SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30104.Seq
         (674 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY075573-1|AAR82741.1|  332|Drosophila melanogaster SD03439p pro...    72   8e-13
AE014134-160|AAF51451.1|  454|Drosophila melanogaster CG3862-PA ...    72   8e-13
AY128479-1|AAM75072.1| 1058|Drosophila melanogaster RE53774p pro...    29   5.8  
AF262977-1|AAF76150.1| 5233|Drosophila melanogaster highwire pro...    29   5.8  
AE014298-2087|AAF48411.3| 5233|Drosophila melanogaster CG32592-P...    29   5.8  
AE014296-225|AAF47475.2| 1058|Drosophila melanogaster CG9153-PB,...    29   5.8  
AE014296-224|AAF47474.2| 1058|Drosophila melanogaster CG9153-PA,...    29   5.8  

>AY075573-1|AAR82741.1|  332|Drosophila melanogaster SD03439p
           protein.
          Length = 332

 Score = 71.7 bits (168), Expect = 8e-13
 Identities = 33/81 (40%), Positives = 48/81 (59%)
 Frame = +2

Query: 254 HVWGFAETGALGIHLPRXXXXXXXXXXXXXLVWHPMRSSFAERFDITNIACGYGFTVASI 433
           +VWGF ETGALG+                 +V HP R  F+   +IT++A GYGFTV ++
Sbjct: 51  YVWGFQETGALGLQT----NVKKAKERYTEMVHHPTRLQFSNNNEITDVAAGYGFTVYAV 106

Query: 434 KTSEQHKVFGTGINTDSQIGY 496
              +   +FG+G+NTDSQ+G+
Sbjct: 107 NRDDGETLFGSGLNTDSQLGF 127



 Score = 31.9 bits (69), Expect = 0.82
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = +3

Query: 573 ECEIKAVAAGRAHTIILTDKEGVYT*VTMPMGQC 674
           +  +K+++AGRAH ++LT    ++T      GQC
Sbjct: 160 DMRVKSMSAGRAHLVVLTQNGTIFTLGNNSYGQC 193


>AE014134-160|AAF51451.1|  454|Drosophila melanogaster CG3862-PA
           protein.
          Length = 454

 Score = 71.7 bits (168), Expect = 8e-13
 Identities = 33/81 (40%), Positives = 48/81 (59%)
 Frame = +2

Query: 254 HVWGFAETGALGIHLPRXXXXXXXXXXXXXLVWHPMRSSFAERFDITNIACGYGFTVASI 433
           +VWGF ETGALG+                 +V HP R  F+   +IT++A GYGFTV ++
Sbjct: 47  YVWGFQETGALGLQT----NVKKAKERYTEMVHHPTRLQFSNNNEITDVAAGYGFTVYAV 102

Query: 434 KTSEQHKVFGTGINTDSQIGY 496
              +   +FG+G+NTDSQ+G+
Sbjct: 103 NRDDGETLFGSGLNTDSQLGF 123



 Score = 31.9 bits (69), Expect = 0.82
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = +3

Query: 573 ECEIKAVAAGRAHTIILTDKEGVYT*VTMPMGQC 674
           +  +K+++AGRAH ++LT    ++T      GQC
Sbjct: 156 DMRVKSMSAGRAHLVVLTQNGTIFTLGNNSYGQC 189


>AY128479-1|AAM75072.1| 1058|Drosophila melanogaster RE53774p
           protein.
          Length = 1058

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 13/44 (29%), Positives = 26/44 (59%)
 Frame = +2

Query: 389 ITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPREIIL 520
           IT +ACG   T+A + +  + +V+  G+ +  Q+G  S + ++L
Sbjct: 304 ITQVACGNRHTLALVPS--RGRVYAFGLGSSGQLGTRSTKSLML 345


>AF262977-1|AAF76150.1| 5233|Drosophila melanogaster highwire protein.
          Length = 5233

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +3

Query: 582  IKAVAAGRAHTIILTDKEGVYT*VTMPMGQ 671
            I  VAAG  HT++LT K  VYT      GQ
Sbjct: 1018 ISQVAAGSNHTVLLTSKGMVYTFGNYQKGQ 1047


>AE014298-2087|AAF48411.3| 5233|Drosophila melanogaster CG32592-PA
            protein.
          Length = 5233

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 15/30 (50%), Positives = 17/30 (56%)
 Frame = +3

Query: 582  IKAVAAGRAHTIILTDKEGVYT*VTMPMGQ 671
            I  VAAG  HT++LT K  VYT      GQ
Sbjct: 1018 ISQVAAGSNHTVLLTSKGMVYTFGNYQKGQ 1047


>AE014296-225|AAF47475.2| 1058|Drosophila melanogaster CG9153-PB,
           isoform B protein.
          Length = 1058

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 13/44 (29%), Positives = 26/44 (59%)
 Frame = +2

Query: 389 ITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPREIIL 520
           IT +ACG   T+A + +  + +V+  G+ +  Q+G  S + ++L
Sbjct: 304 ITQVACGNRHTLALVPS--RGRVYAFGLGSSGQLGTRSTKSLML 345


>AE014296-224|AAF47474.2| 1058|Drosophila melanogaster CG9153-PA,
           isoform A protein.
          Length = 1058

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 13/44 (29%), Positives = 26/44 (59%)
 Frame = +2

Query: 389 ITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPREIIL 520
           IT +ACG   T+A + +  + +V+  G+ +  Q+G  S + ++L
Sbjct: 304 ITQVACGNRHTLALVPS--RGRVYAFGLGSSGQLGTRSTKSLML 345


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,081,509
Number of Sequences: 53049
Number of extensions: 607870
Number of successful extensions: 1651
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1589
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1649
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2930645700
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -