SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30107.Seq
         (684 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY051984-1|AAK93408.1|  838|Drosophila melanogaster LD45365p pro...    32   0.64 
AF220364-1|AAF37265.1|  838|Drosophila melanogaster Plenty of SH...    32   0.64 
AE013599-2508|AAF57833.1|  838|Drosophila melanogaster CG4909-PA...    32   0.64 
AY113374-1|AAM29379.1|  609|Drosophila melanogaster LP06948p pro...    31   1.5  
AE014297-1210|AAF54562.4| 1483|Drosophila melanogaster CG4509-PB...    31   1.5  
X75541-1|CAA53229.1| 1355|Drosophila melanogaster spalt protein ...    30   2.6  
AE014134-2066|AAF53097.3| 1365|Drosophila melanogaster CG6464-PA...    30   2.6  
AY089389-1|AAL90127.1|  225|Drosophila melanogaster AT21457p pro...    29   4.5  
AE014297-2069|AAN13672.1|  225|Drosophila melanogaster CG31294-P...    29   4.5  

>AY051984-1|AAK93408.1|  838|Drosophila melanogaster LD45365p
           protein.
          Length = 838

 Score = 32.3 bits (70), Expect = 0.64
 Identities = 18/67 (26%), Positives = 36/67 (53%)
 Frame = +2

Query: 191 KSARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRRVR 370
           ++A AG+G +K ++   + E++KP+P PA+ V  P  + ++   + +S        RR  
Sbjct: 78  QNAAAGKGEEKGEETETQPERAKPQP-PAESVAPPDNQLLQLQSHQQSHQPARHKQRRFL 136

Query: 371 DLHARSI 391
             HA ++
Sbjct: 137 LPHAYAL 143


>AF220364-1|AAF37265.1|  838|Drosophila melanogaster Plenty of SH3s
           protein.
          Length = 838

 Score = 32.3 bits (70), Expect = 0.64
 Identities = 18/67 (26%), Positives = 36/67 (53%)
 Frame = +2

Query: 191 KSARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRRVR 370
           ++A AG+G +K ++   + E++KP+P PA+ V  P  + ++   + +S        RR  
Sbjct: 78  QNAAAGKGEEKGEETETQPERAKPQP-PAESVAPPDNQLLQLQSHQQSHQPARHKQRRFL 136

Query: 371 DLHARSI 391
             HA ++
Sbjct: 137 LPHAYAL 143


>AE013599-2508|AAF57833.1|  838|Drosophila melanogaster CG4909-PA
           protein.
          Length = 838

 Score = 32.3 bits (70), Expect = 0.64
 Identities = 18/67 (26%), Positives = 36/67 (53%)
 Frame = +2

Query: 191 KSARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNRRVR 370
           ++A AG+G +K ++   + E++KP+P PA+ V  P  + ++   + +S        RR  
Sbjct: 78  QNAAAGKGEEKGEETETQPERAKPQP-PAESVAPPDNQLLQLQSHQQSHQPARHKQRRFL 136

Query: 371 DLHARSI 391
             HA ++
Sbjct: 137 LPHAYAL 143


>AY113374-1|AAM29379.1|  609|Drosophila melanogaster LP06948p
           protein.
          Length = 609

 Score = 31.1 bits (67), Expect = 1.5
 Identities = 28/101 (27%), Positives = 43/101 (42%), Gaps = 3/101 (2%)
 Frame = +2

Query: 197 ARAGEGAQKEDQRSRKREQSKPEPKPAK--GVTVPTRKGIKETQNVKSXTSKVENNRRVR 370
           A AG    K  + S+  +++KP+P P +   V V   K   E +     T K  N   + 
Sbjct: 498 AAAGGKESKSGRESKTSKEAKPKPSPIRENEVKVSNSKIYVEHRGTGHPTQKQLNASTLE 557

Query: 371 DLHARSIVMLSVRLRVVVKIGRRT-VPQKXGRSSAGHRDAS 490
           D H   I M S    ++  +GRR  + +K    S  + D S
Sbjct: 558 DDHDSGIAMNS----LLNSLGRRNPIAEKKSVFSIAYDDVS 594


>AE014297-1210|AAF54562.4| 1483|Drosophila melanogaster CG4509-PB
            protein.
          Length = 1483

 Score = 31.1 bits (67), Expect = 1.5
 Identities = 28/101 (27%), Positives = 43/101 (42%), Gaps = 3/101 (2%)
 Frame = +2

Query: 197  ARAGEGAQKEDQRSRKREQSKPEPKPAK--GVTVPTRKGIKETQNVKSXTSKVENNRRVR 370
            A AG    K  + S+  +++KP+P P +   V V   K   E +     T K  N   + 
Sbjct: 1372 AAAGGKESKSGRESKTSKEAKPKPSPIRENEVKVSNSKIYVEHRGTGHPTQKQLNASTLE 1431

Query: 371  DLHARSIVMLSVRLRVVVKIGRRT-VPQKXGRSSAGHRDAS 490
            D H   I M S    ++  +GRR  + +K    S  + D S
Sbjct: 1432 DDHDSGIAMNS----LLNSLGRRNPIAEKKSVFSIAYDDVS 1468


>X75541-1|CAA53229.1| 1355|Drosophila melanogaster spalt protein
           protein.
          Length = 1355

 Score = 30.3 bits (65), Expect = 2.6
 Identities = 16/58 (27%), Positives = 27/58 (46%)
 Frame = +2

Query: 188 VKSARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNR 361
           VK+    E  Q+E+      E S+PEP+P         + ++E + VK    ++E  R
Sbjct: 605 VKNEPVEEKDQREEHEQEMAECSEPEPEPLPLEVRIKEERVEEQEQVKQEDHRIEPRR 662


>AE014134-2066|AAF53097.3| 1365|Drosophila melanogaster CG6464-PA
           protein.
          Length = 1365

 Score = 30.3 bits (65), Expect = 2.6
 Identities = 16/58 (27%), Positives = 27/58 (46%)
 Frame = +2

Query: 188 VKSARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSKVENNR 361
           VK+    E  Q+E+      E S+PEP+P         + ++E + VK    ++E  R
Sbjct: 605 VKNEPVEEKDQREEHEQEMAECSEPEPEPLPLEVRIKEERVEEQEQVKQEDHRIEPRR 662


>AY089389-1|AAL90127.1|  225|Drosophila melanogaster AT21457p
           protein.
          Length = 225

 Score = 29.5 bits (63), Expect = 4.5
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = +2

Query: 209 EGAQKEDQRSRKREQSKPEPKPAKGVTV 292
           + A K D  ++ +E+ KPE  P++GVT+
Sbjct: 25  QNANKMDTGTKGKEEKKPEVDPSEGVTI 52


>AE014297-2069|AAN13672.1|  225|Drosophila melanogaster CG31294-PA
           protein.
          Length = 225

 Score = 29.5 bits (63), Expect = 4.5
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = +2

Query: 209 EGAQKEDQRSRKREQSKPEPKPAKGVTV 292
           + A K D  ++ +E+ KPE  P++GVT+
Sbjct: 25  QNANKMDTGTKGKEEKKPEVDPSEGVTI 52


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,057,189
Number of Sequences: 53049
Number of extensions: 429899
Number of successful extensions: 1692
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1608
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1686
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2992560750
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -