SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30108.Seq
         (591 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY118852-1|AAM50712.1|   95|Drosophila melanogaster GM16138p pro...   113   2e-25
AE013599-7|EAA46159.1|   95|Drosophila melanogaster CG40127-PA p...   113   2e-25
AE013599-3344|AAF46807.1|  107|Drosophila melanogaster CG11269-P...    54   1e-07
BT016079-1|AAV36964.1|  922|Drosophila melanogaster LD47749p pro...    30   2.0  
AY052114-1|AAK93538.1|  922|Drosophila melanogaster SD06427p pro...    30   2.0  
AE014297-1680|AAF54941.1|  922|Drosophila melanogaster CG9799-PA...    30   2.0  
AY118539-1|AAM49908.1|  324|Drosophila melanogaster LD27322p pro...    28   8.2  
AE014297-2611|AAF55621.2|  324|Drosophila melanogaster CG6005-PA...    28   8.2  

>AY118852-1|AAM50712.1|   95|Drosophila melanogaster GM16138p
           protein.
          Length = 95

 Score =  113 bits (271), Expect = 2e-25
 Identities = 48/84 (57%), Positives = 66/84 (78%)
 Frame = +1

Query: 1   KLSLCGLVLSVWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLN 180
           KLSLCGL++SVWGI+QL LMG+F+YI +VAL+EDLP +E+   HS+EDF     + Y  N
Sbjct: 7   KLSLCGLIISVWGIVQLVLMGLFFYINSVALIEDLPLEEEY--HSLEDFYAAANRAYNQN 64

Query: 181 AQNCWIAALLYLITLVVSGHQFWL 252
           A NCWIAA +Y++TL++S  QF++
Sbjct: 65  AYNCWIAACIYVLTLLLSAQQFYM 88


>AE013599-7|EAA46159.1|   95|Drosophila melanogaster CG40127-PA
           protein.
          Length = 95

 Score =  113 bits (271), Expect = 2e-25
 Identities = 48/84 (57%), Positives = 66/84 (78%)
 Frame = +1

Query: 1   KLSLCGLVLSVWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLN 180
           KLSLCGL++SVWGI+QL LMG+F+YI +VAL+EDLP +E+   HS+EDF     + Y  N
Sbjct: 7   KLSLCGLIISVWGIVQLVLMGLFFYINSVALIEDLPLEEEY--HSLEDFYAAANRAYNQN 64

Query: 181 AQNCWIAALLYLITLVVSGHQFWL 252
           A NCWIAA +Y++TL++S  QF++
Sbjct: 65  AYNCWIAACIYVLTLLLSAQQFYM 88


>AE013599-3344|AAF46807.1|  107|Drosophila melanogaster CG11269-PA
           protein.
          Length = 107

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 26/72 (36%), Positives = 42/72 (58%)
 Frame = +1

Query: 1   KLSLCGLVLSVWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLN 180
           K  L  L +S WG + L L+G+F+Y++++ LLE LP     P  S E F  + ++ Y   
Sbjct: 6   KCCLFCLFMSAWGFLMLNLLGIFFYVQSLMLLESLPLPHHFP--SQEAFKEQADEAYQDV 63

Query: 181 AQNCWIAALLYL 216
           +  C++AA+ YL
Sbjct: 64  STRCFVAAVFYL 75


>BT016079-1|AAV36964.1|  922|Drosophila melanogaster LD47749p
           protein.
          Length = 922

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 524 LPFASNFFQHIATSHQPTYLNK 589
           +PF S  FQ  A +H PTY+NK
Sbjct: 154 VPFRSEEFQITAVTHPPTYINK 175


>AY052114-1|AAK93538.1|  922|Drosophila melanogaster SD06427p
           protein.
          Length = 922

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 524 LPFASNFFQHIATSHQPTYLNK 589
           +PF S  FQ  A +H PTY+NK
Sbjct: 154 VPFRSEEFQITAVTHPPTYINK 175


>AE014297-1680|AAF54941.1|  922|Drosophila melanogaster CG9799-PA
           protein.
          Length = 922

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 524 LPFASNFFQHIATSHQPTYLNK 589
           +PF S  FQ  A +H PTY+NK
Sbjct: 154 VPFRSEEFQITAVTHPPTYINK 175


>AY118539-1|AAM49908.1|  324|Drosophila melanogaster LD27322p
           protein.
          Length = 324

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 1/56 (1%)
 Frame = +1

Query: 73  YIRAVALLEDLPFDEKNPPHSIEDF-VIEVEKGYTLNAQNCWIAALLYLITLVVSG 237
           Y +  +L + LPFD   P H ++DF +I  E      A +    +L  LI  + SG
Sbjct: 237 YRQQQSLSDILPFDISPPGHIVDDFCIIASEANSVSQASDAQARSLKQLIRNIGSG 292


>AE014297-2611|AAF55621.2|  324|Drosophila melanogaster CG6005-PA
           protein.
          Length = 324

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 1/56 (1%)
 Frame = +1

Query: 73  YIRAVALLEDLPFDEKNPPHSIEDF-VIEVEKGYTLNAQNCWIAALLYLITLVVSG 237
           Y +  +L + LPFD   P H ++DF +I  E      A +    +L  LI  + SG
Sbjct: 237 YRQQQSLSDILPFDISPPGHIVDDFCIIASEANSVSQASDAQARSLKQLIRNIGSG 292


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,847,502
Number of Sequences: 53049
Number of extensions: 538026
Number of successful extensions: 1378
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1334
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1376
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2379510885
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -