 414
           S ++AKVD T  + + +     V GYPTL  ++NG    +Y G R   ++ ++LKK  G
Sbjct: 354 SVKIAKVDCTAPENKQVCIDQQVEGYPTLFLYKNGQRQNEYEGSRSLPELQAYLKKFLG 412


>AE014297-599|AAF54029.1|  410|Drosophila melanogaster CG10029-PA
           protein.
          Length = 410

 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 2/82 (2%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTGPPAVE 429
           L KV+   E  LA+ + +  YPT+K  RNG     +Y G R  + +  +++K+   P  E
Sbjct: 85  LGKVNCDTEDILADQFDILKYPTIKIVRNGLIGNQEYRGQRSVEALFQFVEKELSDPIKE 144

Query: 430 VTSAEQAKELIDANTVIVFGFF 495
             + +  K  +D    IV G+F
Sbjct: 145 FHNIDDLKN-VDVGYGIVIGYF 165



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 19/69 (27%), Positives = 39/69 (56%)
 Frame = +2

Query: 35  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 214
           I  ++A+L ++L   V    +V+ ++  N + +I + E +L+ FY  WC   + L P + 
Sbjct: 9   ILYSLAIL-VSLHSLVAGNSSVVAVTHENLQGIIDSNELVLLSFYTDWCRFSQILQPIFE 67

Query: 215 KAATKLAEE 241
           +AA K+ ++
Sbjct: 68  EAAAKVIQK 76


>AF216975-1|AAF34749.1|  857|Drosophila melanogaster l(2)01289 H9
           form protein.
          Length = 857

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 20/80 (25%), Positives = 43/80 (53%), Gaps = 4/80 (5%)
 Frame = +1

Query: 274 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSA 441
           T++  +A+ Y V+ YP L FFRN  P+ ++G     D++++W+        P  +E  + 
Sbjct: 423 TEDTGIAKKYNVKTYPRLVFFRNRDPLHFTGDLDDEDEVLAWITDDETLEIPGKIEEVNV 482

Query: 442 EQAKELIDANTVIVFGFFSD 501
           +   +++  N  +V  F+++
Sbjct: 483 KMLDKILAENDHVVVFFYAE 502



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 5/80 (6%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD----DIISWLKKKTGPPAVEVTSAEQ 447
           ++ LA+ YG++ +P L +FR   PI Y G    +    D ++ L+    P  +E  +A+ 
Sbjct: 105 DKRLAKQYGIKNFPALTYFREKEPIIYDGDLMDEEGVLDFLTSLEAMDLPDRIEEVNAKI 164

Query: 448 AKELI-DANTVIVFGFFSDQ 504
            +++I D + V V  +  DQ
Sbjct: 165 LQKIIEDTDFVAVLFYDKDQ 184



 Score = 33.5 bits (73), Expect = 0.27
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 1/68 (1%)
 Frame = +1

Query: 292 AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVTSAEQAKELIDA 468
           A+ YG+   P L +F N  P  Y G     D+++ WL  +     +E  + E    LI+ 
Sbjct: 322 AKEYGLDHLPALIYFENKIPALYEGDLMNEDEVLEWLLVQKKTATIEEVTDEILVTLINE 381

Query: 469 NTVIVFGF 492
           +  +V  F
Sbjct: 382 HEYVVVFF 389



 Score = 29.9 bits (64), Expect = 3.3
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 4/81 (4%)
 Frame = +1

Query: 274 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWL--KKKTGPPAVEVTSAE 444
           T + D+ + Y + G P L F+R+     Y+G   + ++I+ W+    ++    +E    +
Sbjct: 531 TSDDDIDKEYDLPGLPALAFYRHKFRTIYTGDLMKEEEILEWVIDLHESTADVIESVDRK 590

Query: 445 QAKELI-DANTVIVFGFFSDQ 504
             + LI D   + VF F+ D+
Sbjct: 591 TLQVLINDVEHLAVF-FYDDE 610


>AF216973-2|AAF34747.1|  857|Drosophila melanogaster l(2)01289 H9
           form protein.
          Length = 857

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 20/80 (25%), Positives = 43/80 (53%), Gaps = 4/80 (5%)
 Frame = +1

Query: 274 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSA 441
           T++  +A+ Y V+ YP L FFRN  P+ ++G     D++++W+        P  +E  + 
Sbjct: 423 TEDTGIAKKYNVKTYPRLVFFRNRDPLHFTGDLDDEDEVLAWITDDETLEIPGKIEEVNV 482

Query: 442 EQAKELIDANTVIVFGFFSD 501
           +   +++  N  +V  F+++
Sbjct: 483 KMLDKILAENDHVVVFFYAE 502



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 5/80 (6%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD----DIISWLKKKTGPPAVEVTSAEQ 447
           ++ LA+ YG++ +P L +FR   PI Y G    +    D ++ L+    P  +E  +A+ 
Sbjct: 105 DKRLAKQYGIKNFPALTYFREKEPIIYDGDLMDEEGVLDFLTSLEAMDLPDRIEEVNAKI 164

Query: 448 AKELI-DANTVIVFGFFSDQ 504
            +++I D + V V  +  DQ
Sbjct: 165 LQKIIEDTDFVAVLFYDKDQ 184



 Score = 33.5 bits (73), Expect = 0.27
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 1/68 (1%)
 Frame = +1

Query: 292 AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVTSAEQAKELIDA 468
           A+ YG+   P L +F N  P  Y G     D+++ WL  +     +E  + E    LI+ 
Sbjct: 322 AKEYGLDHLPALIYFENKIPALYEGDLMNEDEVLEWLLVQKKTATIEEVTDEILVTLINE 381

Query: 469 NTVIVFGF 492
           +  +V  F
Sbjct: 382 HEYVVVFF 389



 Score = 29.9 bits (64), Expect = 3.3
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 4/81 (4%)
 Frame = +1

Query: 274 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWL--KKKTGPPAVEVTSAE 444
           T + D+ + Y + G P L F+R+     Y+G   + ++I+ W+    ++    +E    +
Sbjct: 531 TSDDDIDKEYDLPGLPALAFYRHKFRTIYTGDLMKEEEILEWVIDLHESTADVIESVDRK 590

Query: 445 QAKELI-DANTVIVFGFFSDQ 504
             + LI D   + VF F+ D+
Sbjct: 591 TLQVLINDVEHLAVF-FYDDE 610


>AF216973-1|AAF34746.1| 1703|Drosophila melanogaster l(2)01289 long
           form protein.
          Length = 1703

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 20/80 (25%), Positives = 43/80 (53%), Gaps = 4/80 (5%)
 Frame = +1

Query: 274 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSA 441
           T++  +A+ Y V+ YP L FFRN  P+ ++G     D++++W+        P  +E  + 
Sbjct: 754 TEDTGIAKKYNVKTYPRLVFFRNRDPLHFTGDLDDEDEVLAWITDDETLEIPGKIEEVNV 813

Query: 442 EQAKELIDANTVIVFGFFSD 501
           +   +++  N  +V  F+++
Sbjct: 814 KMLDKILAENDHVVVFFYAE 833



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 4/79 (5%)
 Frame = +1

Query: 277  QEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD-DIISWL---KKKTGPPAVEVTSAE 444
            Q+  LA+ Y ++ +P L +FRNG+P+ + G  Q +  ++ WL     +     +E  +  
Sbjct: 1397 QDPQLAKRYSIKTFPALVYFRNGNPLLFEGDLQNEQSVLEWLIDDDNRELADEIEEVNER 1456

Query: 445  QAKELIDANTVIVFGFFSD 501
                L+  +T++V  F+ D
Sbjct: 1457 MLDRLMAESTLLVVFFYDD 1475



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 16/75 (21%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +1

Query: 274  TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVTSAEQA 450
            T++  +A+ YGV  YP L +F  G P  + G   + ++++ WL  +     +E+ + +  
Sbjct: 1291 TRDFSVADGYGVHEYPALVYFEGGIPNVFEGELSEEEEVLQWLITQKTEDRIELITRQML 1350

Query: 451  KELIDANTVIVFGFF 495
            + +++    +   F+
Sbjct: 1351 ETMVEETQYLAVYFY 1365



 Score = 38.7 bits (86), Expect = 0.007
 Identities = 21/86 (24%), Positives = 42/86 (48%), Gaps = 4/86 (4%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD----DIISWLKKKTGPPAVEVTSAEQ 447
           ++ LA+ YG++ +P L +FR   PI Y G    +    D ++ L+    P  +E  +A+ 
Sbjct: 105 DKRLAKQYGIKNFPALTYFREKEPIIYDGDLMDEEGVLDFLTSLEAMDLPDRIEEVNAKI 164

Query: 448 AKELIDANTVIVFGFFSDQS*PEPKL 525
            +++I+    +   F  D     P++
Sbjct: 165 LQKIIEDTDFVAVLFCPDHETCPPRV 190



 Score = 36.3 bits (80), Expect = 0.038
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 7/76 (9%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQ-ADDIISWL--KKKTG--PPAVEVTSAE 444
           ++ LA+ Y +   P L ++R+ +PI Y G  Q  +D++ WL   K TG     +E  +++
Sbjct: 225 DEALADEYNLGNLPALVYYRHQTPIIYEGELQREEDVLEWLVQNKSTGDEDDVIEDVTSK 284

Query: 445 QAKELID--ANTVIVF 486
               LI    N V++F
Sbjct: 285 TLSTLISNIDNLVVLF 300



 Score = 36.3 bits (80), Expect = 0.038
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 5/79 (6%)
 Frame = +1

Query: 280  EQDLAESYGVRGYPTLKFFRNGS--PIDYSGG-RQADDIISWL--KKKTGPPAVEVTSAE 444
            ++ +A+ YGV   P + FF+  S  P+ Y+G   + + I++WL  +K      +E    E
Sbjct: 1184 DKQMAKEYGVFALPAIVFFKPTSKEPVIYAGDLYEEEQILTWLITQKDPSGDVIEDLEGE 1243

Query: 445  QAKELIDANTVIVFGFFSD 501
            +   LI+ +  I   F++D
Sbjct: 1244 RLVHLIEESGSIAVYFYAD 1262



 Score = 35.9 bits (79), Expect = 0.050
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 289  LAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVT 435
            +A+ YG R  P L +FR G  I+Y G     ++++ WL   T P  +E+T
Sbjct: 1079 MAKKYGFRNPPGLTYFRKGKYINYDGDIDDEEEVLDWL---TSPANMEMT 1125



 Score = 34.7 bits (76), Expect = 0.12
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADD-IISWLKKKTGPPAVEVTS 438
           K+D  +E   A  YG+   P L +F  G P  Y G  + ++ ++ WL  +T    +E  +
Sbjct: 436 KIDNPEE---AVEYGINKVPKLIYFEKGIPTIYEGNLEDEEKLLKWLTDQTSSDQIEDIT 492

Query: 439 AEQAKELID 465
            E    +I+
Sbjct: 493 DEMLDLIIE 501



 Score = 33.5 bits (73), Expect = 0.27
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 1/68 (1%)
 Frame = +1

Query: 292 AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVTSAEQAKELIDA 468
           A+ YG+   P L +F N  P  Y G     D+++ WL  +     +E  + E    LI+ 
Sbjct: 653 AKEYGLDHLPALIYFENKIPALYEGDLMNEDEVLEWLLVQKKTATIEEVTDEILVTLINE 712

Query: 469 NTVIVFGF 492
           +  +V  F
Sbjct: 713 HEYVVVFF 720



 Score = 31.9 bits (69), Expect = 0.82
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 4/79 (5%)
 Frame = +1

Query: 292  AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSAEQAKEL 459
            A+ Y +   P+L +FR   P+ Y G   Q D +I+WL  +        +E  + +   +L
Sbjct: 1510 AKKYEIVNIPSLVYFRKQVPVLYDGDLHQHDKVITWLTSQDVFEIKNEIEEVNRKMLDKL 1569

Query: 460  IDANTVIVFGFFSDQS*PE 516
            ++ N  +   FF + + P+
Sbjct: 1570 LEENEFLAV-FFYEHNQPD 1587



 Score = 30.7 bits (66), Expect = 1.9
 Identities = 20/84 (23%), Positives = 33/84 (39%), Gaps = 1/84 (1%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVE 429
           Q  K+D   +   A  YG+   P + +F    P  Y G     + I+ WL  +     +E
Sbjct: 328 QFVKID---DAKAAADYGIDSIPAIVYFEKEIPNVYDGDLMDEEQILKWLLGQLERDEIE 384

Query: 430 VTSAEQAKELIDANTVIVFGFFSD 501
             + E    +I    VI   F+ +
Sbjct: 385 DVTDEMLDTMIKEGRVIAVLFYDN 408



 Score = 30.3 bits (65), Expect = 2.5
 Identities = 11/38 (28%), Positives = 22/38 (57%)
 Frame = +2

Query: 86   TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 199
            TE+ + ++++   ET++  T+Y+ V FY   C  C  +
Sbjct: 1338 TEDRIELITRQMLETMVEETQYLAVYFYKINCNICDQI 1375



 Score = 29.9 bits (64), Expect = 3.3
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 4/81 (4%)
 Frame = +1

Query: 274  TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWL--KKKTGPPAVEVTSAE 444
            T + D+ + Y + G P L F+R+     Y+G   + ++I+ W+    ++    +E    +
Sbjct: 862  TSDDDIDKEYDLPGLPALAFYRHKFRTIYTGDLMKEEEILEWVIDLHESTADVIESVDRK 921

Query: 445  QAKELI-DANTVIVFGFFSDQ 504
              + LI D   + VF F+ D+
Sbjct: 922  TLQVLINDVEHLAVF-FYDDE 941



 Score = 29.9 bits (64), Expect = 3.3
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +1

Query: 292  AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKK 405
            A+ +GV   P + +FR   P  Y G     D+++ WL+K
Sbjct: 1618 AKKWGVTKLPAMVYFRRRFPSIYRGDLLSEDEVLEWLRK 1656


>AE013599-216|AAM70821.2|  857|Drosophila melanogaster CG9432-PA,
           isoform A protein.
          Length = 857

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 20/80 (25%), Positives = 43/80 (53%), Gaps = 4/80 (5%)
 Frame = +1

Query: 274 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSA 441
           T++  +A+ Y V+ YP L FFRN  P+ ++G     D++++W+        P  +E  + 
Sbjct: 423 TEDTGIAKKYNVKTYPRLVFFRNRDPLHFTGDLDDEDEVLAWITDDETLEIPGKIEEVNV 482

Query: 442 EQAKELIDANTVIVFGFFSD 501
           +   +++  N  +V  F+++
Sbjct: 483 KMLDKILAENDHVVVFFYAE 502



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 5/80 (6%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD----DIISWLKKKTGPPAVEVTSAEQ 447
           ++ LA+ YG++ +P L +FR   PI Y G    +    D ++ L+    P  +E  +A+ 
Sbjct: 105 DKRLAKQYGIKNFPALTYFREKEPIIYDGDLMDEEGVLDFLTSLEAMDLPDRIEEVNAKI 164

Query: 448 AKELI-DANTVIVFGFFSDQ 504
            +++I D + V V  +  DQ
Sbjct: 165 LQKIIEDTDFVAVLFYDKDQ 184



 Score = 33.5 bits (73), Expect = 0.27
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 1/68 (1%)
 Frame = +1

Query: 292 AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVTSAEQAKELIDA 468
           A+ YG+   P L +F N  P  Y G     D+++ WL  +     +E  + E    LI+ 
Sbjct: 322 AKEYGLDHLPALIYFENKIPALYEGDLMNEDEVLEWLLVQKKTATIEEVTDEILVTLINE 381

Query: 469 NTVIVFGF 492
           +  +V  F
Sbjct: 382 HEYVVVFF 389



 Score = 29.9 bits (64), Expect = 3.3
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 4/81 (4%)
 Frame = +1

Query: 274 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWL--KKKTGPPAVEVTSAE 444
           T + D+ + Y + G P L F+R+     Y+G   + ++I+ W+    ++    +E    +
Sbjct: 531 TSDDDIDKEYDLPGLPALAFYRHKFRTIYTGDLMKEEEILEWVIDLHESTADVIESVDRK 590

Query: 445 QAKELI-DANTVIVFGFFSDQ 504
             + LI D   + VF F+ D+
Sbjct: 591 TLQVLINDVEHLAVF-FYDDE 610


>AE013599-215|ABI31026.1| 1855|Drosophila melanogaster CG9432-PD,
           isoform D protein.
          Length = 1855

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 20/80 (25%), Positives = 43/80 (53%), Gaps = 4/80 (5%)
 Frame = +1

Query: 274 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSA 441
           T++  +A+ Y V+ YP L FFRN  P+ ++G     D++++W+        P  +E  + 
Sbjct: 754 TEDTGIAKKYNVKTYPRLVFFRNRDPLHFTGDLDDEDEVLAWITDDETLEIPGKIEEVNV 813

Query: 442 EQAKELIDANTVIVFGFFSD 501
           +   +++  N  +V  F+++
Sbjct: 814 KMLDKILAENDHVVVFFYAE 833



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 4/79 (5%)
 Frame = +1

Query: 277  QEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD-DIISWL---KKKTGPPAVEVTSAE 444
            Q+  LA+ Y ++ +P L +FRNG+P+ + G  Q +  ++ WL     +     +E  +  
Sbjct: 1549 QDPQLAKRYSIKTFPALVYFRNGNPLLFEGDLQNEQSVLEWLIDDDNRELADEIEEVNER 1608

Query: 445  QAKELIDANTVIVFGFFSD 501
                L+  +T++V  F+ D
Sbjct: 1609 MLDRLMAESTLLVVFFYDD 1627



 Score = 38.7 bits (86), Expect = 0.007
 Identities = 21/86 (24%), Positives = 42/86 (48%), Gaps = 4/86 (4%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD----DIISWLKKKTGPPAVEVTSAEQ 447
           ++ LA+ YG++ +P L +FR   PI Y G    +    D ++ L+    P  +E  +A+ 
Sbjct: 105 DKRLAKQYGIKNFPALTYFREKEPIIYDGDLMDEEGVLDFLTSLEAMDLPDRIEEVNAKI 164

Query: 448 AKELIDANTVIVFGFFSDQS*PEPKL 525
            +++I+    +   F  D     P++
Sbjct: 165 LQKIIEDTDFVAVLFCPDHETCPPRV 190



 Score = 36.3 bits (80), Expect = 0.038
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 7/76 (9%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQ-ADDIISWL--KKKTG--PPAVEVTSAE 444
           ++ LA+ Y +   P L ++R+ +PI Y G  Q  +D++ WL   K TG     +E  +++
Sbjct: 225 DEALADEYNLGNLPALVYYRHQTPIIYEGELQREEDVLEWLVQNKSTGDEDDVIEDVTSK 284

Query: 445 QAKELID--ANTVIVF 486
               LI    N V++F
Sbjct: 285 TLSTLISNIDNLVVLF 300



 Score = 35.9 bits (79), Expect = 0.050
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 289  LAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVT 435
            +A+ YG R  P L +FR G  I+Y G     ++++ WL   T P  +E+T
Sbjct: 1079 MAKKYGFRNPPGLTYFRKGKYINYDGDIDDEEEVLDWL---TSPANMEMT 1125



 Score = 34.7 bits (76), Expect = 0.12
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADD-IISWLKKKTGPPAVEVTS 438
           K+D  +E   A  YG+   P L +F  G P  Y G  + ++ ++ WL  +T    +E  +
Sbjct: 436 KIDNPEE---AVEYGINKVPKLIYFEKGIPTIYEGNLEDEEKLLKWLTDQTSSDQIEDIT 492

Query: 439 AEQAKELID 465
            E    +I+
Sbjct: 493 DEMLDLIIE 501



 Score = 33.5 bits (73), Expect = 0.27
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 1/68 (1%)
 Frame = +1

Query: 292 AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVTSAEQAKELIDA 468
           A+ YG+   P L +F N  P  Y G     D+++ WL  +     +E  + E    LI+ 
Sbjct: 653 AKEYGLDHLPALIYFENKIPALYEGDLMNEDEVLEWLLVQKKTATIEEVTDEILVTLINE 712

Query: 469 NTVIVFGF 492
           +  +V  F
Sbjct: 713 HEYVVVFF 720



 Score = 33.1 bits (72), Expect = 0.35
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 5/78 (6%)
 Frame = +1

Query: 280  EQDLAESYGVRGYPTLKFFRNGS--PIDYSGG-RQADDIISWL--KKKTGPPAVEVTSAE 444
            ++ +A+ YGV   P + FF+  S  P+ Y+G   + + I++WL  +K      +E    E
Sbjct: 1184 DKQMAKEYGVFALPAIVFFKPTSKEPVIYAGDLYEEEQILTWLITQKDPSGDVIEDLEGE 1243

Query: 445  QAKELIDANTVIVFGFFS 498
            +   LI+ +  I   F++
Sbjct: 1244 RLVHLIEESGSIAVYFWN 1261



 Score = 31.9 bits (69), Expect = 0.82
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 4/79 (5%)
 Frame = +1

Query: 292  AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSAEQAKEL 459
            A+ Y +   P+L +FR   P+ Y G   Q D +I+WL  +        +E  + +   +L
Sbjct: 1662 AKKYEIVNIPSLVYFRKQVPVLYDGDLHQHDKVITWLTSQDVFEIKNEIEEVNRKMLDKL 1721

Query: 460  IDANTVIVFGFFSDQS*PE 516
            ++ N  +   FF + + P+
Sbjct: 1722 LEENEFLAV-FFYEHNQPD 1739



 Score = 30.7 bits (66), Expect = 1.9
 Identities = 20/84 (23%), Positives = 33/84 (39%), Gaps = 1/84 (1%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVE 429
           Q  K+D   +   A  YG+   P + +F    P  Y G     + I+ WL  +     +E
Sbjct: 328 QFVKID---DAKAAADYGIDSIPAIVYFEKEIPNVYDGDLMDEEQILKWLLGQLERDEIE 384

Query: 430 VTSAEQAKELIDANTVIVFGFFSD 501
             + E    +I    VI   F+ +
Sbjct: 385 DVTDEMLDTMIKEGRVIAVLFYDN 408



 Score = 29.9 bits (64), Expect = 3.3
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 4/81 (4%)
 Frame = +1

Query: 274  TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWL--KKKTGPPAVEVTSAE 444
            T + D+ + Y + G P L F+R+     Y+G   + ++I+ W+    ++    +E    +
Sbjct: 862  TSDDDIDKEYDLPGLPALAFYRHKFRTIYTGDLMKEEEILEWVIDLHESTADVIESVDRK 921

Query: 445  QAKELI-DANTVIVFGFFSDQ 504
              + LI D   + VF F+ D+
Sbjct: 922  TLQVLINDVEHLAVF-FYDDE 941



 Score = 29.9 bits (64), Expect = 3.3
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +1

Query: 292  AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKK 405
            A+ +GV   P + +FR   P  Y G     D+++ WL+K
Sbjct: 1770 AKKWGVTKLPAMVYFRRRFPSIYRGDLLSEDEVLEWLRK 1808



 Score = 29.5 bits (63), Expect = 4.4
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +1

Query: 274  TQEQDLAESYGVRGYPTLKFFRNGSP 351
            T++  +A+ YGV  YP L +F  G P
Sbjct: 1374 TRDFSVADGYGVHEYPALVYFEGGIP 1399


>AE013599-214|AAN16126.1| 1703|Drosophila melanogaster CG9432-PB,
           isoform B protein.
          Length = 1703

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 20/80 (25%), Positives = 43/80 (53%), Gaps = 4/80 (5%)
 Frame = +1

Query: 274 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSA 441
           T++  +A+ Y V+ YP L FFRN  P+ ++G     D++++W+        P  +E  + 
Sbjct: 754 TEDTGIAKKYNVKTYPRLVFFRNRDPLHFTGDLDDEDEVLAWITDDETLEIPGKIEEVNV 813

Query: 442 EQAKELIDANTVIVFGFFSD 501
           +   +++  N  +V  F+++
Sbjct: 814 KMLDKILAENDHVVVFFYAE 833



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 4/79 (5%)
 Frame = +1

Query: 277  QEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD-DIISWL---KKKTGPPAVEVTSAE 444
            Q+  LA+ Y ++ +P L +FRNG+P+ + G  Q +  ++ WL     +     +E  +  
Sbjct: 1397 QDPQLAKRYSIKTFPALVYFRNGNPLLFEGDLQNEQSVLEWLIDDDNRELADEIEEVNER 1456

Query: 445  QAKELIDANTVIVFGFFSD 501
                L+  +T++V  F+ D
Sbjct: 1457 MLDRLMAESTLLVVFFYDD 1475



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 16/75 (21%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +1

Query: 274  TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVTSAEQA 450
            T++  +A+ YGV  YP L +F  G P  + G   + ++++ WL  +     +E+ + +  
Sbjct: 1291 TRDFSVADGYGVHEYPALVYFEGGIPNVFEGELSEEEEVLQWLITQKTEDRIELITRQML 1350

Query: 451  KELIDANTVIVFGFF 495
            + +++    +   F+
Sbjct: 1351 ETMVEETQYLAVYFY 1365



 Score = 38.7 bits (86), Expect = 0.007
 Identities = 21/86 (24%), Positives = 42/86 (48%), Gaps = 4/86 (4%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD----DIISWLKKKTGPPAVEVTSAEQ 447
           ++ LA+ YG++ +P L +FR   PI Y G    +    D ++ L+    P  +E  +A+ 
Sbjct: 105 DKRLAKQYGIKNFPALTYFREKEPIIYDGDLMDEEGVLDFLTSLEAMDLPDRIEEVNAKI 164

Query: 448 AKELIDANTVIVFGFFSDQS*PEPKL 525
            +++I+    +   F  D     P++
Sbjct: 165 LQKIIEDTDFVAVLFCPDHETCPPRV 190



 Score = 36.3 bits (80), Expect = 0.038
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 7/76 (9%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQ-ADDIISWL--KKKTG--PPAVEVTSAE 444
           ++ LA+ Y +   P L ++R+ +PI Y G  Q  +D++ WL   K TG     +E  +++
Sbjct: 225 DEALADEYNLGNLPALVYYRHQTPIIYEGELQREEDVLEWLVQNKSTGDEDDVIEDVTSK 284

Query: 445 QAKELID--ANTVIVF 486
               LI    N V++F
Sbjct: 285 TLSTLISNIDNLVVLF 300



 Score = 36.3 bits (80), Expect = 0.038
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 5/79 (6%)
 Frame = +1

Query: 280  EQDLAESYGVRGYPTLKFFRNGS--PIDYSGG-RQADDIISWL--KKKTGPPAVEVTSAE 444
            ++ +A+ YGV   P + FF+  S  P+ Y+G   + + I++WL  +K      +E    E
Sbjct: 1184 DKQMAKEYGVFALPAIVFFKPTSKEPVIYAGDLYEEEQILTWLITQKDPSGDVIEDLEGE 1243

Query: 445  QAKELIDANTVIVFGFFSD 501
            +   LI+ +  I   F++D
Sbjct: 1244 RLVHLIEESGSIAVYFYAD 1262



 Score = 35.9 bits (79), Expect = 0.050
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 289  LAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVT 435
            +A+ YG R  P L +FR G  I+Y G     ++++ WL   T P  +E+T
Sbjct: 1079 MAKKYGFRNPPGLTYFRKGKYINYDGDIDDEEEVLDWL---TSPANMEMT 1125



 Score = 34.7 bits (76), Expect = 0.12
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADD-IISWLKKKTGPPAVEVTS 438
           K+D  +E   A  YG+   P L +F  G P  Y G  + ++ ++ WL  +T    +E  +
Sbjct: 436 KIDNPEE---AVEYGINKVPKLIYFEKGIPTIYEGNLEDEEKLLKWLTDQTSSDQIEDIT 492

Query: 439 AEQAKELID 465
            E    +I+
Sbjct: 493 DEMLDLIIE 501



 Score = 33.5 bits (73), Expect = 0.27
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 1/68 (1%)
 Frame = +1

Query: 292 AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVTSAEQAKELIDA 468
           A+ YG+   P L +F N  P  Y G     D+++ WL  +     +E  + E    LI+ 
Sbjct: 653 AKEYGLDHLPALIYFENKIPALYEGDLMNEDEVLEWLLVQKKTATIEEVTDEILVTLINE 712

Query: 469 NTVIVFGF 492
           +  +V  F
Sbjct: 713 HEYVVVFF 720



 Score = 31.9 bits (69), Expect = 0.82
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 4/79 (5%)
 Frame = +1

Query: 292  AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSAEQAKEL 459
            A+ Y +   P+L +FR   P+ Y G   Q D +I+WL  +        +E  + +   +L
Sbjct: 1510 AKKYEIVNIPSLVYFRKQVPVLYDGDLHQHDKVITWLTSQDVFEIKNEIEEVNRKMLDKL 1569

Query: 460  IDANTVIVFGFFSDQS*PE 516
            ++ N  +   FF + + P+
Sbjct: 1570 LEENEFLAV-FFYEHNQPD 1587



 Score = 30.7 bits (66), Expect = 1.9
 Identities = 20/84 (23%), Positives = 33/84 (39%), Gaps = 1/84 (1%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVE 429
           Q  K+D   +   A  YG+   P + +F    P  Y G     + I+ WL  +     +E
Sbjct: 328 QFVKID---DAKAAADYGIDSIPAIVYFEKEIPNVYDGDLMDEEQILKWLLGQLERDEIE 384

Query: 430 VTSAEQAKELIDANTVIVFGFFSD 501
             + E    +I    VI   F+ +
Sbjct: 385 DVTDEMLDTMIKEGRVIAVLFYDN 408



 Score = 30.3 bits (65), Expect = 2.5
 Identities = 11/38 (28%), Positives = 22/38 (57%)
 Frame = +2

Query: 86   TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 199
            TE+ + ++++   ET++  T+Y+ V FY   C  C  +
Sbjct: 1338 TEDRIELITRQMLETMVEETQYLAVYFYKINCNICDQI 1375



 Score = 29.9 bits (64), Expect = 3.3
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 4/81 (4%)
 Frame = +1

Query: 274  TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWL--KKKTGPPAVEVTSAE 444
            T + D+ + Y + G P L F+R+     Y+G   + ++I+ W+    ++    +E    +
Sbjct: 862  TSDDDIDKEYDLPGLPALAFYRHKFRTIYTGDLMKEEEILEWVIDLHESTADVIESVDRK 921

Query: 445  QAKELI-DANTVIVFGFFSDQ 504
              + LI D   + VF F+ D+
Sbjct: 922  TLQVLINDVEHLAVF-FYDDE 941



 Score = 29.9 bits (64), Expect = 3.3
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +1

Query: 292  AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKK 405
            A+ +GV   P + +FR   P  Y G     D+++ WL+K
Sbjct: 1618 AKKWGVTKLPAMVYFRRRFPSIYRGDLLSEDEVLEWLRK 1656


>AF216977-1|AAF34751.1|  432|Drosophila melanogaster l(2)01289 long
           form protein.
          Length = 432

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 4/79 (5%)
 Frame = +1

Query: 277 QEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD-DIISWL---KKKTGPPAVEVTSAE 444
           Q+  LA+ Y ++ +P L +FRNG+P+ + G  Q +  ++ WL     +     +E  +  
Sbjct: 126 QDPQLAKRYSIKTFPALVYFRNGNPLLFEGDLQNEQSVLEWLIDDDNRELADEIEEVNER 185

Query: 445 QAKELIDANTVIVFGFFSD 501
               L+  +T++V  F+ D
Sbjct: 186 MLDRLMAESTLLVVFFYDD 204



 Score = 31.9 bits (69), Expect = 0.82
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 4/79 (5%)
 Frame = +1

Query: 292 AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSAEQAKEL 459
           A+ Y +   P+L +FR   P+ Y G   Q D +I+WL  +        +E  + +   +L
Sbjct: 239 AKKYEIVNIPSLVYFRKQVPVLYDGDLHQHDKVITWLTSQDVFEIKNEIEEVNRKMLDKL 298

Query: 460 IDANTVIVFGFFSDQS*PE 516
           ++ N  +   FF + + P+
Sbjct: 299 LEENEFLAV-FFYEHNQPD 316



 Score = 29.9 bits (64), Expect = 3.3
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +1

Query: 292 AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKK 405
           A+ +GV   P + +FR   P  Y G     D+++ WL+K
Sbjct: 347 AKKWGVTKLPAMVYFRRRFPSIYRGDLLSEDEVLEWLRK 385


>AF216976-1|AAF34750.1|  758|Drosophila melanogaster l(2)01289 long
           form protein.
          Length = 758

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 4/79 (5%)
 Frame = +1

Query: 277 QEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD-DIISWL---KKKTGPPAVEVTSAE 444
           Q+  LA+ Y ++ +P L +FRNG+P+ + G  Q +  ++ WL     +     +E  +  
Sbjct: 584 QDPQLAKRYSIKTFPALVYFRNGNPLLFEGDLQNEQSVLEWLIDDDNRELADEIEEVNER 643

Query: 445 QAKELIDANTVIVFGFFSD 501
               L+  +T++V  F+ D
Sbjct: 644 MLDRLMAESTLLVVFFYDD 662



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 16/75 (21%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +1

Query: 274 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVTSAEQA 450
           T++  +A+ YGV  YP L +F  G P  + G   + ++++ WL  +     +E+ + +  
Sbjct: 478 TRDFSVADGYGVHEYPALVYFEGGIPNVFEGELSEEEEVLQWLITQKTEDRIELITRQML 537

Query: 451 KELIDANTVIVFGFF 495
           + +++    +   F+
Sbjct: 538 ETMVEETQYLAVYFY 552



 Score = 36.3 bits (80), Expect = 0.038
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 5/79 (6%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGS--PIDYSGG-RQADDIISWL--KKKTGPPAVEVTSAE 444
           ++ +A+ YGV   P + FF+  S  P+ Y+G   + + I++WL  +K      +E    E
Sbjct: 371 DKQMAKEYGVFALPAIVFFKPTSKEPVIYAGDLYEEEQILTWLITQKDPSGDVIEDLEGE 430

Query: 445 QAKELIDANTVIVFGFFSD 501
           +   LI+ +  I   F++D
Sbjct: 431 RLVHLIEESGSIAVYFYAD 449



 Score = 35.9 bits (79), Expect = 0.050
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 289 LAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVT 435
           +A+ YG R  P L +FR G  I+Y G     ++++ WL   T P  +E+T
Sbjct: 266 MAKKYGFRNPPGLTYFRKGKYINYDGDIDDEEEVLDWL---TSPANMEMT 312



 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
 Frame = +1

Query: 292 AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWL 399
           A+ Y +   P+L +FR   P+ Y G   Q D +I+WL
Sbjct: 697 AKKYEIVNIPSLVYFRKQVPVLYDGDLHQHDKVITWL 733



 Score = 30.3 bits (65), Expect = 2.5
 Identities = 11/38 (28%), Positives = 22/38 (57%)
 Frame = +2

Query: 86  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 199
           TE+ + ++++   ET++  T+Y+ V FY   C  C  +
Sbjct: 525 TEDRIELITRQMLETMVEETQYLAVYFYKINCNICDQI 562



 Score = 29.9 bits (64), Expect = 3.3
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 4/81 (4%)
 Frame = +1

Query: 274 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWL--KKKTGPPAVEVTSAE 444
           T + D+ + Y + G P L F+R+     Y+G   + ++I+ W+    ++    +E    +
Sbjct: 49  TSDDDIDKEYDLPGLPALAFYRHKFRTIYTGDLMKEEEILEWVIDLHESTADVIESVDRK 108

Query: 445 QAKELI-DANTVIVFGFFSDQ 504
             + LI D   + VF F+ D+
Sbjct: 109 TLQVLINDVEHLAVF-FYDDE 128


>AE013599-213|ABI31025.1|  884|Drosophila melanogaster CG9432-PE,
           isoform E protein.
          Length = 884

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 4/79 (5%)
 Frame = +1

Query: 277 QEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD-DIISWL---KKKTGPPAVEVTSAE 444
           Q+  LA+ Y ++ +P L +FRNG+P+ + G  Q +  ++ WL     +     +E  +  
Sbjct: 578 QDPQLAKRYSIKTFPALVYFRNGNPLLFEGDLQNEQSVLEWLIDDDNRELADEIEEVNER 637

Query: 445 QAKELIDANTVIVFGFFSD 501
               L+  +T++V  F+ D
Sbjct: 638 MLDRLMAESTLLVVFFYDD 656



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 16/75 (21%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +1

Query: 274 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVTSAEQA 450
           T++  +A+ YGV  YP L +F  G P  + G   + ++++ WL  +     +E+ + +  
Sbjct: 472 TRDFSVADGYGVHEYPALVYFEGGIPNVFEGELSEEEEVLQWLITQKTEDRIELITRQML 531

Query: 451 KELIDANTVIVFGFF 495
           + +++    +   F+
Sbjct: 532 ETMVEETQYLAVYFY 546



 Score = 36.7 bits (81), Expect = 0.029
 Identities = 18/66 (27%), Positives = 36/66 (54%), Gaps = 4/66 (6%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD----DIISWLKKKTGPPAVEVTSAEQ 447
           ++ LA+ YG++ +P L +FR   PI Y G    +    D ++ L+    P  +E  +A+ 
Sbjct: 105 DKRLAKQYGIKNFPALTYFREKEPIIYDGDLMDEEGVLDFLTSLEAMDLPDRIEEVNAKI 164

Query: 448 AKELID 465
            +++I+
Sbjct: 165 LQKIIE 170



 Score = 36.3 bits (80), Expect = 0.038
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 5/79 (6%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGS--PIDYSGG-RQADDIISWL--KKKTGPPAVEVTSAE 444
           ++ +A+ YGV   P + FF+  S  P+ Y+G   + + I++WL  +K      +E    E
Sbjct: 365 DKQMAKEYGVFALPAIVFFKPTSKEPVIYAGDLYEEEQILTWLITQKDPSGDVIEDLEGE 424

Query: 445 QAKELIDANTVIVFGFFSD 501
           +   LI+ +  I   F++D
Sbjct: 425 RLVHLIEESGSIAVYFYAD 443



 Score = 35.9 bits (79), Expect = 0.050
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 289 LAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVT 435
           +A+ YG R  P L +FR G  I+Y G     ++++ WL   T P  +E+T
Sbjct: 260 MAKKYGFRNPPGLTYFRKGKYINYDGDIDDEEEVLDWL---TSPANMEMT 306



 Score = 31.9 bits (69), Expect = 0.82
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 4/79 (5%)
 Frame = +1

Query: 292 AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSAEQAKEL 459
           A+ Y +   P+L +FR   P+ Y G   Q D +I+WL  +        +E  + +   +L
Sbjct: 691 AKKYEIVNIPSLVYFRKQVPVLYDGDLHQHDKVITWLTSQDVFEIKNEIEEVNRKMLDKL 750

Query: 460 IDANTVIVFGFFSDQS*PE 516
           ++ N  +   FF + + P+
Sbjct: 751 LEENEFLAV-FFYEHNQPD 768



 Score = 30.3 bits (65), Expect = 2.5
 Identities = 11/38 (28%), Positives = 22/38 (57%)
 Frame = +2

Query: 86  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 199
           TE+ + ++++   ET++  T+Y+ V FY   C  C  +
Sbjct: 519 TEDRIELITRQMLETMVEETQYLAVYFYKINCNICDQI 556



 Score = 29.9 bits (64), Expect = 3.3
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +1

Query: 292 AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKK 405
           A+ +GV   P + +FR   P  Y G     D+++ WL+K
Sbjct: 799 AKKWGVTKLPAMVYFRRRFPSIYRGDLLSEDEVLEWLRK 837


>BT004854-1|AAO45210.1|  637|Drosophila melanogaster RE62692p
           protein.
          Length = 637

 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 21/48 (43%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +2

Query: 92  ENVLVLSKANFE-TVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 232
           + V+ LS  NF  TV+      LVEFY  +CGHC+  AP Y   A  L
Sbjct: 49  DKVIRLSVDNFNATVLDQNRGALVEFYNTYCGHCRRFAPTYKSVAEHL 96


>AE013599-1673|AAF58400.1|  637|Drosophila melanogaster CG4670-PA
           protein.
          Length = 637

 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 21/48 (43%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +2

Query: 92  ENVLVLSKANFE-TVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 232
           + V+ LS  NF  TV+      LVEFY  +CGHC+  AP Y   A  L
Sbjct: 49  DKVIRLSVDNFNATVLDQNRGALVEFYNTYCGHCRRFAPTYKSVAEHL 96


>BT023024-1|AAY55440.1|  139|Drosophila melanogaster IP04051p
           protein.
          Length = 139

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 3/46 (6%)
 Frame = +2

Query: 98  VLVLSKANFETVIT---TTEYILVEFYAPWCGHCKSLAPEYAKAAT 226
           ++V SK+ F+ +I    T +Y+LVEF+A WCG C  + P   + A+
Sbjct: 9   IIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLAS 54



 Score = 31.9 bits (69), Expect = 0.82
 Identities = 18/65 (27%), Positives = 31/65 (47%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 441
           K+D  + +DLA  Y V   PT    +N   +    G   + ++S ++K  G   VE +  
Sbjct: 64  KIDVDENEDLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFVG--KVEDSKE 121

Query: 442 EQAKE 456
            ++KE
Sbjct: 122 HKSKE 126


>BT022989-1|AAY55405.1|  139|Drosophila melanogaster IP04151p
           protein.
          Length = 139

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 3/46 (6%)
 Frame = +2

Query: 98  VLVLSKANFETVIT---TTEYILVEFYAPWCGHCKSLAPEYAKAAT 226
           ++V SK+ F+ +I    T +Y+LVEF+A WCG C  + P   + A+
Sbjct: 9   IIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLAS 54



 Score = 31.9 bits (69), Expect = 0.82
 Identities = 18/65 (27%), Positives = 31/65 (47%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 441
           K+D  + +DLA  Y V   PT    +N   +    G   + ++S ++K  G   VE +  
Sbjct: 64  KIDVDENEDLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFVG--KVEDSKE 121

Query: 442 EQAKE 456
            ++KE
Sbjct: 122 HKSKE 126


>AE014296-2414|AAF49714.1|  139|Drosophila melanogaster CG13473-PA
           protein.
          Length = 139

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 3/46 (6%)
 Frame = +2

Query: 98  VLVLSKANFETVIT---TTEYILVEFYAPWCGHCKSLAPEYAKAAT 226
           ++V SK+ F+ +I    T +Y+LVEF+A WCG C  + P   + A+
Sbjct: 9   IIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLEQLAS 54



 Score = 31.9 bits (69), Expect = 0.82
 Identities = 18/65 (27%), Positives = 31/65 (47%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 441
           K+D  + +DLA  Y V   PT    +N   +    G   + ++S ++K  G   VE +  
Sbjct: 64  KIDVDENEDLAVQYEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFVG--KVEDSKE 121

Query: 442 EQAKE 456
            ++KE
Sbjct: 122 HKSKE 126


>BT001615-1|AAN71370.1|  729|Drosophila melanogaster RE34119p
           protein.
          Length = 729

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 19/80 (23%), Positives = 41/80 (51%), Gaps = 4/80 (5%)
 Frame = +1

Query: 274 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTG---PPAVEVTSA 441
           T+   +A+ Y V+ YP L  FRN  P+ ++G     D++++W+        P  +E  + 
Sbjct: 423 TEVTGIAKKYNVKTYPRLVLFRNRDPLHFTGDLDDEDEVLAWITDDETLEIPGKIEEVNV 482

Query: 442 EQAKELIDANTVIVFGFFSD 501
           +   +++  N  +V  F+++
Sbjct: 483 KMLDKILAENDHVVVFFYAE 502



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 5/80 (6%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD----DIISWLKKKTGPPAVEVTSAEQ 447
           ++ LA+ YG++ +P L +FR   PI Y G    +    D ++ L+    P  +E  +A+ 
Sbjct: 105 DKRLAKQYGIKNFPALTYFREKEPIIYDGDLMDEEGVLDFLTSLEAMDLPDRIEEVNAKI 164

Query: 448 AKELI-DANTVIVFGFFSDQ 504
            +++I D + V V  +  DQ
Sbjct: 165 LQKIIEDTDFVAVLFYDKDQ 184



 Score = 32.7 bits (71), Expect = 0.47
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 1/68 (1%)
 Frame = +1

Query: 292 AESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVEVTSAEQAKELIDA 468
           A+ YG+   P L +F N  P  Y G     D+++ WL  +     +E  + E    LI+ 
Sbjct: 322 AKEYGLDHLPALIYFENKIPALYEGDLMNEDEVLEWLLVQKKTANIEEVTDEILVTLINE 381

Query: 469 NTVIVFGF 492
           +  +V  F
Sbjct: 382 HEYVVVFF 389



 Score = 29.9 bits (64), Expect = 3.3
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 4/81 (4%)
 Frame = +1

Query: 274 TQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWL--KKKTGPPAVEVTSAE 444
           T + D+ + Y + G P L F+R+     Y+G   + ++I+ W+    ++    +E    +
Sbjct: 531 TSDDDIDKEYDLPGLPALAFYRHKFRTIYTGDLMKEEEILEWVIDLHESTADVIESVDRK 590

Query: 445 QAKELI-DANTVIVFGFFSDQ 504
             + LI D   + VF F+ D+
Sbjct: 591 TLQVLINDVEHLAVF-FYDDE 610


>AY089550-1|AAL90288.1|  287|Drosophila melanogaster LD26837p
           protein.
          Length = 287

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 22/73 (30%), Positives = 35/73 (47%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 441
           KVD  + QD A   GV   PT  F+RN + ID   G   + + + +++  G    E    
Sbjct: 57  KVDVDKCQDTAAGQGVSAMPTFIFYRNRTKIDRVQGADVNGLEAKIQEHIGTSGGEEGGE 116

Query: 442 EQAKELIDANTVI 480
           +  + L++ NT I
Sbjct: 117 DYGQGLMELNTFI 129



 Score = 33.5 bits (73), Expect = 0.27
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = +2

Query: 146 EYILVEFYAPWCGHCKSLAPEYAKAATK 229
           + ++V+F A WCG CK +AP +    TK
Sbjct: 22  QLVVVDFTASWCGPCKRIAPIFETFPTK 49


>AF143404-1|AAF66635.1|  287|Drosophila melanogaster
           thioredoxin-like protein TXL protein.
          Length = 287

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 22/73 (30%), Positives = 35/73 (47%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 441
           KVD  + QD A   GV   PT  F+RN + ID   G   + + + +++  G    E    
Sbjct: 57  KVDVDKCQDTAAGQGVSAMPTFIFYRNRTKIDRVQGADVNGLEAKIQEHIGTSGGEEGGE 116

Query: 442 EQAKELIDANTVI 480
           +  + L++ NT I
Sbjct: 117 DYGQGLMELNTFI 129



 Score = 33.5 bits (73), Expect = 0.27
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = +2

Query: 146 EYILVEFYAPWCGHCKSLAPEYAKAATK 229
           + ++V+F A WCG CK +AP +    TK
Sbjct: 22  QLVVVDFTASWCGPCKRIAPIFETFPTK 49


>AE014296-996|AAF50750.1|  287|Drosophila melanogaster CG5495-PA
           protein.
          Length = 287

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 22/73 (30%), Positives = 35/73 (47%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 441
           KVD  + QD A   GV   PT  F+RN + ID   G   + + + +++  G    E    
Sbjct: 57  KVDVDKCQDTAAGQGVSAMPTFIFYRNRTKIDRVQGADVNGLEAKIQEHIGTSGGEEGGE 116

Query: 442 EQAKELIDANTVI 480
           +  + L++ NT I
Sbjct: 117 DYGQGLMELNTFI 129



 Score = 33.5 bits (73), Expect = 0.27
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = +2

Query: 146 EYILVEFYAPWCGHCKSLAPEYAKAATK 229
           + ++V+F A WCG CK +AP +    TK
Sbjct: 22  QLVVVDFTASWCGPCKRIAPIFETFPTK 49


>AF216974-1|AAF34748.1|  566|Drosophila melanogaster l(2)01289 long
           form protein.
          Length = 566

 Score = 38.7 bits (86), Expect = 0.007
 Identities = 21/86 (24%), Positives = 42/86 (48%), Gaps = 4/86 (4%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQAD----DIISWLKKKTGPPAVEVTSAEQ 447
           ++ LA+ YG++ +P L +FR   PI Y G    +    D ++ L+    P  +E  +A+ 
Sbjct: 105 DKRLAKQYGIKNFPALTYFREKEPIIYDGDLMDEEGVLDFLTSLEAMDLPDRIEEVNAKI 164

Query: 448 AKELIDANTVIVFGFFSDQS*PEPKL 525
            +++I+    +   F  D     P++
Sbjct: 165 LQKIIEDTDFVAVLFCPDHETCPPRV 190



 Score = 36.3 bits (80), Expect = 0.038
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 7/76 (9%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQ-ADDIISWL--KKKTG--PPAVEVTSAE 444
           ++ LA+ Y +   P L ++R+ +PI Y G  Q  +D++ WL   K TG     +E  +++
Sbjct: 225 DEALADEYNLGNLPALVYYRHQTPIIYEGELQREEDVLEWLVQNKSTGDEDDVIEDVTSK 284

Query: 445 QAKELID--ANTVIVF 486
               LI    N V++F
Sbjct: 285 TLSTLISNIDNLVVLF 300



 Score = 34.7 bits (76), Expect = 0.12
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADD-IISWLKKKTGPPAVEVTS 438
           K+D  +E   A  YG+   P L +F  G P  Y G  + ++ ++ WL  +T    +E  +
Sbjct: 436 KIDNPEE---AVEYGINKVPKLIYFEKGIPTIYEGNLEDEEKLLKWLTDQTSSDQIEDIT 492

Query: 439 AEQAKELID 465
            E    +I+
Sbjct: 493 DEMLDLIIE 501



 Score = 30.7 bits (66), Expect = 1.9
 Identities = 20/84 (23%), Positives = 33/84 (39%), Gaps = 1/84 (1%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGG-RQADDIISWLKKKTGPPAVE 429
           Q  K+D   +   A  YG+   P + +F    P  Y G     + I+ WL  +     +E
Sbjct: 328 QFVKID---DAKAAADYGIDSIPAIVYFEKEIPNVYDGDLMDEEQILKWLLGQLERDEIE 384

Query: 430 VTSAEQAKELIDANTVIVFGFFSD 501
             + E    +I    VI   F+ +
Sbjct: 385 DVTDEMLDTMIKEGRVIAVLFYDN 408


>AF220362-1|AAF37263.1|  106|Drosophila melanogaster thioredoxin
           protein.
          Length = 106

 Score = 37.1 bits (82), Expect = 0.022
 Identities = 14/47 (29%), Positives = 30/47 (63%), Gaps = 2/47 (4%)
 Frame = +2

Query: 104 VLSKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATKLAE 238
           V  KA+ +  +T    + ++++F+A WCG CK ++P+  + +T+ A+
Sbjct: 5   VKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFAD 51



 Score = 31.9 bits (69), Expect = 0.82
 Identities = 13/39 (33%), Positives = 20/39 (51%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQA 378
           KVD  + +D+A  Y +   PT  F +NG  ++   G  A
Sbjct: 57  KVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANA 95


>AE014298-718|AAF46018.2|  157|Drosophila melanogaster CG3315-PA
           protein.
          Length = 157

 Score = 37.1 bits (82), Expect = 0.022
 Identities = 11/38 (28%), Positives = 25/38 (65%)
 Frame = +2

Query: 125 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 238
           + ++   + ++++FYA WCG CK +AP+  + A + ++
Sbjct: 14  QLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSD 51


>AE014134-1667|AAN10701.1|  106|Drosophila melanogaster CG31884-PB,
           isoform B protein.
          Length = 106

 Score = 37.1 bits (82), Expect = 0.022
 Identities = 14/47 (29%), Positives = 30/47 (63%), Gaps = 2/47 (4%)
 Frame = +2

Query: 104 VLSKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATKLAE 238
           V  KA+ +  +T    + ++++F+A WCG CK ++P+  + +T+ A+
Sbjct: 5   VKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFAD 51



 Score = 31.9 bits (69), Expect = 0.82
 Identities = 13/39 (33%), Positives = 20/39 (51%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQA 378
           KVD  + +D+A  Y +   PT  F +NG  ++   G  A
Sbjct: 57  KVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANA 95


>AE014134-1666|AAN10700.1|  106|Drosophila melanogaster CG31884-PA,
           isoform A protein.
          Length = 106

 Score = 37.1 bits (82), Expect = 0.022
 Identities = 14/47 (29%), Positives = 30/47 (63%), Gaps = 2/47 (4%)
 Frame = +2

Query: 104 VLSKANFETVITTT--EYILVEFYAPWCGHCKSLAPEYAKAATKLAE 238
           V  KA+ +  +T    + ++++F+A WCG CK ++P+  + +T+ A+
Sbjct: 5   VKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFAD 51



 Score = 31.9 bits (69), Expect = 0.82
 Identities = 13/39 (33%), Positives = 20/39 (51%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQA 378
           KVD  + +D+A  Y +   PT  F +NG  ++   G  A
Sbjct: 57  KVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANA 95


>AY118750-1|AAM50610.1|  323|Drosophila melanogaster GH07506p
           protein.
          Length = 323

 Score = 36.7 bits (81), Expect = 0.029
 Identities = 16/55 (29%), Positives = 29/55 (52%)
 Frame = +1

Query: 244 ISYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKK 408
           +  Q+AK+D T    L+  + V   PT+   ++G    Y G R  D ++ ++KK+
Sbjct: 83  VQVQVAKIDVTTSPSLSGRFFVTALPTIYHVKDGEFRQYRGARDGDALLYFVKKQ 137



 Score = 36.3 bits (80), Expect = 0.038
 Identities = 12/23 (52%), Positives = 18/23 (78%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAKAA 223
           ++EF+APWC  CK+LAP + + A
Sbjct: 55  MIEFFAPWCPACKNLAPTWERFA 77


>AJ507731-1|CAD45644.1|  157|Drosophila melanogaster thioredoxinT
           protein.
          Length = 157

 Score = 36.7 bits (81), Expect = 0.029
 Identities = 11/38 (28%), Positives = 25/38 (65%)
 Frame = +2

Query: 125 ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 238
           + ++   + ++++FYA WCG CK +AP+  + A + ++
Sbjct: 14  QLILAEDKLVVIDFYADWCGPCKIIAPKLDELAHEYSD 51


>AE013599-3698|AAF47072.1|  323|Drosophila melanogaster CG5554-PA
           protein.
          Length = 323

 Score = 36.7 bits (81), Expect = 0.029
 Identities = 16/55 (29%), Positives = 29/55 (52%)
 Frame = +1

Query: 244 ISYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKK 408
           +  Q+AK+D T    L+  + V   PT+   ++G    Y G R  D ++ ++KK+
Sbjct: 83  VQVQVAKIDVTTSPSLSGRFFVTALPTIYHVKDGEFRQYRGARDGDALLYFVKKQ 137



 Score = 36.3 bits (80), Expect = 0.038
 Identities = 12/23 (52%), Positives = 18/23 (78%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAKAA 223
           ++EF+APWC  CK+LAP + + A
Sbjct: 55  MIEFFAPWCPACKNLAPTWERFA 77


>AY060458-1|AAL25497.1|  114|Drosophila melanogaster SD03042p
           protein.
          Length = 114

 Score = 35.9 bits (79), Expect = 0.050
 Identities = 10/29 (34%), Positives = 22/29 (75%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATKLAE 238
           ++++F+A WCG CK ++P+  + +T+ A+
Sbjct: 31  VVLDFFATWCGPCKMISPKLVELSTQFAD 59



 Score = 31.9 bits (69), Expect = 0.82
 Identities = 13/39 (33%), Positives = 20/39 (51%)
 Frame = +1

Query: 262 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQA 378
           KVD  + +D+A  Y +   PT  F +NG  ++   G  A
Sbjct: 65  KVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANA 103


>AY071406-1|AAL49028.1|  142|Drosophila melanogaster RE49388p
           protein.
          Length = 142

 Score = 35.1 bits (77), Expect = 0.088
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +1

Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADD-IISWL 399
           S +LAKVD  +  +LA  Y V   P L   +NG  +    G Q +D I +W+
Sbjct: 83  SIKLAKVDIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWV 134



 Score = 34.3 bits (75), Expect = 0.15
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = +2

Query: 68  LGDEVPTEENVLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAP 205
           L    P +E   V S  +F+  +  ++  ++V+F+A WC  CK L P
Sbjct: 25  LSVSAPRQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTP 71


>AE014296-444|AAF47638.1|  142|Drosophila melanogaster CG8993-PA
           protein.
          Length = 142

 Score = 35.1 bits (77), Expect = 0.088
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +1

Query: 247 SYQLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADD-IISWL 399
           S +LAKVD  +  +LA  Y V   P L   +NG  +    G Q +D I +W+
Sbjct: 83  SIKLAKVDIDEHSELALDYDVAAVPVLVVLQNGKEVQRMVGLQDEDKIRAWV 134



 Score = 34.3 bits (75), Expect = 0.15
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = +2

Query: 68  LGDEVPTEENVLVLSKANFETVITTTEY-ILVEFYAPWCGHCKSLAP 205
           L    P +E   V S  +F+  +  ++  ++V+F+A WC  CK L P
Sbjct: 25  LSVSAPRQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNPCKLLTP 71


>AY070811-1|AAL48433.1|  145|Drosophila melanogaster AT22380p
           protein.
          Length = 145

 Score = 34.7 bits (76), Expect = 0.12
 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 1/62 (1%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDII-SWLKKKTGPPAVE 429
           +LA+VD  +  +LA  Y V   P+L    NG  ++   G Q  + +  WL K    P  E
Sbjct: 82  RLARVDIDEHGELALDYNVGSVPSLVVISNGKVVNRMVGLQTSEYLRKWLHKAVPHPPPE 141

Query: 430 VT 435
            T
Sbjct: 142 DT 143



 Score = 33.9 bits (74), Expect = 0.20
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 1/35 (2%)
 Frame = +2

Query: 104 VLSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 205
           V ++ +FE  VI +   ++V+F+A WC  CK+LAP
Sbjct: 34  VETRKDFEQRVINSDRPVVVDFHASWCCPCKALAP 68


>AE013599-2952|AAF57518.2|  145|Drosophila melanogaster CG8517-PA
           protein.
          Length = 145

 Score = 34.7 bits (76), Expect = 0.12
 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 1/62 (1%)
 Frame = +1

Query: 253 QLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDII-SWLKKKTGPPAVE 429
           +LA+VD  +  +LA  Y V   P+L    NG  ++   G Q  + +  WL K    P  E
Sbjct: 82  RLARVDIDEHGELALDYNVGSVPSLVVISNGKVVNRMVGLQTSEYLRKWLHKAVPHPPPE 141

Query: 430 VT 435
            T
Sbjct: 142 DT 143



 Score = 33.9 bits (74), Expect = 0.20
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 1/35 (2%)
 Frame = +2

Query: 104 VLSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 205
           V ++ +FE  VI +   ++V+F+A WC  CK+LAP
Sbjct: 34  VETRKDFEQRVINSDRPVVVDFHASWCCPCKALAP 68


>BT012482-1|AAS93753.1|  245|Drosophila melanogaster RE10237p
           protein.
          Length = 245

 Score = 33.1 bits (72), Expect = 0.35
 Identities = 20/65 (30%), Positives = 30/65 (46%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKEL 459
           + +L   Y     P L FFR G PI Y G    D+I+ +       PAV+  S +  + L
Sbjct: 22  DSNLVSIYDPSKEPALVFFRRGIPILYHGEINDDEILDFFNDNL-EPAVKELSDDNFEHL 80

Query: 460 IDANT 474
             A++
Sbjct: 81  TQASS 85


>AY095006-1|AAM11334.1|  302|Drosophila melanogaster GH08893p
           protein.
          Length = 302

 Score = 33.1 bits (72), Expect = 0.35
 Identities = 20/65 (30%), Positives = 30/65 (46%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKEL 459
           + +L   Y     P L FFR G PI Y G    D+I+ +       PAV+  S +  + L
Sbjct: 79  DSNLVSIYDPSKEPALVFFRRGIPILYHGEINDDEILDFFNDNL-EPAVKELSDDNFEHL 137

Query: 460 IDANT 474
             A++
Sbjct: 138 TQASS 142


>AE014297-3697|AAN14034.1|  245|Drosophila melanogaster CG11790-PB,
           isoform B protein.
          Length = 245

 Score = 33.1 bits (72), Expect = 0.35
 Identities = 20/65 (30%), Positives = 30/65 (46%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKEL 459
           + +L   Y     P L FFR G PI Y G    D+I+ +       PAV+  S +  + L
Sbjct: 22  DSNLVSIYDPSKEPALVFFRRGIPILYHGEINDDEILDFFNDNL-EPAVKELSDDNFEHL 80

Query: 460 IDANT 474
             A++
Sbjct: 81  TQASS 85


>AE014297-3696|AAF56385.2|  302|Drosophila melanogaster CG11790-PA,
           isoform A protein.
          Length = 302

 Score = 33.1 bits (72), Expect = 0.35
 Identities = 20/65 (30%), Positives = 30/65 (46%)
 Frame = +1

Query: 280 EQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKEL 459
           + +L   Y     P L FFR G PI Y G    D+I+ +       PAV+  S +  + L
Sbjct: 79  DSNLVSIYDPSKEPALVFFRRGIPILYHGEINDDEILDFFNDNL-EPAVKELSDDNFEHL 137

Query: 460 IDANT 474
             A++
Sbjct: 138 TQASS 142


>AE014296-2483|AAN11792.1|  175|Drosophila melanogaster CG6988-PB,
           isoform B protein.
          Length = 175

 Score = 31.9 bits (69), Expect = 0.82
 Identities = 15/43 (34%), Positives = 25/43 (58%)
 Frame = +2

Query: 35  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVE 163
           +F A + +  +   EV  EE VLV +  NF+ +I   E++LV+
Sbjct: 8   LFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVD 50


>L27072-1|AAA28937.1|  107|Drosophila melanogaster thioredoxin-like
           protein protein.
          Length = 107

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 11/30 (36%), Positives = 17/30 (56%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATKLAEE 241
           I+++FYA WCG CK +       A K + +
Sbjct: 22  IVLDFYATWCGPCKEMESTVKSLARKYSSK 51


>AY119573-1|AAM50227.1|  160|Drosophila melanogaster LD03613p
           protein.
          Length = 160

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +2

Query: 125 ETVITTTEYILVEFYAPWCGHCKSLAPE 208
           + VI +   ++V F+A WC  CK L P+
Sbjct: 61  QKVINSDNPVIVNFHAEWCDPCKILTPK 88


>AL023893-3|CAA19652.1|  160|Drosophila melanogaster EG:132E8.3
           protein.
          Length = 160

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +2

Query: 125 ETVITTTEYILVEFYAPWCGHCKSLAPE 208
           + VI +   ++V F+A WC  CK L P+
Sbjct: 61  QKVINSDNPVIVNFHAEWCDPCKILTPK 88


>AE014298-719|AAF46019.1|  107|Drosophila melanogaster CG4193-PA
           protein.
          Length = 107

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 11/30 (36%), Positives = 17/30 (56%)
 Frame = +2

Query: 152 ILVEFYAPWCGHCKSLAPEYAKAATKLAEE 241
           I+++FYA WCG CK +       A K + +
Sbjct: 22  IVLDFYATWCGPCKEMESTVKSLARKYSSK 51


>AE014298-194|AAF45615.1|  160|Drosophila melanogaster CG3719-PA
           protein.
          Length = 160

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +2

Query: 125 ETVITTTEYILVEFYAPWCGHCKSLAPE 208
           + VI +   ++V F+A WC  CK L P+
Sbjct: 61  QKVINSDNPVIVNFHAEWCDPCKILTPK 88


>U73196-1|AAC47325.1|  353|Drosophila melanogaster Jun-N-terminal
           kinase protein.
          Length = 353

 Score = 29.5 bits (63), Expect = 4.4
 Identities = 20/84 (23%), Positives = 37/84 (44%)
 Frame = -2

Query: 572 DNSKYLVINNLSS*KESFGSG*LWSEKKPNTITVLASISSLACSAEVTSTAGGPVFFFSQ 393
           D   YL+   L   K    +G +  + KP+ I V A  +       +  TA G  F  + 
Sbjct: 124 DRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTA-GTTFMMTP 182

Query: 392 LMMSSA*RPPE*SIGLPFLKNLRV 321
            +++   R PE  +G+ + +N+ +
Sbjct: 183 YVVTRYYRAPEVILGMGYTENVDI 206


>U50966-1|AAB51188.1|  315|Drosophila melanogaster DJNK protein.
          Length = 315

 Score = 29.5 bits (63), Expect = 4.4
 Identities = 20/84 (23%), Positives = 37/84 (44%)
 Frame = -2

Query: 572 DNSKYLVINNLSS*KESFGSG*LWSEKKPNTITVLASISSLACSAEVTSTAGGPVFFFSQ 393
           D   YL+   L   K    +G +  + KP+ I V A  +       +  TA G  F  + 
Sbjct: 124 DRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTA-GTTFMMTP 182

Query: 392 LMMSSA*RPPE*SIGLPFLKNLRV 321
            +++   R PE  +G+ + +N+ +
Sbjct: 183 YVVTRYYRAPEVILGMGYTENVDI 206


>U50965-1|AAB51187.1|  372|Drosophila melanogaster DJNK protein.
          Length = 372

 Score = 29.5 bits (63), Expect = 4.4
 Identities = 20/84 (23%), Positives = 37/84 (44%)
 Frame = -2

Query: 572 DNSKYLVINNLSS*KESFGSG*LWSEKKPNTITVLASISSLACSAEVTSTAGGPVFFFSQ 393
           D   YL+   L   K    +G +  + KP+ I V A  +       +  TA G  F  + 
Sbjct: 124 DRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTA-GTTFMMTP 182

Query: 392 LMMSSA*RPPE*SIGLPFLKNLRV 321
            +++   R PE  +G+ + +N+ +
Sbjct: 183 YVVTRYYRAPEVILGMGYTENVDI 206


>U49249-1|AAB48381.1|  372|Drosophila melanogaster JNK protein
           kinase protein.
          Length = 372

 Score = 29.5 bits (63), Expect = 4.4
 Identities = 20/84 (23%), Positives = 37/84 (44%)
 Frame = -2

Query: 572 DNSKYLVINNLSS*KESFGSG*LWSEKKPNTITVLASISSLACSAEVTSTAGGPVFFFSQ 393
           D   YL+   L   K    +G +  + KP+ I V A  +       +  TA G  F  + 
Sbjct: 124 DRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTA-GTTFMMTP 182

Query: 392 LMMSSA*RPPE*SIGLPFLKNLRV 321
            +++   R PE  +G+ + +N+ +
Sbjct: 183 YVVTRYYRAPEVILGMGYTENVDI 206


>U49180-1|AAB97094.1|  372|Drosophila melanogaster JNK protein
           kinase protein.
          Length = 372

 Score = 29.5 bits (63), Expect = 4.4
 Identities = 20/84 (23%), Positives = 37/84 (44%)
 Frame = -2

Query: 572 DNSKYLVINNLSS*KESFGSG*LWSEKKPNTITVLASISSLACSAEVTSTAGGPVFFFSQ 393
           D   YL+   L   K    +G +  + KP+ I V A  +       +  TA G  F  + 
Sbjct: 124 DRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTA-GTTFMMTP 182

Query: 392 LMMSSA*RPPE*SIGLPFLKNLRV 321
            +++   R PE  +G+ + +N+ +
Sbjct: 183 YVVTRYYRAPEVILGMGYTENVDI 206


>AY122221-1|AAM52733.1|  372|Drosophila melanogaster RE08746p
           protein.
          Length = 372

 Score = 29.5 bits (63), Expect = 4.4
 Identities = 20/84 (23%), Positives = 37/84 (44%)
 Frame = -2

Query: 572 DNSKYLVINNLSS*KESFGSG*LWSEKKPNTITVLASISSLACSAEVTSTAGGPVFFFSQ 393
           D   YL+   L   K    +G +  + KP+ I V A  +       +  TA G  F  + 
Sbjct: 124 DRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTA-GTTFMMTP 182

Query: 392 LMMSSA*RPPE*SIGLPFLKNLRV 321
            +++   R PE  +G+ + +N+ +
Sbjct: 183 YVVTRYYRAPEVILGMGYTENVDI 206


>AY070865-1|AAL48487.1|  372|Drosophila melanogaster HL02677p
           protein.
          Length = 372

 Score = 29.5 bits (63), Expect = 4.4
 Identities = 20/84 (23%), Positives = 37/84 (44%)
 Frame = -2

Query: 572 DNSKYLVINNLSS*KESFGSG*LWSEKKPNTITVLASISSLACSAEVTSTAGGPVFFFSQ 393
           D   YL+   L   K    +G +  + KP+ I V A  +       +  TA G  F  + 
Sbjct: 124 DRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTA-GTTFMMTP 182

Query: 392 LMMSSA*RPPE*SIGLPFLKNLRV 321
            +++   R PE  +G+ + +N+ +
Sbjct: 183 YVVTRYYRAPEVILGMGYTENVDI 206


>AE014134-1794|AAF52883.1|  372|Drosophila melanogaster CG5680-PB
           protein.
          Length = 372

 Score = 29.5 bits (63), Expect = 4.4
 Identities = 20/84 (23%), Positives = 37/84 (44%)
 Frame = -2

Query: 572 DNSKYLVINNLSS*KESFGSG*LWSEKKPNTITVLASISSLACSAEVTSTAGGPVFFFSQ 393
           D   YL+   L   K    +G +  + KP+ I V A  +       +  TA G  F  + 
Sbjct: 124 DRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTA-GTTFMMTP 182

Query: 392 LMMSSA*RPPE*SIGLPFLKNLRV 321
            +++   R PE  +G+ + +N+ +
Sbjct: 183 YVVTRYYRAPEVILGMGYTENVDI 206


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,821,260
Number of Sequences: 53049
Number of extensions: 548120
Number of successful extensions: 1806
Number of sequences better than 10.0: 74
Number of HSP's better than 10.0 without gapping: 1587
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1796
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2910007350
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -