SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30102.Seq
         (594 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z21673-1|CAA79771.1|  130|Drosophila melanogaster ribosomal prot...   133   2e-31
AY084182-1|AAL89920.1|  130|Drosophila melanogaster RE54483p pro...   133   2e-31
AE014298-1889|AAN09323.1|  130|Drosophila melanogaster CG2033-PE...   133   2e-31
AE014298-1888|AAF48257.1|  130|Drosophila melanogaster CG2033-PD...   133   2e-31
AE014298-1887|AAN09322.1|  130|Drosophila melanogaster CG2033-PC...   133   2e-31
AE014298-1886|AAF48256.1|  130|Drosophila melanogaster CG2033-PA...   133   2e-31
AY150728-1|AAN78378.1|  130|Drosophila melanogaster CG12324 prot...   132   3e-31
AY150727-1|AAN78377.1|  130|Drosophila melanogaster CG12324 prot...   132   3e-31
AY150726-1|AAN78376.1|  130|Drosophila melanogaster CG12324 prot...   132   3e-31
AY150725-1|AAN78375.1|  130|Drosophila melanogaster CG12324 prot...   132   3e-31
AY150724-1|AAN78374.1|  130|Drosophila melanogaster CG12324 prot...   132   3e-31
AY150723-1|AAN78373.1|  130|Drosophila melanogaster CG12324 prot...   132   3e-31
AY150722-1|AAN78372.1|  130|Drosophila melanogaster CG12324 prot...   132   3e-31
AY150721-1|AAN78371.1|  130|Drosophila melanogaster CG12324 prot...   132   3e-31
AY150720-1|AAN78370.1|  130|Drosophila melanogaster CG12324 prot...   132   3e-31
AY150719-1|AAN78369.1|  130|Drosophila melanogaster CG12324 prot...   132   3e-31
AY150718-1|AAN78368.1|  130|Drosophila melanogaster CG12324 prot...   132   3e-31
AY150717-1|AAN78367.1|  130|Drosophila melanogaster CG12324 prot...   132   3e-31
AY150715-1|AAN78365.1|  130|Drosophila melanogaster CG12324 prot...   132   3e-31
AY150714-1|AAN78364.1|  130|Drosophila melanogaster CG12324 prot...   132   3e-31
AY150713-1|AAN78363.1|  130|Drosophila melanogaster CG12324 prot...   132   3e-31
AY061830-1|AAL27641.1|  130|Drosophila melanogaster LD11847p pro...   132   3e-31
AE013599-1180|AAM68752.1|  130|Drosophila melanogaster CG12324-P...   132   3e-31
AY150716-1|AAN78366.1|  130|Drosophila melanogaster CG12324 prot...   132   3e-31

>Z21673-1|CAA79771.1|  130|Drosophila melanogaster ribosomal protein
           15a (40S subunit)protein.
          Length = 130

 Score =  133 bits (321), Expect = 2e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIVDDHR+GK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVDDHRSGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 93.5 bits (222), Expect = 2e-19
 Identities = 43/48 (89%), Positives = 45/48 (93%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFDVPINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDVPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AY084182-1|AAL89920.1|  130|Drosophila melanogaster RE54483p
           protein.
          Length = 130

 Score =  133 bits (321), Expect = 2e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIVDDHR+GK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVDDHRSGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 93.5 bits (222), Expect = 2e-19
 Identities = 43/48 (89%), Positives = 45/48 (93%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFDVPINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDVPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AE014298-1889|AAN09323.1|  130|Drosophila melanogaster CG2033-PE,
           isoform E protein.
          Length = 130

 Score =  133 bits (321), Expect = 2e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIVDDHR+GK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVDDHRSGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 93.5 bits (222), Expect = 2e-19
 Identities = 43/48 (89%), Positives = 45/48 (93%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFDVPINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDVPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AE014298-1888|AAF48257.1|  130|Drosophila melanogaster CG2033-PD,
           isoform D protein.
          Length = 130

 Score =  133 bits (321), Expect = 2e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIVDDHR+GK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVDDHRSGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 93.5 bits (222), Expect = 2e-19
 Identities = 43/48 (89%), Positives = 45/48 (93%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFDVPINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDVPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AE014298-1887|AAN09322.1|  130|Drosophila melanogaster CG2033-PC,
           isoform C protein.
          Length = 130

 Score =  133 bits (321), Expect = 2e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIVDDHR+GK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVDDHRSGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 93.5 bits (222), Expect = 2e-19
 Identities = 43/48 (89%), Positives = 45/48 (93%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFDVPINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDVPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AE014298-1886|AAF48256.1|  130|Drosophila melanogaster CG2033-PA,
           isoform A protein.
          Length = 130

 Score =  133 bits (321), Expect = 2e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIVDDHR+GK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVDDHRSGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 93.5 bits (222), Expect = 2e-19
 Identities = 43/48 (89%), Positives = 45/48 (93%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFDVPINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDVPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AY150728-1|AAN78378.1|  130|Drosophila melanogaster CG12324 protein
           protein.
          Length = 130

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIV+DHRAGK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 91.9 bits (218), Expect = 6e-19
 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFD PINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AY150727-1|AAN78377.1|  130|Drosophila melanogaster CG12324 protein
           protein.
          Length = 130

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIV+DHRAGK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 91.9 bits (218), Expect = 6e-19
 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFD PINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AY150726-1|AAN78376.1|  130|Drosophila melanogaster CG12324 protein
           protein.
          Length = 130

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIV+DHRAGK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 91.9 bits (218), Expect = 6e-19
 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFD PINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AY150725-1|AAN78375.1|  130|Drosophila melanogaster CG12324 protein
           protein.
          Length = 130

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIV+DHRAGK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 91.9 bits (218), Expect = 6e-19
 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFD PINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AY150724-1|AAN78374.1|  130|Drosophila melanogaster CG12324 protein
           protein.
          Length = 130

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIV+DHRAGK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 91.9 bits (218), Expect = 6e-19
 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFD PINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AY150723-1|AAN78373.1|  130|Drosophila melanogaster CG12324 protein
           protein.
          Length = 130

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIV+DHRAGK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 91.9 bits (218), Expect = 6e-19
 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFD PINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AY150722-1|AAN78372.1|  130|Drosophila melanogaster CG12324 protein
           protein.
          Length = 130

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIV+DHRAGK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 91.9 bits (218), Expect = 6e-19
 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFD PINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AY150721-1|AAN78371.1|  130|Drosophila melanogaster CG12324 protein
           protein.
          Length = 130

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIV+DHRAGK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 91.9 bits (218), Expect = 6e-19
 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFD PINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AY150720-1|AAN78370.1|  130|Drosophila melanogaster CG12324 protein
           protein.
          Length = 130

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIV+DHRAGK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 91.9 bits (218), Expect = 6e-19
 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFD PINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AY150719-1|AAN78369.1|  130|Drosophila melanogaster CG12324 protein
           protein.
          Length = 130

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIV+DHRAGK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 91.9 bits (218), Expect = 6e-19
 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFD PINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AY150718-1|AAN78368.1|  130|Drosophila melanogaster CG12324 protein
           protein.
          Length = 130

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIV+DHRAGK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 91.9 bits (218), Expect = 6e-19
 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFD PINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AY150717-1|AAN78367.1|  130|Drosophila melanogaster CG12324 protein
           protein.
          Length = 130

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIV+DHRAGK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 91.9 bits (218), Expect = 6e-19
 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFD PINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AY150715-1|AAN78365.1|  130|Drosophila melanogaster CG12324 protein
           protein.
          Length = 130

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIV+DHRAGK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 91.9 bits (218), Expect = 6e-19
 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFD PINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AY150714-1|AAN78364.1|  130|Drosophila melanogaster CG12324 protein
           protein.
          Length = 130

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIV+DHRAGK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 91.9 bits (218), Expect = 6e-19
 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFD PINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AY150713-1|AAN78363.1|  130|Drosophila melanogaster CG12324 protein
           protein.
          Length = 130

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIV+DHRAGK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 91.9 bits (218), Expect = 6e-19
 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFD PINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AY061830-1|AAL27641.1|  130|Drosophila melanogaster LD11847p
           protein.
          Length = 130

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIV+DHRAGK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 91.9 bits (218), Expect = 6e-19
 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFD PINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AE013599-1180|AAM68752.1|  130|Drosophila melanogaster CG12324-PA
           protein.
          Length = 130

 Score =  132 bits (320), Expect = 3e-31
 Identities = 62/69 (89%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMNVL+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIV+DHRAGK
Sbjct: 1   MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 91.9 bits (218), Expect = 6e-19
 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFD PINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


>AY150716-1|AAN78366.1|  130|Drosophila melanogaster CG12324 protein
           protein.
          Length = 130

 Score =  132 bits (319), Expect = 3e-31
 Identities = 61/69 (88%), Positives = 67/69 (97%)
 Frame = -3

Query: 463 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMXHGYIGEFEIVDDHRAGK 284
           MVRMN+L+DALK I+NAEKRGKRQVL+RPCSKVI+KFLTVMM HGYIGEFEIV+DHRAGK
Sbjct: 1   MVRMNILADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGK 60

Query: 283 IVVNLTGRL 257
           IVVNLTGRL
Sbjct: 61  IVVNLTGRL 69



 Score = 91.9 bits (218), Expect = 6e-19
 Identities = 42/48 (87%), Positives = 44/48 (91%), Gaps = 1/48 (2%)
 Frame = -2

Query: 254 KCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLXTSGGIMXHEEARR 114
           KCGVISPRFD PINDIE+WTN LLPSRQFGY+VL TSGGIM HEEARR
Sbjct: 71  KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARR 118


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,170,377
Number of Sequences: 53049
Number of extensions: 381291
Number of successful extensions: 636
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 584
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 612
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2400202284
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -