SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30111.Seq
         (593 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M21159-1|AAA28927.1|  557|Drosophila melanogaster protein ( D.me...   148   5e-36
AY118416-1|AAM48445.1|  557|Drosophila melanogaster RE70560p pro...   148   5e-36
AE014297-3168|AAN13906.1|  557|Drosophila melanogaster CG5374-PB...   148   5e-36
AE014297-3167|AAF56009.1|  557|Drosophila melanogaster CG5374-PA...   148   5e-36
X95602-1|CAA64860.1|  545|Drosophila melanogaster CCT-gamma prot...    87   2e-17
U31961-17|AAA84416.1|  531|Drosophila melanogaster protein ( Dro...    87   2e-17
AY089543-1|AAL90281.1|  544|Drosophila melanogaster LD20933p pro...    87   2e-17
AE014297-2252|AAN13716.1|  544|Drosophila melanogaster CG8977-PB...    87   2e-17
AE014297-2251|AAF55350.1|  544|Drosophila melanogaster CG8977-PA...    87   2e-17
AY058756-1|AAL13985.1|  535|Drosophila melanogaster SD02216p pro...    84   1e-16
AE014298-1271|AAO41641.1|  533|Drosophila melanogaster CG7033-PC...    84   1e-16
AE014298-1270|AAN09241.1|  533|Drosophila melanogaster CG7033-PB...    84   1e-16
AE014298-1269|AAF46442.2|  535|Drosophila melanogaster CG7033-PA...    84   1e-16
AF172635-1|AAD46928.1|  542|Drosophila melanogaster GM12270p pro...    75   1e-13
AE013599-1409|AAM71027.1|  512|Drosophila melanogaster CG8439-PB...    75   1e-13
AE013599-1408|AAF58565.1|  542|Drosophila melanogaster CG8439-PA...    75   1e-13
AY128484-1|AAM75077.1|  533|Drosophila melanogaster RE61939p pro...    73   4e-13
AE014134-2227|AAF53210.1|  533|Drosophila melanogaster CG5525-PA...    73   4e-13
AY122201-1|AAM52713.1|  544|Drosophila melanogaster LD47396p pro...    72   7e-13
AE014297-822|AAF54292.2|  544|Drosophila melanogaster CG8351-PA ...    72   7e-13
AY058545-1|AAL13774.1|  546|Drosophila melanogaster LD24495p pro...    71   2e-12
AE013599-736|AAF59029.3|  546|Drosophila melanogaster CG8258-PA ...    71   2e-12
AY051470-1|AAK92894.1|  533|Drosophila melanogaster GH13725p pro...    58   7e-09
AE014298-2206|AAF48503.1|  533|Drosophila melanogaster CG8231-PA...    58   7e-09
X99341-1|CAA67720.1|  573|Drosophila melanogaster heat shock pro...    44   2e-04
BT010206-1|AAQ23524.1|  573|Drosophila melanogaster SD06594p pro...    44   2e-04
AE014298-1553|AAF47998.1|  573|Drosophila melanogaster CG12101-P...    44   2e-04
AE014298-1552|AAF47999.1|  573|Drosophila melanogaster CG12101-P...    44   2e-04
AY113273-1|AAM29278.1|  576|Drosophila melanogaster AT16985p pro...    42   8e-04
BT001308-1|AAN71063.1|  576|Drosophila melanogaster AT13565p pro...    41   0.001
AE014134-954|AAN10551.2|  576|Drosophila melanogaster CG7235-PC,...    41   0.001
AE014134-953|AAN10550.2|  576|Drosophila melanogaster CG7235-PB,...    41   0.001
AE014134-952|AAF52277.2|  576|Drosophila melanogaster CG7235-PA,...    41   0.001
BT001426-1|AAN71181.1|  648|Drosophila melanogaster GH15356p pro...    34   0.17 
AY047544-1|AAK77276.1|  639|Drosophila melanogaster GH05807p pro...    34   0.17 
AE014134-140|AAF51467.1|  648|Drosophila melanogaster CG2830-PA ...    34   0.17 
BT001546-1|AAN71301.1|  386|Drosophila melanogaster RE10780p pro...    29   6.3  
AE014296-2725|AAN11751.1|  386|Drosophila melanogaster CG4729-PC...    29   6.3  
AE014296-2724|AAN11750.1|  386|Drosophila melanogaster CG4729-PB...    29   6.3  
AE014296-2723|AAF49471.1|  386|Drosophila melanogaster CG4729-PA...    29   6.3  

>M21159-1|AAA28927.1|  557|Drosophila melanogaster protein (
           D.melanogaster T complexprotein 1 (Tcp-1) mRNA, complete
           cds. ).
          Length = 557

 Score =  148 bits (359), Expect = 5e-36
 Identities = 73/92 (79%), Positives = 81/92 (88%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +EVEHPAAKVLVELAQLQDEEVGDGTTSVVI+AAELLKNADELVK KIHPTSIISGY
Sbjct: 65  LRLLEVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGY 124

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLITQPK 520
           R+ACKEA KYI ++LT  V+ LGR SLI   K
Sbjct: 125 RIACKEACKYISEHLTAPVDELGRDSLINIAK 156



 Score =  101 bits (242), Expect = 7e-22
 Identities = 50/67 (74%), Positives = 56/67 (83%)
 Frame = +3

Query: 54  MSTIAAPLSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNE 233
           MST+A+PLS+AGTR     VRTQNVM      NIVKSSLGPVGLDKMLVDDIGDVTVTN+
Sbjct: 1   MSTLASPLSIAGTRQSRRIVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTND 60

Query: 234 GATILKM 254
           GATIL++
Sbjct: 61  GATILRL 67



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/26 (84%), Positives = 25/26 (96%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDAAQ 591
           AKT+MSSK+IGADA+FFS MVVDAAQ
Sbjct: 155 AKTSMSSKIIGADAEFFSAMVVDAAQ 180


>AY118416-1|AAM48445.1|  557|Drosophila melanogaster RE70560p
           protein.
          Length = 557

 Score =  148 bits (359), Expect = 5e-36
 Identities = 73/92 (79%), Positives = 81/92 (88%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +EVEHPAAKVLVELAQLQDEEVGDGTTSVVI+AAELLKNADELVK KIHPTSIISGY
Sbjct: 65  LRLLEVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGY 124

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLITQPK 520
           R+ACKEA KYI ++LT  V+ LGR SLI   K
Sbjct: 125 RIACKEACKYISEHLTAPVDELGRDSLINIAK 156



 Score =  105 bits (252), Expect = 5e-23
 Identities = 51/67 (76%), Positives = 57/67 (85%)
 Frame = +3

Query: 54  MSTIAAPLSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNE 233
           MST+A+PLS+AGTR  G  VRTQNVM      NIVKSSLGPVGLDKMLVDDIGDVTVTN+
Sbjct: 1   MSTLASPLSIAGTRQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTND 60

Query: 234 GATILKM 254
           GATIL++
Sbjct: 61  GATILRL 67



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/26 (84%), Positives = 25/26 (96%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDAAQ 591
           AKT+MSSK+IGADA+FFS MVVDAAQ
Sbjct: 155 AKTSMSSKIIGADAEFFSAMVVDAAQ 180


>AE014297-3168|AAN13906.1|  557|Drosophila melanogaster CG5374-PB,
           isoform B protein.
          Length = 557

 Score =  148 bits (359), Expect = 5e-36
 Identities = 73/92 (79%), Positives = 81/92 (88%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +EVEHPAAKVLVELAQLQDEEVGDGTTSVVI+AAELLKNADELVK KIHPTSIISGY
Sbjct: 65  LRLLEVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGY 124

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLITQPK 520
           R+ACKEA KYI ++LT  V+ LGR SLI   K
Sbjct: 125 RIACKEACKYISEHLTAPVDELGRDSLINIAK 156



 Score =  105 bits (252), Expect = 5e-23
 Identities = 51/67 (76%), Positives = 57/67 (85%)
 Frame = +3

Query: 54  MSTIAAPLSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNE 233
           MST+A+PLS+AGTR  G  VRTQNVM      NIVKSSLGPVGLDKMLVDDIGDVTVTN+
Sbjct: 1   MSTLASPLSIAGTRQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTND 60

Query: 234 GATILKM 254
           GATIL++
Sbjct: 61  GATILRL 67



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/26 (84%), Positives = 25/26 (96%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDAAQ 591
           AKT+MSSK+IGADA+FFS MVVDAAQ
Sbjct: 155 AKTSMSSKIIGADAEFFSAMVVDAAQ 180


>AE014297-3167|AAF56009.1|  557|Drosophila melanogaster CG5374-PA,
           isoform A protein.
          Length = 557

 Score =  148 bits (359), Expect = 5e-36
 Identities = 73/92 (79%), Positives = 81/92 (88%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +EVEHPAAKVLVELAQLQDEEVGDGTTSVVI+AAELLKNADELVK KIHPTSIISGY
Sbjct: 65  LRLLEVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGY 124

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLITQPK 520
           R+ACKEA KYI ++LT  V+ LGR SLI   K
Sbjct: 125 RIACKEACKYISEHLTAPVDELGRDSLINIAK 156



 Score =  105 bits (252), Expect = 5e-23
 Identities = 51/67 (76%), Positives = 57/67 (85%)
 Frame = +3

Query: 54  MSTIAAPLSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNE 233
           MST+A+PLS+AGTR  G  VRTQNVM      NIVKSSLGPVGLDKMLVDDIGDVTVTN+
Sbjct: 1   MSTLASPLSIAGTRQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTND 60

Query: 234 GATILKM 254
           GATIL++
Sbjct: 61  GATILRL 67



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/26 (84%), Positives = 25/26 (96%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDAAQ 591
           AKT+MSSK+IGADA+FFS MVVDAAQ
Sbjct: 155 AKTSMSSKIIGADAEFFSAMVVDAAQ 180


>X95602-1|CAA64860.1|  545|Drosophila melanogaster CCT-gamma protein
           protein.
          Length = 545

 Score = 87.0 bits (206), Expect = 2e-17
 Identities = 36/80 (45%), Positives = 60/80 (75%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ + V+HPAAK ++E+A+ QDEEVGDGTTSV+++A E+L  A+  ++ +IHPT II  Y
Sbjct: 69  LREITVQHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAY 128

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R A ++ V ++Q  L++ ++
Sbjct: 129 REALEDIVGHLQSQLSIQLD 148



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 17/53 (32%), Positives = 32/53 (60%)
 Frame = +3

Query: 93  RSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           R  G  V+ +N+       +++++ LGP  + KML+D +G + +TN+G  IL+
Sbjct: 18  RESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILR 70


>U31961-17|AAA84416.1|  531|Drosophila melanogaster protein (
           Drosophila melanogasterbithorax complex (BX-C), complete
           sequence. ).
          Length = 531

 Score = 87.0 bits (206), Expect = 2e-17
 Identities = 36/80 (45%), Positives = 60/80 (75%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ + V+HPAAK ++E+A+ QDEEVGDGTTSV+++A E+L  A+  ++ +IHPT II  Y
Sbjct: 55  LREITVQHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAY 114

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R A ++ V ++Q  L++ ++
Sbjct: 115 REALEDIVGHLQSQLSIQLD 134


>AY089543-1|AAL90281.1|  544|Drosophila melanogaster LD20933p
           protein.
          Length = 544

 Score = 87.0 bits (206), Expect = 2e-17
 Identities = 36/80 (45%), Positives = 60/80 (75%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ + V+HPAAK ++E+A+ QDEEVGDGTTSV+++A E+L  A+  ++ +IHPT II  Y
Sbjct: 68  LREITVQHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAY 127

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R A ++ V ++Q  L++ ++
Sbjct: 128 REALEDIVGHLQSQLSIQLD 147



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           LS    R  G  V+ +N+       +++++ LGP  + KML+D +G + +TN+G  IL+
Sbjct: 11  LSQNTKRESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILR 69


>AE014297-2252|AAN13716.1|  544|Drosophila melanogaster CG8977-PB,
           isoform B protein.
          Length = 544

 Score = 87.0 bits (206), Expect = 2e-17
 Identities = 36/80 (45%), Positives = 60/80 (75%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ + V+HPAAK ++E+A+ QDEEVGDGTTSV+++A E+L  A+  ++ +IHPT II  Y
Sbjct: 68  LREITVQHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAY 127

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R A ++ V ++Q  L++ ++
Sbjct: 128 REALEDIVGHLQSQLSIQLD 147



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           LS    R  G  V+ +N+       +++++ LGP  + KML+D +G + +TN+G  IL+
Sbjct: 11  LSQNTKRESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILR 69


>AE014297-2251|AAF55350.1|  544|Drosophila melanogaster CG8977-PA,
           isoform A protein.
          Length = 544

 Score = 87.0 bits (206), Expect = 2e-17
 Identities = 36/80 (45%), Positives = 60/80 (75%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ + V+HPAAK ++E+A+ QDEEVGDGTTSV+++A E+L  A+  ++ +IHPT II  Y
Sbjct: 68  LREITVQHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAY 127

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R A ++ V ++Q  L++ ++
Sbjct: 128 REALEDIVGHLQSQLSIQLD 147



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           LS    R  G  V+ +N+       +++++ LGP  + KML+D +G + +TN+G  IL+
Sbjct: 11  LSQNTKRESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILR 69


>AY058756-1|AAL13985.1|  535|Drosophila melanogaster SD02216p
           protein.
          Length = 535

 Score = 84.2 bits (199), Expect = 1e-16
 Identities = 36/69 (52%), Positives = 59/69 (85%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ V V++PAAK+LV+++++QDEEVGDGTTSV ++A+ELL+ A++LV+ K+HP  I+SG+
Sbjct: 71  LRAVGVDNPAAKILVDMSRVQDEEVGDGTTSVTVLASELLREAEKLVEQKLHPQIIVSGW 130

Query: 425 RLACKEAVK 451
           R A + A++
Sbjct: 131 RQATQVALE 139



 Score = 41.5 bits (93), Expect = 8e-04
 Identities = 21/37 (56%), Positives = 29/37 (78%), Gaps = 3/37 (8%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLV---DDIGDVTVTNEGATILK 251
           ++VKS+LGP G+DK+LV    + G V VTN+GATIL+
Sbjct: 36  DLVKSTLGPKGMDKILVATGRNAGHVEVTNDGATILR 72



 Score = 30.3 bits (65), Expect = 2.1
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDA 585
           A+TT+SSK++    DFF+ + VDA
Sbjct: 163 ARTTLSSKILHQHKDFFANLAVDA 186


>AE014298-1271|AAO41641.1|  533|Drosophila melanogaster CG7033-PC,
           isoform C protein.
          Length = 533

 Score = 84.2 bits (199), Expect = 1e-16
 Identities = 36/69 (52%), Positives = 59/69 (85%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ V V++PAAK+LV+++++QDEEVGDGTTSV ++A+ELL+ A++LV+ K+HP  I+SG+
Sbjct: 69  LRAVGVDNPAAKILVDMSRVQDEEVGDGTTSVTVLASELLREAEKLVEQKLHPQIIVSGW 128

Query: 425 RLACKEAVK 451
           R A + A++
Sbjct: 129 RQATQVALE 137



 Score = 41.5 bits (93), Expect = 8e-04
 Identities = 21/37 (56%), Positives = 29/37 (78%), Gaps = 3/37 (8%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLV---DDIGDVTVTNEGATILK 251
           ++VKS+LGP G+DK+LV    + G V VTN+GATIL+
Sbjct: 34  DLVKSTLGPKGMDKILVATGRNAGHVEVTNDGATILR 70



 Score = 30.3 bits (65), Expect = 2.1
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDA 585
           A+TT+SSK++    DFF+ + VDA
Sbjct: 161 ARTTLSSKILHQHKDFFANLAVDA 184


>AE014298-1270|AAN09241.1|  533|Drosophila melanogaster CG7033-PB,
           isoform B protein.
          Length = 533

 Score = 84.2 bits (199), Expect = 1e-16
 Identities = 36/69 (52%), Positives = 59/69 (85%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ V V++PAAK+LV+++++QDEEVGDGTTSV ++A+ELL+ A++LV+ K+HP  I+SG+
Sbjct: 69  LRAVGVDNPAAKILVDMSRVQDEEVGDGTTSVTVLASELLREAEKLVEQKLHPQIIVSGW 128

Query: 425 RLACKEAVK 451
           R A + A++
Sbjct: 129 RQATQVALE 137



 Score = 41.5 bits (93), Expect = 8e-04
 Identities = 21/37 (56%), Positives = 29/37 (78%), Gaps = 3/37 (8%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLV---DDIGDVTVTNEGATILK 251
           ++VKS+LGP G+DK+LV    + G V VTN+GATIL+
Sbjct: 34  DLVKSTLGPKGMDKILVATGRNAGHVEVTNDGATILR 70



 Score = 30.3 bits (65), Expect = 2.1
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDA 585
           A+TT+SSK++    DFF+ + VDA
Sbjct: 161 ARTTLSSKILHQHKDFFANLAVDA 184


>AE014298-1269|AAF46442.2|  535|Drosophila melanogaster CG7033-PA,
           isoform A protein.
          Length = 535

 Score = 84.2 bits (199), Expect = 1e-16
 Identities = 36/69 (52%), Positives = 59/69 (85%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ V V++PAAK+LV+++++QDEEVGDGTTSV ++A+ELL+ A++LV+ K+HP  I+SG+
Sbjct: 71  LRAVGVDNPAAKILVDMSRVQDEEVGDGTTSVTVLASELLREAEKLVEQKLHPQIIVSGW 130

Query: 425 RLACKEAVK 451
           R A + A++
Sbjct: 131 RQATQVALE 139



 Score = 41.5 bits (93), Expect = 8e-04
 Identities = 21/37 (56%), Positives = 29/37 (78%), Gaps = 3/37 (8%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLV---DDIGDVTVTNEGATILK 251
           ++VKS+LGP G+DK+LV    + G V VTN+GATIL+
Sbjct: 36  DLVKSTLGPKGMDKILVATGRNAGHVEVTNDGATILR 72



 Score = 30.3 bits (65), Expect = 2.1
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +1

Query: 514 AKTTMSSKLIGADADFFSEMVVDA 585
           A+TT+SSK++    DFF+ + VDA
Sbjct: 163 ARTTLSSKILHQHKDFFANLAVDA 186


>AF172635-1|AAD46928.1|  542|Drosophila melanogaster GM12270p
           protein.
          Length = 542

 Score = 74.5 bits (175), Expect = 1e-13
 Identities = 33/71 (46%), Positives = 51/71 (71%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +EV+H  AK++V+L+Q QD+E+GDGTT VV++A  LL+ A+ L+   IHP  I  G+
Sbjct: 79  MKLMEVDHEIAKLMVQLSQSQDDEIGDGTTGVVVLAGALLEQAEGLIDRGIHPIRIADGF 138

Query: 425 RLACKEAVKYI 457
            LA + A+K +
Sbjct: 139 ELAAQCAIKQL 149



 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 25/50 (50%), Positives = 37/50 (74%)
 Frame = +3

Query: 105 DPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           D ++T ++M      + +K+SLGP GLDK++V   GDVTVTN+GATI+K+
Sbjct: 33  DAIKT-HIMAARQIASTLKTSLGPKGLDKIMVSPDGDVTVTNDGATIMKL 81


>AE013599-1409|AAM71027.1|  512|Drosophila melanogaster CG8439-PB,
           isoform B protein.
          Length = 512

 Score = 74.5 bits (175), Expect = 1e-13
 Identities = 33/71 (46%), Positives = 51/71 (71%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +EV+H  AK++V+L+Q QD+E+GDGTT VV++A  LL+ A+ L+   IHP  I  G+
Sbjct: 49  MKLMEVDHEIAKLMVQLSQSQDDEIGDGTTGVVVLAGALLEQAEGLIDRGIHPIRIADGF 108

Query: 425 RLACKEAVKYI 457
            LA + A+K +
Sbjct: 109 ELAAQCAIKQL 119



 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 24/48 (50%), Positives = 35/48 (72%)
 Frame = +3

Query: 111 VRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           V+  ++M      + +K+SLGP GLDK++V   GDVTVTN+GATI+K+
Sbjct: 4   VQLTHIMAARQIASTLKTSLGPKGLDKIMVSPDGDVTVTNDGATIMKL 51


>AE013599-1408|AAF58565.1|  542|Drosophila melanogaster CG8439-PA,
           isoform A protein.
          Length = 542

 Score = 74.5 bits (175), Expect = 1e-13
 Identities = 33/71 (46%), Positives = 51/71 (71%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +EV+H  AK++V+L+Q QD+E+GDGTT VV++A  LL+ A+ L+   IHP  I  G+
Sbjct: 79  MKLMEVDHEIAKLMVQLSQSQDDEIGDGTTGVVVLAGALLEQAEGLIDRGIHPIRIADGF 138

Query: 425 RLACKEAVKYI 457
            LA + A+K +
Sbjct: 139 ELAAQCAIKQL 149



 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 25/50 (50%), Positives = 37/50 (74%)
 Frame = +3

Query: 105 DPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           D ++T ++M      + +K+SLGP GLDK++V   GDVTVTN+GATI+K+
Sbjct: 33  DAIKT-HIMAARQIASTLKTSLGPKGLDKIMVSPDGDVTVTNDGATIMKL 81


>AY128484-1|AAM75077.1|  533|Drosophila melanogaster RE61939p
           protein.
          Length = 533

 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 36/88 (40%), Positives = 59/88 (67%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K + V HPAAK+LVEL++ QD   GDGTTSVV+IA  LL+  ++L++  +HPT+I   +
Sbjct: 71  LKQMNVLHPAAKMLVELSRAQDVAAGDGTTSVVVIAGALLEACEKLLQKGLHPTAISDSF 130

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
           +    +AV+ ++  ++  +E   R +LI
Sbjct: 131 QRCSNKAVEILK-QMSTPIELDDRETLI 157



 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 21/47 (44%), Positives = 32/47 (68%)
 Frame = +3

Query: 111 VRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           VR  N+       + +++SLGP G+DKM+    G+V++TN+GATILK
Sbjct: 26  VRLSNIQAAKAVSDAIRTSLGPRGMDKMIQAGNGEVSITNDGATILK 72


>AE014134-2227|AAF53210.1|  533|Drosophila melanogaster CG5525-PA
           protein.
          Length = 533

 Score = 72.5 bits (170), Expect = 4e-13
 Identities = 36/88 (40%), Positives = 59/88 (67%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K + V HPAAK+LVEL++ QD   GDGTTSVV+IA  LL+  ++L++  +HPT+I   +
Sbjct: 71  LKQMNVLHPAAKMLVELSRAQDVAAGDGTTSVVVIAGALLEACEKLLQKGLHPTAISDSF 130

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
           +    +AV+ ++  ++  +E   R +LI
Sbjct: 131 QRCSNKAVEILK-QMSTPIELDDRETLI 157



 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 21/47 (44%), Positives = 32/47 (68%)
 Frame = +3

Query: 111 VRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           VR  N+       + +++SLGP G+DKM+    G+V++TN+GATILK
Sbjct: 26  VRLSNIQAAKAVSDAIRTSLGPRGMDKMIQAGNGEVSITNDGATILK 72


>AY122201-1|AAM52713.1|  544|Drosophila melanogaster LD47396p
           protein.
          Length = 544

 Score = 71.7 bits (168), Expect = 7e-13
 Identities = 36/80 (45%), Positives = 50/80 (62%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +E+ HPAAK LV++A+ QD EVGDGTTSVV++A E LK     V+  +HP  II   
Sbjct: 65  MKLLEIIHPAAKTLVDIAKSQDAEVGDGTTSVVLLAGEFLKQVKPFVEEGVHPRVIIKAI 124

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R A +  ++ I +     VE
Sbjct: 125 RKALQLCMEKINEMAVQIVE 144



 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 21/53 (39%), Positives = 34/53 (64%)
 Frame = +3

Query: 96  SCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           S G P    N+       + V+++LGP G+DK++VD  G  T++N+GATI+K+
Sbjct: 15  SQGKPQLVSNINACQSIVDAVRTTLGPRGMDKLIVDAHGKATISNDGATIMKL 67



 Score = 34.3 bits (75), Expect = 0.13
 Identities = 17/31 (54%), Positives = 21/31 (67%)
 Frame = +1

Query: 493 QAVSDHTAKTTMSSKLIGADADFFSEMVVDA 585
           +A+ +  A T MSSKLI    DFFS +VVDA
Sbjct: 151 RALLEKCAATAMSSKLIHQQKDFFSRIVVDA 181


>AE014297-822|AAF54292.2|  544|Drosophila melanogaster CG8351-PA
           protein.
          Length = 544

 Score = 71.7 bits (168), Expect = 7e-13
 Identities = 36/80 (45%), Positives = 50/80 (62%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +E+ HPAAK LV++A+ QD EVGDGTTSVV++A E LK     V+  +HP  II   
Sbjct: 65  MKLLEIIHPAAKTLVDIAKSQDAEVGDGTTSVVLLAGEFLKQVKPFVEEGVHPRVIIKAI 124

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R A +  ++ I +     VE
Sbjct: 125 RKALQLCMEKINEMAVQIVE 144



 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 21/53 (39%), Positives = 34/53 (64%)
 Frame = +3

Query: 96  SCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           S G P    N+       + V+++LGP G+DK++VD  G  T++N+GATI+K+
Sbjct: 15  SQGKPQLVSNINACQSIVDAVRTTLGPRGMDKLIVDAHGKATISNDGATIMKL 67



 Score = 34.3 bits (75), Expect = 0.13
 Identities = 17/31 (54%), Positives = 21/31 (67%)
 Frame = +1

Query: 493 QAVSDHTAKTTMSSKLIGADADFFSEMVVDA 585
           +A+ +  A T MSSKLI    DFFS +VVDA
Sbjct: 151 RALLEKCAATAMSSKLIHQQKDFFSRIVVDA 181


>AY058545-1|AAL13774.1|  546|Drosophila melanogaster LD24495p
           protein.
          Length = 546

 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 32/80 (40%), Positives = 56/80 (70%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++VEHPAAK++V  +Q+QD EVGDGT  VV++A  LL++A+EL++  I    I  GY
Sbjct: 73  MRELDVEHPAAKLIVMASQMQDAEVGDGTNFVVVLAGALLESAEELLRLGITTAEISDGY 132

Query: 425 RLACKEAVKYIQDNLTVTVE 484
             A ++A++ + + ++  +E
Sbjct: 133 EKALEKALEILPNLVSHKIE 152



 Score = 30.3 bits (65), Expect = 2.1
 Identities = 12/44 (27%), Positives = 26/44 (59%)
 Frame = +3

Query: 120 QNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +N+         ++S+ GP G++KM+++ I    VT++  TI++
Sbjct: 31  RNISACKEFAQTMRSAYGPNGMNKMIINHIEKQFVTSDAGTIMR 74


>AE013599-736|AAF59029.3|  546|Drosophila melanogaster CG8258-PA
           protein.
          Length = 546

 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 32/80 (40%), Positives = 56/80 (70%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++VEHPAAK++V  +Q+QD EVGDGT  VV++A  LL++A+EL++  I    I  GY
Sbjct: 73  MRELDVEHPAAKLIVMASQMQDAEVGDGTNFVVVLAGALLESAEELLRLGITTAEISDGY 132

Query: 425 RLACKEAVKYIQDNLTVTVE 484
             A ++A++ + + ++  +E
Sbjct: 133 EKALEKALEILPNLVSHKIE 152



 Score = 30.3 bits (65), Expect = 2.1
 Identities = 12/44 (27%), Positives = 26/44 (59%)
 Frame = +3

Query: 120 QNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +N+         ++S+ GP G++KM+++ I    VT++  TI++
Sbjct: 31  RNISACKEFAQTMRSAYGPNGMNKMIINHIEKQFVTSDAGTIMR 74


>AY051470-1|AAK92894.1|  533|Drosophila melanogaster GH13725p
           protein.
          Length = 533

 Score = 58.4 bits (135), Expect = 7e-09
 Identities = 26/80 (32%), Positives = 47/80 (58%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  ++++HP A ++   +  QD+  GDGTT+ V++  ELLK AD  +   +HP  +  G+
Sbjct: 64  LHEMQIQHPTASMIARASTAQDDSTGDGTTTTVMLIGELLKQADIYLSEGLHPRIMTDGF 123

Query: 425 RLACKEAVKYIQDNLTVTVE 484
             A  +A++ + D + V VE
Sbjct: 124 EKARDKALE-VLDQVKVPVE 142



 Score = 35.5 bits (78), Expect = 0.055
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           N+       ++++++LGP G  KMLV   GD+ +T +G  +L
Sbjct: 23  NISAAKGLQDVMRTNLGPKGTVKMLVSGAGDIKITKDGNVLL 64


>AE014298-2206|AAF48503.1|  533|Drosophila melanogaster CG8231-PA
           protein.
          Length = 533

 Score = 58.4 bits (135), Expect = 7e-09
 Identities = 26/80 (32%), Positives = 47/80 (58%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  ++++HP A ++   +  QD+  GDGTT+ V++  ELLK AD  +   +HP  +  G+
Sbjct: 64  LHEMQIQHPTASMIARASTAQDDSTGDGTTTTVMLIGELLKQADIYLSEGLHPRIMTDGF 123

Query: 425 RLACKEAVKYIQDNLTVTVE 484
             A  +A++ + D + V VE
Sbjct: 124 EKARDKALE-VLDQVKVPVE 142



 Score = 35.5 bits (78), Expect = 0.055
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           N+       ++++++LGP G  KMLV   GD+ +T +G  +L
Sbjct: 23  NISAAKGLQDVMRTNLGPKGTVKMLVSGAGDIKITKDGNVLL 64


>X99341-1|CAA67720.1|  573|Drosophila melanogaster heat shock
           protein 60 protein.
          Length = 573

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 25/80 (31%), Positives = 40/80 (50%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +    +P  I  G  L    AV+ 
Sbjct: 91  AKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGANPVEIRRGVML----AVET 146

Query: 455 IQDNLTVTVESLGRPSLITQ 514
           ++DNL      +  P  I Q
Sbjct: 147 VKDNLKTMSRPVSTPEEIAQ 166


>BT010206-1|AAQ23524.1|  573|Drosophila melanogaster SD06594p
           protein.
          Length = 573

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 25/80 (31%), Positives = 40/80 (50%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +    +P  I  G  L    AV+ 
Sbjct: 91  AKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGANPVEIRRGVML----AVET 146

Query: 455 IQDNLTVTVESLGRPSLITQ 514
           ++DNL      +  P  I Q
Sbjct: 147 VKDNLKTMSRPVSTPEEIAQ 166


>AE014298-1553|AAF47998.1|  573|Drosophila melanogaster CG12101-PB,
           isoform B protein.
          Length = 573

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 25/80 (31%), Positives = 40/80 (50%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +    +P  I  G  L    AV+ 
Sbjct: 91  AKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGANPVEIRRGVML----AVET 146

Query: 455 IQDNLTVTVESLGRPSLITQ 514
           ++DNL      +  P  I Q
Sbjct: 147 VKDNLKTMSRPVSTPEEIAQ 166


>AE014298-1552|AAF47999.1|  573|Drosophila melanogaster CG12101-PA,
           isoform A protein.
          Length = 573

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 25/80 (31%), Positives = 40/80 (50%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +    +P  I  G  L    AV+ 
Sbjct: 91  AKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGANPVEIRRGVML----AVET 146

Query: 455 IQDNLTVTVESLGRPSLITQ 514
           ++DNL      +  P  I Q
Sbjct: 147 VKDNLKTMSRPVSTPEEIAQ 166


>AY113273-1|AAM29278.1|  576|Drosophila melanogaster AT16985p
           protein.
          Length = 576

 Score = 41.5 bits (93), Expect = 8e-04
 Identities = 24/80 (30%), Positives = 40/80 (50%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +     P  I  G  L    A++ 
Sbjct: 95  AKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISRGASPVEIRRGVML----AIET 150

Query: 455 IQDNLTVTVESLGRPSLITQ 514
           ++DNL    + +  P  I Q
Sbjct: 151 VKDNLRRLSQPVNTPEEICQ 170


>BT001308-1|AAN71063.1|  576|Drosophila melanogaster AT13565p
           protein.
          Length = 576

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 24/80 (30%), Positives = 39/80 (48%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +     P  I  G  L    A++ 
Sbjct: 95  AKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISRGASPVEIRRGVML----AIET 150

Query: 455 IQDNLTVTVESLGRPSLITQ 514
           ++DNL      +  P  I Q
Sbjct: 151 VKDNLRRLSRPVNTPEEICQ 170


>AE014134-954|AAN10551.2|  576|Drosophila melanogaster CG7235-PC,
           isoform C protein.
          Length = 576

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 24/80 (30%), Positives = 39/80 (48%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +     P  I  G  L    A++ 
Sbjct: 95  AKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISRGASPVEIRRGVML----AIET 150

Query: 455 IQDNLTVTVESLGRPSLITQ 514
           ++DNL      +  P  I Q
Sbjct: 151 VKDNLRRLSRPVNTPEEICQ 170


>AE014134-953|AAN10550.2|  576|Drosophila melanogaster CG7235-PB,
           isoform B protein.
          Length = 576

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 24/80 (30%), Positives = 39/80 (48%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +     P  I  G  L    A++ 
Sbjct: 95  AKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISRGASPVEIRRGVML----AIET 150

Query: 455 IQDNLTVTVESLGRPSLITQ 514
           ++DNL      +  P  I Q
Sbjct: 151 VKDNLRRLSRPVNTPEEICQ 170


>AE014134-952|AAF52277.2|  576|Drosophila melanogaster CG7235-PA,
           isoform A protein.
          Length = 576

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 24/80 (30%), Positives = 39/80 (48%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +     P  I  G  L    A++ 
Sbjct: 95  AKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISRGASPVEIRRGVML----AIET 150

Query: 455 IQDNLTVTVESLGRPSLITQ 514
           ++DNL      +  P  I Q
Sbjct: 151 VKDNLRRLSRPVNTPEEICQ 170


>BT001426-1|AAN71181.1|  648|Drosophila melanogaster GH15356p
           protein.
          Length = 648

 Score = 33.9 bits (74), Expect = 0.17
 Identities = 20/71 (28%), Positives = 35/71 (49%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +E  GDGTT+  ++A  + K     +    +P  I  G  LA  + VK 
Sbjct: 89  AKLVQDVADNTNESAGDGTTTATVLARAIAKEGFNQITMGANPVEIRRGVMLAV-DVVKD 147

Query: 455 IQDNLTVTVES 487
               ++  VE+
Sbjct: 148 KLKEMSKAVET 158


>AY047544-1|AAK77276.1|  639|Drosophila melanogaster GH05807p
           protein.
          Length = 639

 Score = 33.9 bits (74), Expect = 0.17
 Identities = 20/71 (28%), Positives = 35/71 (49%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +E  GDGTT+  ++A  + K     +    +P  I  G  LA  + VK 
Sbjct: 89  AKLVQDVADNTNESAGDGTTTATVLARAIAKEGFNQITMGANPVEIRRGVMLAV-DVVKD 147

Query: 455 IQDNLTVTVES 487
               ++  VE+
Sbjct: 148 KLKEMSKAVET 158


>AE014134-140|AAF51467.1|  648|Drosophila melanogaster CG2830-PA
           protein.
          Length = 648

 Score = 33.9 bits (74), Expect = 0.17
 Identities = 20/71 (28%), Positives = 35/71 (49%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +E  GDGTT+  ++A  + K     +    +P  I  G  LA  + VK 
Sbjct: 89  AKLVQDVADNTNESAGDGTTTATVLARAIAKEGFNQITMGANPVEIRRGVMLAV-DVVKD 147

Query: 455 IQDNLTVTVES 487
               ++  VE+
Sbjct: 148 KLKEMSKAVET 158


>BT001546-1|AAN71301.1|  386|Drosophila melanogaster RE10780p
           protein.
          Length = 386

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 10/36 (27%), Positives = 15/36 (41%)
 Frame = -1

Query: 161 LYYVCYSRCCHYILCSHWVSAGSCPCYRQRCSYSRH 54
           +YY CYS     I  S W +      Y  +  + +H
Sbjct: 51  MYYACYSLYSQLIFVSDWYAGSKMTVYMDKEDFEKH 86


>AE014296-2725|AAN11751.1|  386|Drosophila melanogaster CG4729-PC,
           isoform C protein.
          Length = 386

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 10/36 (27%), Positives = 15/36 (41%)
 Frame = -1

Query: 161 LYYVCYSRCCHYILCSHWVSAGSCPCYRQRCSYSRH 54
           +YY CYS     I  S W +      Y  +  + +H
Sbjct: 51  MYYACYSLYSQLIFVSDWYAGSKMTVYMDKEDFEKH 86


>AE014296-2724|AAN11750.1|  386|Drosophila melanogaster CG4729-PB,
           isoform B protein.
          Length = 386

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 10/36 (27%), Positives = 15/36 (41%)
 Frame = -1

Query: 161 LYYVCYSRCCHYILCSHWVSAGSCPCYRQRCSYSRH 54
           +YY CYS     I  S W +      Y  +  + +H
Sbjct: 51  MYYACYSLYSQLIFVSDWYAGSKMTVYMDKEDFEKH 86


>AE014296-2723|AAF49471.1|  386|Drosophila melanogaster CG4729-PA,
           isoform A protein.
          Length = 386

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 10/36 (27%), Positives = 15/36 (41%)
 Frame = -1

Query: 161 LYYVCYSRCCHYILCSHWVSAGSCPCYRQRCSYSRH 54
           +YY CYS     I  S W +      Y  +  + +H
Sbjct: 51  MYYACYSLYSQLIFVSDWYAGSKMTVYMDKEDFEKH 86


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,553,843
Number of Sequences: 53049
Number of extensions: 499290
Number of successful extensions: 1221
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 1143
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1217
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2400202284
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -