SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30110.Seq
         (444 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY113508-1|AAM29513.1|  124|Drosophila melanogaster RE59131p pro...   118   4e-27
AE013599-889|AAM71074.1|  124|Drosophila melanogaster CG1821-PC,...   118   4e-27
AE013599-888|AAF58920.1|  124|Drosophila melanogaster CG1821-PB,...   118   4e-27
AE013599-887|AAM71073.1|  124|Drosophila melanogaster CG1821-PA,...   118   4e-27
AY095051-1|AAM11379.1| 1838|Drosophila melanogaster LD40310p pro...    28   5.0  
AE014134-1014|AAN10569.1| 1838|Drosophila melanogaster CG9088-PB...    28   5.0  
AE014134-1013|AAF52319.1| 1838|Drosophila melanogaster CG9088-PA...    28   5.0  
BT010282-1|AAQ23600.1| 1001|Drosophila melanogaster RE04457p pro...    27   8.7  
AY118429-1|AAM48458.1|  163|Drosophila melanogaster RH26504p pro...    27   8.7  
AE014298-1203|AAS65290.1| 1001|Drosophila melanogaster CG11265-P...    27   8.7  
AE014298-1202|AAS65289.1| 1029|Drosophila melanogaster CG11265-P...    27   8.7  
AE014298-1201|AAS65288.1| 1029|Drosophila melanogaster CG11265-P...    27   8.7  
AE014298-1200|AAF46390.2| 1029|Drosophila melanogaster CG11265-P...    27   8.7  
AE014296-3393|AAN12138.1|  163|Drosophila melanogaster CG5104-PB...    27   8.7  

>AY113508-1|AAM29513.1|  124|Drosophila melanogaster RE59131p
           protein.
          Length = 124

 Score =  118 bits (284), Expect = 4e-27
 Identities = 53/72 (73%), Positives = 63/72 (87%)
 Frame = +2

Query: 38  MAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIR 217
           M K KGE+  KSAINEVVTRE T++L KR+H +GFKKRAPRAIKEIRKFAE++MGT D+R
Sbjct: 1   MTKTKGEKINKSAINEVVTRECTIHLAKRVHNIGFKKRAPRAIKEIRKFAEREMGTTDVR 60

Query: 218 VDTRLNKFLWSK 253
           +DTRLNK +WSK
Sbjct: 61  IDTRLNKHIWSK 72



 Score = 61.7 bits (143), Expect = 4e-10
 Identities = 27/52 (51%), Positives = 36/52 (69%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQE 408
           G+R+ PF          NDDEDS +KL+T VTYVPV++ K LQTENV++S +
Sbjct: 73  GIRSTPFRIRVRLARRRNDDEDSPNKLYTYVTYVPVSTFKNLQTENVESSDD 124


>AE013599-889|AAM71074.1|  124|Drosophila melanogaster CG1821-PC,
           isoform C protein.
          Length = 124

 Score =  118 bits (284), Expect = 4e-27
 Identities = 53/72 (73%), Positives = 63/72 (87%)
 Frame = +2

Query: 38  MAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIR 217
           M K KGE+  KSAINEVVTRE T++L KR+H +GFKKRAPRAIKEIRKFAE++MGT D+R
Sbjct: 1   MTKTKGEKINKSAINEVVTRECTIHLAKRVHNIGFKKRAPRAIKEIRKFAEREMGTTDVR 60

Query: 218 VDTRLNKFLWSK 253
           +DTRLNK +WSK
Sbjct: 61  IDTRLNKHIWSK 72



 Score = 61.7 bits (143), Expect = 4e-10
 Identities = 27/52 (51%), Positives = 36/52 (69%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQE 408
           G+R+ PF          NDDEDS +KL+T VTYVPV++ K LQTENV++S +
Sbjct: 73  GIRSTPFRIRVRLARRRNDDEDSPNKLYTYVTYVPVSTFKNLQTENVESSDD 124


>AE013599-888|AAF58920.1|  124|Drosophila melanogaster CG1821-PB,
           isoform B protein.
          Length = 124

 Score =  118 bits (284), Expect = 4e-27
 Identities = 53/72 (73%), Positives = 63/72 (87%)
 Frame = +2

Query: 38  MAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIR 217
           M K KGE+  KSAINEVVTRE T++L KR+H +GFKKRAPRAIKEIRKFAE++MGT D+R
Sbjct: 1   MTKTKGEKINKSAINEVVTRECTIHLAKRVHNIGFKKRAPRAIKEIRKFAEREMGTTDVR 60

Query: 218 VDTRLNKFLWSK 253
           +DTRLNK +WSK
Sbjct: 61  IDTRLNKHIWSK 72



 Score = 61.7 bits (143), Expect = 4e-10
 Identities = 27/52 (51%), Positives = 36/52 (69%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQE 408
           G+R+ PF          NDDEDS +KL+T VTYVPV++ K LQTENV++S +
Sbjct: 73  GIRSTPFRIRVRLARRRNDDEDSPNKLYTYVTYVPVSTFKNLQTENVESSDD 124


>AE013599-887|AAM71073.1|  124|Drosophila melanogaster CG1821-PA,
           isoform A protein.
          Length = 124

 Score =  118 bits (284), Expect = 4e-27
 Identities = 53/72 (73%), Positives = 63/72 (87%)
 Frame = +2

Query: 38  MAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIR 217
           M K KGE+  KSAINEVVTRE T++L KR+H +GFKKRAPRAIKEIRKFAE++MGT D+R
Sbjct: 1   MTKTKGEKINKSAINEVVTRECTIHLAKRVHNIGFKKRAPRAIKEIRKFAEREMGTTDVR 60

Query: 218 VDTRLNKFLWSK 253
           +DTRLNK +WSK
Sbjct: 61  IDTRLNKHIWSK 72



 Score = 61.7 bits (143), Expect = 4e-10
 Identities = 27/52 (51%), Positives = 36/52 (69%)
 Frame = +1

Query: 253 GVRNVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQE 408
           G+R+ PF          NDDEDS +KL+T VTYVPV++ K LQTENV++S +
Sbjct: 73  GIRSTPFRIRVRLARRRNDDEDSPNKLYTYVTYVPVSTFKNLQTENVESSDD 124


>AY095051-1|AAM11379.1| 1838|Drosophila melanogaster LD40310p
           protein.
          Length = 1838

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 71  SAINEVVTREYTVNLHKRLHGVGFKKRA 154
           S+I+E VT EY  +LH   HG GF  ++
Sbjct: 554 SSIDEDVTVEYGADLHTMDHGSGFPTKS 581


>AE014134-1014|AAN10569.1| 1838|Drosophila melanogaster CG9088-PB,
           isoform B protein.
          Length = 1838

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 71  SAINEVVTREYTVNLHKRLHGVGFKKRA 154
           S+I+E VT EY  +LH   HG GF  ++
Sbjct: 554 SSIDEDVTVEYGADLHTMDHGSGFPTKS 581


>AE014134-1013|AAF52319.1| 1838|Drosophila melanogaster CG9088-PA,
           isoform A protein.
          Length = 1838

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +2

Query: 71  SAINEVVTREYTVNLHKRLHGVGFKKRA 154
           S+I+E VT EY  +LH   HG GF  ++
Sbjct: 554 SSIDEDVTVEYGADLHTMDHGSGFPTKS 581


>BT010282-1|AAQ23600.1| 1001|Drosophila melanogaster RE04457p
           protein.
          Length = 1001

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = -3

Query: 325 VRNLHHHYVFVKASHGHGREH 263
           V+ L+HH V V  +HGH   H
Sbjct: 620 VQQLYHHPVQVPTAHGHSHAH 640


>AY118429-1|AAM48458.1|  163|Drosophila melanogaster RH26504p
           protein.
          Length = 163

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = -1

Query: 306 ITSS*KPHTDTEGNISDSLDQRNLFKRVSTRMSGVPICFSANFRISLIALGARFLN 139
           + S  +P  + E +I   ++  +     STR+ G  ICF+    +SL+   A FL+
Sbjct: 7   VLSGDEPTPEEESSIITQINDMSTLSW-STRIKGFVICFALGILLSLLGSVALFLH 61


>AE014298-1203|AAS65290.1| 1001|Drosophila melanogaster CG11265-PE,
           isoform E protein.
          Length = 1001

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = -3

Query: 325 VRNLHHHYVFVKASHGHGREH 263
           V+ L+HH V V  +HGH   H
Sbjct: 620 VQQLYHHPVQVPTAHGHSHAH 640


>AE014298-1202|AAS65289.1| 1029|Drosophila melanogaster CG11265-PC,
           isoform C protein.
          Length = 1029

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = -3

Query: 325 VRNLHHHYVFVKASHGHGREH 263
           V+ L+HH V V  +HGH   H
Sbjct: 620 VQQLYHHPVQVPTAHGHSHAH 640


>AE014298-1201|AAS65288.1| 1029|Drosophila melanogaster CG11265-PB,
           isoform B protein.
          Length = 1029

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = -3

Query: 325 VRNLHHHYVFVKASHGHGREH 263
           V+ L+HH V V  +HGH   H
Sbjct: 620 VQQLYHHPVQVPTAHGHSHAH 640


>AE014298-1200|AAF46390.2| 1029|Drosophila melanogaster CG11265-PA,
           isoform A protein.
          Length = 1029

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = -3

Query: 325 VRNLHHHYVFVKASHGHGREH 263
           V+ L+HH V V  +HGH   H
Sbjct: 620 VQQLYHHPVQVPTAHGHSHAH 640


>AE014296-3393|AAN12138.1|  163|Drosophila melanogaster CG5104-PB
           protein.
          Length = 163

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 16/56 (28%), Positives = 28/56 (50%)
 Frame = -1

Query: 306 ITSS*KPHTDTEGNISDSLDQRNLFKRVSTRMSGVPICFSANFRISLIALGARFLN 139
           + S  +P  + E +I   ++  +     STR+ G  ICF+    +SL+   A FL+
Sbjct: 7   VLSGDEPTPEEESSIITQINDMSTLSW-STRIKGFVICFALGILLSLLGSVALFLH 61


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,277,249
Number of Sequences: 53049
Number of extensions: 346644
Number of successful extensions: 763
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 754
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 763
length of database: 24,988,368
effective HSP length: 78
effective length of database: 20,850,546
effective search space used: 1438687674
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -